F412987

General Info

Members Datasets Scaffolds Average Seq Length
337 215 674 136

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100000068|Ga0070665_100000068138
Length 151
Sequence MDKRPWLLLPSLAGMNLTLSQCFVLVHDPDQALAFYRDTLGLELRNDVAKGEFRWITVGADSQPGVAIVLTNYLNGSPADQDALSALIAKGALNGVHFHSDDLDSTFEKVDASGAEIVQEPTDQPWGTRDFALRDPSGNMIRIDQPPATQS

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
17 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
18 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
19 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
23 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
24 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
25 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
26 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
27 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
28 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
29 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
79 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
80 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
81 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
82 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
86 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
87 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
88 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
89 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
90 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
91 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
94 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
95 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
96 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
97 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
98 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
101 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
104 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
105 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
106 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
109 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
110 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
111 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
112 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
115 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
116 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
117 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
121 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
124 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
125 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
126 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
136 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
137 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
172 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
173 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
174 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
175 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
200 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
203 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
211 2508501039 Frankia saprophytica CN3 Isolate Nodule
212 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
213 2687453737 Frankia sp. BMG5.36 Isolate Nodule
214 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
215 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.52
Metatranscriptomes 0
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 1.48
Rhizoplane 13.65
Rhizosphere 74.18
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100000068 3300005548 Bacteria 204531
2 Ga0070677_10000011 3300005333 Bacteria 60102
3 Ga0070682_100000028 3300005337 Bacteria 185177
4 Ga0070682_100247186 3300005337 Bacteria 1284
5 Ga0070660_100119418 3300005339 Bacteria 2103
