F412863

General Info

Members Datasets Scaffolds Average Seq Length
336 247 672 195

Family's Representative Sequence

Representative Sequence 3300053123|Ga0500614_006403|Ga0500614_006403_75_644
Length 189
Sequence MSDEEDRPRASFTAFSQGTPADWDIIGAEFVRFAGGLPDRVLEHLMLLGQGHGGFPIDRLTHSLQTATMAHDDGRDEEYVVCALLHDIGDSLGTYNHPEVAAAILGPFVSDENRWMVEKHGIFQSHHMFQSVLDRDPRDALRSHRFYARAEDFSVRYDNRAFDPNRPNRPLAFFEPMVQRLFARPRRAG

Samples

Sample ID Description Type Environment
1 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
9 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
10 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
82 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
83 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
130 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
133 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
148 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
152 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
155 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
156 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
157 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
158 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
159 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
160 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
161 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
162 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
163 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
166 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
167 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
168 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
179 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
185 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
195 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
196 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
197 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
198 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
199 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
200 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
201 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
202 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
203 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
204 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
216 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
220 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
221 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
222 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
223 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
224 2511231017 Pseudomonas sp. GM55 Isolate Nodule
225 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
226 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
227 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
228 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
229 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
230 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
231 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
232 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
233 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
234 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
235 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
236 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
237 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
238 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
239 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
240 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
241 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
242 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
243 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
244 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
245 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
246 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
247 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 92.26
Metatranscriptomes 0.6
Isolates 7.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.9
Nodule 0.3
Rhizoplane 5.95
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500614_006403 3300053123 Bacteria 2475
2 JGI25150J39212_1000195 3300002774 Bacteria 33776
3 JGI25151J46595_10042355 3300003187 Bacteria 1641
4 JGI25153J46596_10000208 3300003215 Bacteria 53467
5 rootH2_10264734 3300003320 Bacteria 2740
6 Ga0055537_1006245 3300003773 Bacteria 3056
7 Ga0055536_1011468 3300003781 Bacteria 3395
8 Ga0055540_1001676 3300003792 Bacteria 12815
9 Ga0055531_10000001 3300003794 Bacteria 543586
10 Ga0055531_10000010 3300003794 Bacteria 206117
11 Ga0058859_10010417 3300004798 Bacteria 715
12 Ga0065704_10148096 3300005289 Bacteria 1453
13 Ga0070690_100008033 3300005330 Bacteria 6058
14 Ga0070670_100066352 3300005331 Bacteria 3096
15 Ga0070670_100122329 3300005331 Bacteria 2245
16 Ga0070677_10099475 3300005333 Bacteria 1280
17 Ga0070689_100119890 3300005340 Bacteria 2100
18 Ga0070668_100045700 3300005347 Bacteria 3360
19 Ga0070668_100278218 3300005347 Bacteria 1397
20 Ga0070669_100062201 3300005353 Bacteria 2744
21 Ga0070669_100331427 3300005353 Bacteria 1231
22 Ga0070671_100252826 3300005355 Bacteria 1497
23 Ga0070671_100352333 3300005355 Bacteria 1256
24 Ga0070671_100740259 3300005355 Bacteria 854
25 Ga0070674_100494991 3300005356 Bacteria 1017
26 Ga0070673_100096572 3300005364 Bacteria 2425
27 Ga0070688_100388202 3300005365 Bacteria 1031
28 Ga0070659_100123507 3300005366 Bacteria 2099
29 Ga0070667_100313202 3300005367 Bacteria 1415
30 Ga0070667_100622124 3300005367 Bacteria 996
31 Ga0070703_10068573 3300005406 Bacteria 1179
32 Ga0070705_100182399 3300005440 Bacteria 1423
33 Ga0070663_100719599 3300005455 Bacteria 850
34 Ga0070678_100570953 3300005456 Bacteria 1006
35 Ga0070662_100146080 3300005457 Bacteria 1837
36 Ga0070681_10913025 3300005458 Bacteria 797
37 Ga0068867_100069726 3300005459 Bacteria 2626
38 Ga0070698_100700483 3300005471 Bacteria 955
39 Ga0070699_100411286 3300005518 Bacteria 1224
40 Ga0070679_100773978 3300005530 Bacteria 903
41 Ga0068853_100031358 3300005539 Bacteria 4496
42 Ga0070672_100012287 3300005543 Bacteria 6004
43 Ga0070672_100053781 3300005543 Bacteria 3149
44 Ga0070695_100053747 3300005545 Bacteria 2591
45 Ga0070696_100075441 3300005546 Bacteria 2379
46 Ga0068855_100000772 3300005563 Bacteria 39468
47 Ga0068857_100136362 3300005577 Bacteria 2216
48 Ga0068856_100960638 3300005614 Bacteria 873
49 Ga0068852_101051602 3300005616 Bacteria 833
50 Ga0068859_100237582 3300005617 Bacteria 1911
51 Ga0068864_100507634 3300005618 Bacteria 1161
52 Ga0068861_100011778 3300005719 Bacteria 6085
53 Ga0068851_10116032 3300005834 Bacteria 1434
54 Ga0068863_100005774 3300005841 Bacteria 12134
55 Ga0068862_100048481 3300005844 Bacteria 3626
56 Ga0068862_100407600 3300005844 Bacteria 1273
57 Ga0070717_10041917 3300006028 Bacteria 3733
58 Ga0070717_10138764 3300006028 Bacteria 2096
59 Ga0075363_100016581 3300006048 Bacteria 3641
60 Ga0075364_10067152 3300006051 Bacteria 2357
61 Ga0075362_10289769 3300006177 Bacteria 811
62 Ga0075367_10092870 3300006178 Bacteria 1838
63 Ga0097621_100218385 3300006237 Bacteria 1660
64 Ga0075370_10004326 3300006353 Bacteria 6884
65 Ga0068871_100272239 3300006358 Bacteria 1479