6 Ga0070714_100012544 3300005435 Bacteria 6771
7 Ga0070714_101799179 3300005435 Bacteria 598
8 Ga0070713_100000112 3300005436 Bacteria 53224
9 Ga0070713_100983538 3300005436 Bacteria 814
10 Ga0070710_11126597 3300005437 Bacteria 577
11 Ga0070701_10564472 3300005438 Bacteria 749
12 Ga0070681_10004765 3300005458 Bacteria 12998
13 Ga0068867_100420983 3300005459 Bacteria 1131
14 Ga0070679_100000401 3300005530 Bacteria 36912
15 Ga0068853_100100284 3300005539 Bacteria 2560
16 Ga0068855_101874821 3300005563 Bacteria 608
17 Ga0068854_100037476 3300005578 Bacteria 3404
18 Ga0068856_100008862 3300005614 Bacteria 9790
19 Ga0068856_100145108 3300005614 Bacteria 2381
20 Ga0068866_10041860 3300005718 Bacteria 2276
21 Ga0068861_100270172 3300005719 Bacteria 1460
22 Ga0068858_100000012 3300005842 Bacteria 216931
23 Ga0068858_100000033 3300005842 Bacteria 142748
24 Ga0068858_100000081 3300005842 Bacteria 100314
25 Ga0081455_10026544 3300005937 Bacteria 5323
26 Ga0081540_1009793 3300005983 Bacteria 6559
27 Ga0075365_10301513 3300006038 Bacteria 1128
28 Ga0075368_10014845 3300006042 Bacteria 2882
29 Ga0075363_100006935 3300006048 Bacteria 5179
30 Ga0075363_100100753 3300006048 Bacteria 1598
31 Ga0075364_10006562 3300006051 Bacteria 6845
32 Ga0075364_10030834 3300006051 Bacteria 3443
33 Ga0075364_10707260 3300006051 Bacteria 687
34 Ga0070712_100000006 3300006175 Bacteria 161357
35 Ga0075362_10013392 3300006177 Bacteria 3284
36 Ga0075367_10002919 3300006178 Bacteria 7971
37 Ga0075367_10021589 3300006178 Bacteria 3600
38 Ga0075370_10003859 3300006353 Bacteria 7179
39 Ga0075370_10006366 3300006353 Bacteria 5929
40 Ga0075370_10582177 3300006353 Bacteria 678
41 Ga0068871_100364209 3300006358 Bacteria 1281
42 Ga0075428_102096782 3300006844 Bacteria 585
43 Ga0068865_100000017 3300006881 Bacteria 109636
44 Ga0075435_100618344 3300007076 Bacteria 940
45 Ga0099794_10371308 3300007265 Bacteria 745
46 Ga0105240_10328139 3300009093 Bacteria 1742
47 Ga0105245_10000161 3300009098 Bacteria 63378
48 Ga0105245_10000295 3300009098 Bacteria 47700
49 Ga0105247_10000105 3300009101 Bacteria 87578
50 Ga0105247_11167969 3300009101 Bacteria 611
51 Ga0105241_10810945 3300009174 Bacteria 863
52 Ga0105242_10001190 3300009176 Bacteria 20519
53 Ga0105242_10003454 3300009176 Bacteria 12286
54 Ga0105242_12410761 3300009176 Bacteria 574
55 Ga0105248_10000028 3300009177 Bacteria 225683
56 Ga0105248_10000941 3300009177 Bacteria 32417
57 Ga0105248_12267115 3300009177 Bacteria 618
58 Ga0105249_10000165 3300009553 Bacteria 77694
59 Ga0157370_10004853 3300013104 Bacteria 15271
60 Ga0157370_10195774 3300013104 Bacteria 1876
61 Ga0157374_10030619 3300013296 Bacteria 4888
62 Ga0157374_10142188 3300013296 Bacteria 2330
63 Ga0157378_10045623 3300013297 Bacteria 3895
64 Ga0157378_11705251 3300013297 Bacteria 677
65 Ga0157375_10002684 3300013308 Bacteria 15420
66 Ga0157375_10498308 3300013308 Bacteria 1382
67 Ga0157375_12206974 3300013308 Bacteria 656
68 Ga0163163_10003439 3300014325 Bacteria 13453
69 Ga0157380_10000028 3300014326 Bacteria 99836
70 Ga0157377_10329536 3300014745 Bacteria 1017
71 Ga0157379_10000042 3300014968 Bacteria 77721
72 Ga0157379_10026743 3300014968 Bacteria 5136
73 Ga0157379_10341125 3300014968 Bacteria 1370
74 Ga0157376_12073847 3300014969 Bacteria 607
75 Ga0207682_10000159 3300025893 Bacteria 30618
76 Ga0207710_10009817 3300025900 Bacteria 4023
77 Ga0207707_10017049 3300025912 Bacteria 6328
78 Ga0207695_10401910 3300025913 Bacteria 1254
79 Ga0207693_10001638 3300025915 Bacteria 19774
80 Ga0207663_10280078 3300025916 Bacteria 1238
81 Ga0207652_10000577 3300025921 Bacteria 36887
82 Ga0207687_10000026 3300025927 Bacteria 173968
83 Ga0207687_10000578 3300025927 Bacteria 24764
84 Ga0207700_10000008 3300025928 Bacteria 341717
85 Ga0207664_10000210 3300025929 Bacteria 44375
86 Ga0207664_10401521 3300025929 Bacteria 1219