66 Ga0068871_100841876 3300006358 Bacteria 847
67 Ga0075428_100117115 3300006844 Bacteria 2902
68 Ga0068865_100690532 3300006881 Bacteria 871
69 Ga0075436_100013150 3300006914 Bacteria 5676
70 Ga0097620_100237577 3300006931 Bacteria 1911
71 Ga0075435_100097332 3300007076 Unclassified 2435
72 Ga0099795_10000002 3300007788 Bacteria 161112
73 Ga0105240_10029247 3300009093 Bacteria 7184
74 Ga0111539_11012836 3300009094 Bacteria 966
75 Ga0105245_10186298 3300009098 Bacteria 1986
76 Ga0105247_10001647 3300009101 Bacteria 15782
77 Ga0114129_10082269 3300009147 Bacteria 4474
78 Ga0105243_11120720 3300009148 Bacteria 796
79 Ga0105248_11090342 3300009177 Bacteria 902
80 Ga0105238_10043338 3300009551 Bacteria 4553
81 Ga0105238_11441195 3300009551 Bacteria 716
82 Ga0105249_10158555 3300009553 Bacteria 2185
83 Ga0105249_10210400 3300009553 Bacteria 1908
84 Ga0105249_11171780 3300009553 Bacteria 839
85 Ga0099796_10000004 3300010159 Bacteria 77538
86 Ga0105239_10229246 3300010375 Bacteria 2084
87 Ga0157373_10287222 3300013100 Bacteria 1166
88 Ga0157374_10752915 3300013296 Bacteria 989
89 Ga0157372_10472449 3300013307 Bacteria 1462
90 Ga0157375_10779508 3300013308 Bacteria 1106
91 Ga0163163_11185022 3300014325 Bacteria 826
92 Ga0157380_10014575 3300014326 Bacteria 5755
93 Ga0157380_10088710 3300014326 Bacteria 2546
94 Ga0157380_10531014 3300014326 Bacteria 1150
95 Ga0157380_10608933 3300014326 Bacteria 1082
96 Ga0157380_11125521 3300014326 Bacteria 825
97 Ga0157379_11052081 3300014968 Bacteria 778
98 Ga0224712_10116163 3300022467 Unclassified 1153
99 Ga0207425_1000025 3300025245 Bacteria 321872
100 Ga0209129_1001489 3300025258 Bacteria 13016
101 Ga0209565_1000209 3300025263 Bacteria 68237
102 Ga0209673_1012397 3300025273 Bacteria 3435
103 Ga0209676_1003373 3300025292 Bacteria 9929
104 Ga0209025_1000630 3300025294 Bacteria 62487
105 Ga0209564_1000745 3300025295 Bacteria 46163
106 Ga0209758_1000002 3300025297 Bacteria 1400310
107 Ga0209758_1000108 3300025297 Bacteria 216541
108 Ga0209050_1000001 3300025298 Bacteria 3563507
109 Ga0209050_1012429 3300025298 Bacteria 3903
110 Ga0209050_1019709 3300025298 Bacteria 2547
111 Ga0209051_1000699 3300025303 Bacteria 36947
112 Ga0209257_1000033 3300025304 Bacteria 671006
113 Ga0209257_1016065 3300025304 Bacteria 3057
114 Ga0207656_10031198 3300025321 Bacteria 2206
115 Ga0207682_10139842 3300025893 Bacteria 1086
116 Ga0207710_10000860 3300025900 Bacteria 16332
117 Ga0207705_10190921 3300025909 Bacteria 1549
118 Ga0207684_10011340 3300025910 Bacteria 7802
119 Ga0207707_10101572 3300025912 Bacteria 2514
120 Ga0207695_10074851 3300025913 Bacteria 3446
121 Ga0207671_10135067 3300025914 Bacteria 1896
122 Ga0207652_10297840 3300025921 Bacteria 1456
123 Ga0207646_10285325 3300025922 Bacteria 1492
124 Ga0207681_10029693 3300025923 Bacteria 3556
125 Ga0207681_10118063 3300025923 Bacteria 1941
126 Ga0207694_10069938 3300025924 Bacteria 2742
127 Ga0207650_10005640 3300025925 Bacteria 8546
128 Ga0207650_10043201 3300025925 Bacteria 3308
129 Ga0207687_10136720 3300025927 Bacteria 1854
130 Ga0207644_10104169 3300025931 Bacteria 2136
131 Ga0207706_10065877 3300025933 Bacteria 3189
132 Ga0207670_10320152 3300025936 Bacteria 1220
133 Ga0207691_10459993 3300025940 Bacteria 1082
134 Ga0207689_10119268 3300025942 Bacteria 2170
135 Ga0207667_10007188 3300025949 Bacteria 13431
136 Ga0207651_10072200 3300025960 Bacteria 2449
137 Ga0207712_10105324 3300025961 Bacteria 2105
138 Ga0207712_10350348 3300025961 Bacteria 1227
139 Ga0207668_10179794 3300025972 Bacteria 1667
140 Ga0207640_10464750 3300025981 Bacteria 1046
141 Ga0207658_10332247 3300025986 Bacteria 1319
142 Ga0207658_10343286 3300025986 Bacteria 1298
143 Ga0207658_10423083 3300025986 Bacteria 1175
144 Ga0207639_10031987 3300026041 Bacteria 3870
145 Ga0207702_11025750 3300026078 Bacteria 819
146 Ga0207641_10030661 3300026088 Bacteria 4455
147 Ga0207648_10060997 3300026089 Bacteria 3289
148 Ga0207675_100102852 3300026118 Bacteria 2692
149 Ga0207683_10477032 3300026121 Bacteria 1151
150 Ga0209179_1000003 3300027512 Bacteria 121837
151 Ga0209982_1007185 3300027552 Bacteria 1627
152 Ga0307515_10022360 3300028794 Bacteria 11146
153 Ga0265338_10017848 3300028800 Bacteria 7628
154 Ga0316182_1101815 3300030745 Bacteria 1975
155 Ga0265332_10009183 3300031238 Bacteria 4422
156 Ga0265325_10177670 3300031241 Bacteria 993
157 Ga0307509_10098288 3300031507 Bacteria 2972
158 Ga0307509_10212103 3300031507 Bacteria 1759
159 Ga0307408_100000581 3300031548 Bacteria 31371
160 Ga0307408_100177453 3300031548 Bacteria 1705
161 Ga0307408_100390172 3300031548 Bacteria 1193
162 Ga0307408_101020310 3300031548 Bacteria 763
163 Ga0307508_10001570 3300031616 Bacteria 25499
164 Ga0307508_10025419 3300031616 Bacteria 5370
165 Ga0307508_10135619 3300031616 Bacteria 2064
166 Ga0307514_10011549 3300031649 Bacteria 7342
167 Ga0307516_10013033 3300031730 Bacteria 8903
168 Ga0307516_10018121 3300031730 Bacteria 7321
169 Ga0307516_10066867 3300031730 Bacteria 3465
170 Ga0307516_10085101 3300031730 Bacteria 3000
171 Ga0307405_10149021 3300031731 Bacteria 1642
172 Ga0307413_10028268 3300031824 Bacteria 3120
173 Ga0307413_10139596 3300031824 Bacteria 1672
174 Ga0307413_10194003 3300031824 Bacteria 1460
175 Ga0307413_10661234 3300031824 Bacteria 863
176 Ga0307410_10022894 3300031852 Bacteria 3872
177 Ga0307410_10053791 3300031852 Bacteria 2726
178 Ga0307410_10084024 3300031852 Bacteria 2243
179 Ga0307410_10121623 3300031852 Bacteria 1904
180 Ga0307410_10392871 3300031852 Bacteria 1119
181 Ga0307407_10042664 3300031903 Bacteria 2545
182 Ga0307407_10150570 3300031903 Bacteria 1511
183 Ga0307407_10321064 3300031903 Bacteria 1087
184 Ga0307412_10074705 3300031911 Bacteria 2323
185 Ga0307412_10285099 3300031911 Bacteria 1298
186 Ga0307409_100068728 3300031995 Bacteria 2803
187 Ga0307409_100159909 3300031995 Bacteria 1968
188 Ga0307409_100219823 3300031995 Bacteria 1714
189 Ga0307409_100520296 3300031995 Bacteria 1162
190 Ga0307409_100544430 3300031995 Bacteria 1138
191 Ga0307409_100663898 3300031995 Bacteria 1038
192 Ga0307409_101112697 3300031995 Bacteria 811
193 Ga0307416_100185792 3300032002 Bacteria 1953
194 Ga0307416_101159765 3300032002 Bacteria 878
195 Ga0307414_10000602 3300032004 Bacteria 18524
196 Ga0307414_10007591 3300032004 Bacteria 6100
197 Ga0307414_10165456 3300032004 Bacteria 1762
198 Ga0307414_10166400 3300032004 Bacteria 1758
199 Ga0307414_10208739 3300032004 Bacteria 1594
200 Ga0307414_10312525 3300032004 Bacteria 1334
201 Ga0307414_10344484 3300032004 Bacteria 1277
202 Ga0307414_10649079 3300032004 Bacteria 951
203 Ga0307411_10001709 3300032005 Bacteria 9218
204 Ga0307411_10009215 3300032005 Bacteria 5173
205 Ga0307411_10038136 3300032005 Bacteria 3028
206 Ga0307411_10058375 3300032005 Bacteria 2553
207 Ga0307411_10077140 3300032005 Bacteria 2280
208 Ga0307411_10083736 3300032005 Bacteria 2204
209 Ga0307411_10092745 3300032005 Bacteria 2113
210 Ga0307411_10102572 3300032005 Bacteria 2027
211 Ga0307411_10220669 3300032005 Bacteria 1470
212 Ga0307415_100019734 3300032126 Bacteria 4098
213 Ga0307415_100676622 3300032126 Bacteria 928
214 Ga0307415_101223819 3300032126 Bacteria 708
215 Ga0307507_10292047 3300033179 Bacteria 1008
216 Ga0373936_0000002 3300035113 Bacteria 452874
217 Ga0373961_0000105 3300035241 Bacteria 44080
218 Ga0316574_0028118 3300035398 Bacteria 3390
219 Ga0373937_0675750 3300036401 Bacteria 979
220 Ga0395905_0092882 3300037471 Bacteria 2830
221 Ga0395905_0749554 3300037471 Bacteria 879
222 Ga0439447_000230 3300041407 Bacteria 19716
223 Ga0439466_0002200 3300041411 Bacteria 7630
224 Ga0451793_0625347 3300041452 Bacteria 1623
225 Ga0451849_1304009 3300041505 Bacteria 924
226 Ga0439431_0020422 3300041997 Bacteria 1582
227 Ga0439443_011956 3300042003 Bacteria 1279
228 Ga0439449_0206964 3300042007 Bacteria 735
229 Ga0439452_052300 3300042010 Bacteria 932
230 Ga0439456_000027 3300042013 Bacteria 54335
231 Ga0439462_0081551 3300042015 Bacteria 884
232 Ga0450889_016879 3300042144 Bacteria 790
233 Ga0439434_0184789 3300042435 Bacteria 699
234 Ga0450893_0005353 3300042532 Bacteria 2061
235 Ga0466961_0302813 3300044693 Bacteria 976
236 Ga0453684_1331856 3300044712 Bacteria 748
237 Ga0466960_0355449 3300044901 Bacteria 836
238 Ga0495617_031375 3300046452 Bacteria 1784
239 Ga0495629_0317134 3300046459 Bacteria 1066
240 Ga0495653_0158976 3300046463 Bacteria 1570
241 Ga0495650_0001788 3300046471 Bacteria 19451
242 Ga0495582_0004652 3300046473 Bacteria 7717
243 Ga0495594_0133472 3300046499 Bacteria 1406
244 Ga0495594_0239976 3300046499 Bacteria 1033
245 Ga0495596_0068518 3300046500 Bacteria 1379
246 Ga0495628_0301457 3300046516 Bacteria 1186
247 Ga0495630_0201584 3300046517 Bacteria 1518
248 Ga0495630_0234214 3300046517 Bacteria 1403
249 Ga0495648_0011151 3300046524 Bacteria 6793
250 Ga0495648_0088280 3300046524 Bacteria 1743
251 Ga0495648_0291750 3300046524 Bacteria 768
252 Ga0495663_0002744 3300046525 Bacteria 5215
253 Ga0495666_0133077 3300046526 Bacteria 1161
254 Ga0495587_0037895 3300046536 Bacteria 2892
255 Ga0495598_0057316 3300046537 Bacteria 1192
256 Ga0495598_0068527 3300046537 Bacteria 1112
257 Ga0495609_0063326 3300046538 Bacteria 1632
258 Ga0495621_0023211 3300046539 Bacteria 2062
259 Ga0495645_0146251 3300046543 Bacteria 1646
260 Ga0495633_0094501 3300046558 Bacteria 1389
261 Ga0495656_0205594 3300046615 Bacteria 979
262 Ga0495635_0005882 3300046663 Bacteria 8550
263 Ga0495659_0059108 3300046664 Bacteria 1412
264 Ga0495659_0199451 3300046664 Bacteria 820
265 Ga0495646_0018341 3300046680 Bacteria 4432
266 Ga0495658_0423179 3300046683 Bacteria 850
267 Ga0495669_0382247 3300046684 Bacteria 681
268 Ga0495613_0020167 3300046689 Bacteria 4967
269 Ga0495670_0022580 3300046691 Bacteria 3107
270 Ga0495670_0033958 3300046691 Bacteria 2539
271 Ga0495670_0044031 3300046691 Bacteria 2228
272 Ga0495670_0098243 3300046691 Bacteria 1505
273 Ga0495604_0228858 3300047317 Bacteria 1276
274 Ga0495636_0007063 3300047318 Bacteria 4417
275 Ga0495636_0081171 3300047318 Bacteria 1397
276 Ga0495636_0101842 3300047318 Bacteria 1257
277 Ga0495672_0064052 3300047320 Bacteria 2106
278 Ga0495680_0007570 3300047322 Bacteria 9929
279 Ga0495687_000808 3300047443 Bacteria 33677
280 Ga0495675_0000981 3300047444 Bacteria 17308
281 Ga0495685_074267 3300047447 Bacteria 1137
282 Ga0495673_0042059 3300047469 Bacteria 2054
283 Ga0495673_0086581 3300047469 Bacteria 1287
284 Ga0495681_0029055 3300047470 Bacteria 2835
285 Ga0495681_0187132 3300047470 Bacteria 847
286 Ga0495593_0054930 3300047673 Bacteria 2098
287 Ga0495614_0278181 3300048089 Bacteria 770
288 Ga0495615_0139713 3300048090 Bacteria 714
289 Ga0496108_0411356 3300048911 Bacteria 1181
290 Ga0496109_0026309 3300048912 Bacteria 5188
291 Ga0496109_0339584 3300048912 Bacteria 1418
292 Ga0496112_0009658 3300048915 Bacteria 8706
293 Ga0496121_0000374 3300048924 Bacteria 92048
294 Ga0501068_0392682 3300049584 Bacteria 894
295 Ga0501069_0000498 3300049585 Bacteria 17879
296 Ga0501070_0000026 3300049586 Bacteria 150349
297 Ga0501071_0005619 3300049587 Bacteria 8081
298 Ga0501217_138119 3300049661 Bacteria 720
299 Ga0501080_0002679 3300049742 Bacteria 15590
300 nmdc:mga0k408_428527_c1 3300050493 Bacteria 786
301 nmdc:mga0k408_471830_c1 3300050493 Bacteria 744
302 nmdc:mga07m45_13804_c1 3300050496 Bacteria 3557
303 nmdc:mga07m45_208457_c1 3300050496 Bacteria 1137
304 nmdc:mga07m45_9479_c1 3300050496 Bacteria 5053
305 nmdc:mga0a205_380214_c1 3300050515 Unclassified 1277
306 nmdc:mga0a205_48775_c1 3300050515 Bacteria 4087
307 nmdc:mga0sz30_183988_c1 3300050516 Bacteria 927
308 Ga0500651_0055194 3300053093 Bacteria 2489
309 Ga0500553_212386 3300053101 Bacteria 644
310 Ga0500595_000943 3300053119 Bacteria 16406
311 Ga0500603_031817 3300053150 Bacteria 1366
312 Ga0500636_0111537 3300053177 Bacteria 1545
313 2511334457 2511231017 Bacteria 6503007
314 2555668564 2554235341 Bacteria 6867980
315 2599356936 2599185160 Bacteria 6844013
316 2599362277 2599185161 Bacteria 6960462
317 2599368597 2599185162 Bacteria 6957254
318 2599375386 2599185163 Bacteria 6995158
319 2599382041 2599185164 Bacteria 6841688
320 2599388488 2599185165 Bacteria 6843250
321 2599394244 2599185166 Bacteria 6959206
322 2599406009 2599185168 Bacteria 6997636
323 2599464559 2599185181 Bacteria 6844519
324 2599468883 2599185182 Bacteria 6883168
325 2599493582 2599185186 Bacteria 6831633
326 2600216836 2599185356 Bacteria 6843884
327 2601776567 2600255313 Bacteria 6842543
328 2643952464 2643221589 Bacteria 6250934
329 2644022226 2643221602 Bacteria 6249926
330 2671098916 2667528171 Bacteria 6900659
331 2739200748 2738543004 Bacteria 6381073
332 2819704037 2818991464 Bacteria 6907494
333 2858699890 2858688981 Bacteria 8184122
334 2917072335 2917070673 Bacteria 6868303
335 2935354499 2935353572 Unclassified 6955622
336 637318925 637000220 Bacteria 7074893
337 Ga0500614_006403
338 JGI25150J39212_1000195
339 JGI25151J46595_10042355
340 JGI25153J46596_10000208
341 rootH2_10264734
342 Ga0055537_1006245
343 Ga0055536_1011468
344 Ga0055540_1001676
345 Ga0055531_10000001
346 Ga0055531_10000010
347 Ga0058859_10010417
348 Ga0065704_10148096
349 Ga0070690_100008033
350 Ga0070670_100066352
351 Ga0070670_100122329
352 Ga0070677_10099475
353 Ga0070689_100119890
354 Ga0070668_100045700
355 Ga0070668_100278218
356 Ga0070669_100062201
357 Ga0070669_100331427
358 Ga0070671_100252826
359 Ga0070671_100352333
360 Ga0070671_100740259
361 Ga0070674_100494991
362 Ga0070673_100096572
363 Ga0070688_100388202
364 Ga0070659_100123507
365 Ga0070667_100313202
366 Ga0070667_100622124
367 Ga0070703_10068573
368 Ga0070705_100182399
369 Ga0070663_100719599
370 Ga0070678_100570953
371 Ga0070662_100146080
372 Ga0070681_10913025
373 Ga0068867_100069726
374 Ga0070698_100700483
375 Ga0070699_100411286
376 Ga0070679_100773978
377 Ga0068853_100031358
378 Ga0070672_100012287
379 Ga0070672_100053781
380 Ga0070695_100053747
381 Ga0070696_100075441
382 Ga0068855_100000772
383 Ga0068857_100136362
384 Ga0068856_100960638
385 Ga0068852_101051602
386 Ga0068859_100237582
387 Ga0068864_100507634
388 Ga0068861_100011778
389 Ga0068851_10116032
390 Ga0068863_100005774
391 Ga0068862_100048481
392 Ga0068862_100407600
393 Ga0070717_10041917
394 Ga0070717_10138764
395 Ga0075363_100016581
396 Ga0075364_10067152
397 Ga0075362_10289769
398 Ga0075367_10092870
399 Ga0097621_100218385
400 Ga0075370_10004326
401 Ga0068871_100272239
402 Ga0068871_100841876
403 Ga0075428_100117115
404 Ga0068865_100690532
405 Ga0075436_100013150
406 Ga0097620_100237577
407 Ga0075435_100097332
408 Ga0099795_10000002
409 Ga0105240_10029247
410 Ga0111539_11012836
411 Ga0105245_10186298
412 Ga0105247_10001647
413 Ga0114129_10082269
414 Ga0105243_11120720
415 Ga0105248_11090342
416 Ga0105238_10043338
417 Ga0105238_11441195
418 Ga0105249_10158555
419 Ga0105249_10210400
420 Ga0105249_11171780
421 Ga0099796_10000004
422 Ga0105239_10229246
423 Ga0157373_10287222
424 Ga0157374_10752915
425 Ga0157372_10472449
426 Ga0157375_10779508
427 Ga0163163_11185022
428 Ga0157380_10014575
429 Ga0157380_10088710
430 Ga0157380_10531014
431 Ga0157380_10608933
432 Ga0157380_11125521
433 Ga0157379_11052081
434 Ga0224712_10116163
435 Ga0207425_1000025
436 Ga0209129_1001489
437 Ga0209565_1000209
438 Ga0209673_1012397
439 Ga0209676_1003373
440 Ga0209025_1000630
441 Ga0209564_1000745
442 Ga0209758_1000002
443 Ga0209758_1000108
444 Ga0209050_1000001
445 Ga0209050_1012429
446 Ga0209050_1019709
447 Ga0209051_1000699
448 Ga0209257_1000033
449 Ga0209257_1016065
450 Ga0207656_10031198
451 Ga0207682_10139842
452 Ga0207710_10000860
453 Ga0207705_10190921
454 Ga0207684_10011340
455 Ga0207707_10101572
456 Ga0207695_10074851
457 Ga0207671_10135067
458 Ga0207652_10297840
459 Ga0207646_10285325
460 Ga0207681_10029693
461 Ga0207681_10118063
462 Ga0207694_10069938
463 Ga0207650_10005640
464 Ga0207650_10043201
465 Ga0207687_10136720
466 Ga0207644_10104169
467 Ga0207706_10065877
468 Ga0207670_10320152
469 Ga0207691_10459993
470 Ga0207689_10119268
471 Ga0207667_10007188
472 Ga0207651_10072200
473 Ga0207712_10105324
474 Ga0207712_10350348
475 Ga0207668_10179794
476 Ga0207640_10464750
477 Ga0207658_10332247
478 Ga0207658_10343286
479 Ga0207658_10423083
480 Ga0207639_10031987
481 Ga0207702_11025750
482 Ga0207641_10030661
483 Ga0207648_10060997
484 Ga0207675_100102852
485 Ga0207683_10477032
486 Ga0209179_1000003
487 Ga0209982_1007185
488 Ga0307515_10022360
489 Ga0265338_10017848
490 Ga0316182_1101815
491 Ga0265332_10009183
492 Ga0265325_10177670
493 Ga0307509_10098288
494 Ga0307509_10212103
495 Ga0307408_100000581
496 Ga0307408_100177453
497 Ga0307408_100390172
498 Ga0307408_101020310
499 Ga0307508_10001570
500 Ga0307508_10025419
501 Ga0307508_10135619
502 Ga0307514_10011549
503 Ga0307516_10013033
504 Ga0307516_10018121
505 Ga0307516_10066867
506 Ga0307516_10085101
507 Ga0307405_10149021
508 Ga0307413_10028268
509 Ga0307413_10139596
510 Ga0307413_10194003
511 Ga0307413_10661234
512 Ga0307410_10022894
513 Ga0307410_10053791
514 Ga0307410_10084024
515 Ga0307410_10121623
516 Ga0307410_10392871
517 Ga0307407_10042664
518 Ga0307407_10150570
519 Ga0307407_10321064
520 Ga0307412_10074705
521 Ga0307412_10285099
522 Ga0307409_100068728
523 Ga0307409_100159909
524 Ga0307409_100219823
525 Ga0307409_100520296
526 Ga0307409_100544430
527 Ga0307409_100663898
528 Ga0307409_101112697
529 Ga0307416_100185792
530 Ga0307416_101159765
531 Ga0307414_10000602
532 Ga0307414_10007591
533 Ga0307414_10165456
534 Ga0307414_10166400
535 Ga0307414_10208739
536 Ga0307414_10312525
537 Ga0307414_10344484
538 Ga0307414_10649079
539 Ga0307411_10001709
540 Ga0307411_10009215
541 Ga0307411_10038136
542 Ga0307411_10058375
543 Ga0307411_10077140
544 Ga0307411_10083736
545 Ga0307411_10092745
546 Ga0307411_10102572
547 Ga0307411_10220669
548 Ga0307415_100019734
549 Ga0307415_100676622
550 Ga0307415_101223819
551 Ga0307507_10292047
552 Ga0373936_0000002
553 Ga0373961_0000105
554 Ga0316574_0028118
555 Ga0373937_0675750
556 Ga0395905_0092882
557 Ga0395905_0749554
558 Ga0439447_000230
559 Ga0439466_0002200
560 Ga0451793_0625347
561 Ga0451849_1304009
562 Ga0439431_0020422
563 Ga0439443_011956
564 Ga0439449_0206964
565 Ga0439452_052300
566 Ga0439456_000027
567 Ga0439462_0081551
568 Ga0450889_016879
569 Ga0439434_0184789
570 Ga0450893_0005353
571 Ga0466961_0302813
572 Ga0453684_1331856
573 Ga0466960_0355449
574 Ga0495617_031375
575 Ga0495629_0317134
576 Ga0495653_0158976
577 Ga0495650_0001788
578 Ga0495582_0004652
579 Ga0495594_0133472
580 Ga0495594_0239976
581 Ga0495596_0068518
582 Ga0495628_0301457
583 Ga0495630_0201584
584 Ga0495630_0234214
585 Ga0495648_0011151
586 Ga0495648_0088280
587 Ga0495648_0291750
588 Ga0495663_0002744
589 Ga0495666_0133077
590 Ga0495587_0037895
591 Ga0495598_0057316
592 Ga0495598_0068527
593 Ga0495609_0063326
594 Ga0495621_0023211
595 Ga0495645_0146251
596 Ga0495633_0094501
597 Ga0495656_0205594
598 Ga0495635_0005882
599 Ga0495659_0059108
600 Ga0495659_0199451
601 Ga0495646_0018341
602 Ga0495658_0423179
603 Ga0495669_0382247
604 Ga0495613_0020167
605 Ga0495670_0022580
606 Ga0495670_0033958
607 Ga0495670_0044031
608 Ga0495670_0098243
609 Ga0495604_0228858
610 Ga0495636_0007063
611 Ga0495636_0081171
612 Ga0495636_0101842
613 Ga0495672_0064052
614 Ga0495680_0007570
615 Ga0495687_000808
616 Ga0495675_0000981
617 Ga0495685_074267
618 Ga0495673_0042059
619 Ga0495673_0086581
620 Ga0495681_0029055
621 Ga0495681_0187132
622 Ga0495593_0054930
623 Ga0495614_0278181
624 Ga0495615_0139713
625 Ga0496108_0411356
626 Ga0496109_0026309
627 Ga0496109_0339584
628 Ga0496112_0009658
629 Ga0496121_0000374
630 Ga0501068_0392682
631 Ga0501069_0000498
632 Ga0501070_0000026
633 Ga0501071_0005619
634 Ga0501217_138119
635 Ga0501080_0002679
636 nmdc:mga0k408_428527_c1
637 nmdc:mga0k408_471830_c1
638 nmdc:mga07m45_13804_c1
639 nmdc:mga07m45_208457_c1
640 nmdc:mga07m45_9479_c1
641 nmdc:mga0a205_380214_c1
642 nmdc:mga0a205_48775_c1
643 nmdc:mga0sz30_183988_c1
644 Ga0500651_0055194
645 Ga0500553_212386
646 Ga0500595_000943
647 Ga0500603_031817
648 Ga0500636_0111537
649 2511334457
650 2555668564
651 2599356936
652 2599362277
653 2599368597
654 2599375386
655 2599382041
656 2599388488
657 2599394244
658 2599406009
659 2599464559
660 2599468883
661 2599493582
662 2600216836
663 2601776567
664 2643952464
665 2644022226
666 2671098916
667 2739200748
668 2819704037
669 2858699890
670 2917072335
671 2935354499
672 637318925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

59

154

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n71-assembly3.cif.gz_D x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.8191 32 182
4mln-assembly1.cif.gz_A crystal of phnz bound to (r)-2-amino-1-hydroxyethylphosphonic acid 0.8182 32 182
4n6w-assembly1.cif.gz_A x-ray crystal structure of citrate-bound phnz 0.8005 32 182
4n71-assembly4.cif.gz_E x-ray crystal structure of 2-amino-1-hydroxyethylphosphonate-bound phnz 0.7962 32 182
6npa-assembly4.cif.gz_D x-ray crystal structure of tmpb, (r)-1-hydroxy-2-trimethylaminoethylphosphonate oxygenase, with (r)-1-hydroxy-2-trimethylaminoethylphosphonate 0.7887 32 182
ID Description Score Start End Superfamily
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.7803 31 182 1.10.3210.10
4mlnB00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.6641 31 182 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.618 26 186 1.10.3210.10
af_A0A1D6P1M6_55_306_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5259 26 186 1.10.3210.10
af_A0A1D6IZ35_686_847_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4062 68 149 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2A5EKD9-F1-model_v4 Phosphohydrolase 0.9955 7 189 GO:0016787
AF-A0A7C7Y4W0-F1-model_v4 HD domain-containing protein 0.9952 6 182
AF-A0A7Y1TB96-F1-model_v4 HD domain-containing protein 0.9951 13 180
AF-A0A2U0VKN6-F1-model_v4 deleted 0.9941 1 192
AF-A0A2D8EL55-F1-model_v4 Phosphohydrolase 0.9934 4 191 GO:0016787

Map