87 Ga0207690_10006070 3300025932 Bacteria 7157
88 Ga0207686_10000032 3300025934 Bacteria 150341
89 Ga0207686_10056488 3300025934 Bacteria 2468
90 Ga0207686_10593688 3300025934 Bacteria 871
91 Ga0207709_10550590 3300025935 Bacteria 907
92 Ga0207704_10000025 3300025938 Bacteria 135523
93 Ga0207704_10764444 3300025938 Bacteria 805
94 Ga0207711_10000132 3300025941 Bacteria 78834
95 Ga0207711_10000304 3300025941 Bacteria 52792
96 Ga0207711_11258326 3300025941 Bacteria 682
97 Ga0207661_10003103 3300025944 Bacteria 11507
98 Ga0207712_10000037 3300025961 Bacteria 195906
99 Ga0207640_10009188 3300025981 Bacteria 5524
100 Ga0207658_10312235 3300025986 Bacteria 1358
101 Ga0207703_10000089 3300026035 Bacteria 105959
102 Ga0207703_10000091 3300026035 Bacteria 105608
103 Ga0207703_10000126 3300026035 Bacteria 91860
104 Ga0207639_10001697 3300026041 Bacteria 14869
105 Ga0207678_10298389 3300026067 Bacteria 1384
106 Ga0207702_10006884 3300026078 Bacteria 9743
107 Ga0207702_10116026 3300026078 Bacteria 2389
108 Ga0207674_10035565 3300026116 Bacteria 5198
109 Ga0207675_100316906 3300026118 Bacteria 1522
110 Ga0207698_10808702 3300026142 Bacteria 940
111 Ga0209813_10030071 3300027866 Bacteria 1594
112 Ga0268266_10000020 3300028379 Bacteria 527065
113 Ga0265337_1000012 3300028556 Bacteria 85395
114 Ga0265326_10001927 3300028558 Bacteria 7096
115 Ga0265319_1000028 3300028563 Bacteria 135557
116 Ga0265334_10271815 3300028573 Bacteria 582
117 Ga0265322_10000001 3300028654 Bacteria 543854
118 Ga0265336_10006074 3300028666 Bacteria 4385
119 Ga0265338_10001943 3300028800 Bacteria 32266
120 Ga0265338_10003038 3300028800 Bacteria 24155
121 Ga0265338_10004524 3300028800 Bacteria 18741
122 Ga0265324_10002100 3300029957 Bacteria 10531
123 Ga0265332_10106958 3300031238 Bacteria 1179
124 Ga0265328_10000659 3300031239 Bacteria 16018
125 Ga0265320_10000002 3300031240 Bacteria 542875
126 Ga0265329_10012150 3300031242 Bacteria 3106
127 Ga0265339_10183898 3300031249 Bacteria 1039
128 Ga0265331_10000919 3300031250 Bacteria 23588
129 Ga0265327_10000011 3300031251 Bacteria 543807
130 Ga0265327_10022380 3300031251 Bacteria 3781
131 Ga0265327_10044859 3300031251 Bacteria 2354
132 Ga0265316_10107407 3300031344 Bacteria 2116
133 Ga0265316_10830647 3300031344 Bacteria 647
134 Ga0265313_10199185 3300031595 Bacteria 834
135 Ga0265313_10289056 3300031595 Bacteria 661
136 Ga0316579_10615820 3300031691 Bacteria 526
137 Ga0265314_10000224 3300031711 Bacteria 84325
138 Ga0265342_10153288 3300031712 Bacteria 1278
139 Ga0373953_0168268 3300035117 Bacteria 943
140 Ga0373956_0317647 3300035119 Bacteria 742
141 Ga0373947_0793144 3300035725 Bacteria 647
142 Ga0373937_0340649 3300036401 Bacteria 1420
143 Ga0436364_0647765 3300037853 Bacteria 2212
144 Ga0451800_0314821 3300041459 Bacteria 852
145 Ga0451807_1812733 3300041486 Bacteria 1059
146 Ga0451807_2046680 3300041486 Bacteria 629
147 Ga0451833_0204672 3300041491 Bacteria 841
148 Ga0451849_0174761 3300041505 Bacteria 861
149 Ga0466966_0218843 3300044684 Unclassified 1150
150 Ga0466966_0225172 3300044684 Bacteria 1132
151 Ga0466966_0287301 3300044684 Bacteria 989
152 Ga0466961_0162678 3300044693 Bacteria 1391
153 Ga0466963_0000025 3300044694 Bacteria 51171
154 Ga0466963_0113015 3300044694 Bacteria 1865
155 Ga0466971_0209398 3300044719 Bacteria 922
156 Ga0466970_0886166 3300044765 Bacteria 524
157 Ga0466957_0058393 3300044842 Bacteria 2364
158 Ga0466957_0435446 3300044842 Bacteria 901
159 Ga0466959_0046404 3300045049 Bacteria 3197
160 Ga0466959_0094988 3300045049 Bacteria 2138
161 Ga0466958_0114070 3300045836 Bacteria 1688
162 Ga0466958_0549466 3300045836 Bacteria 750
163 Ga0466967_0000045 3300045976 Bacteria 45085
164 Ga0466967_1648235 3300045976 Bacteria 639
165 Ga0466967_1750981 3300045976 Bacteria 619
166 Ga0495590_0186293 3300046457 Bacteria 760
167 Ga0495629_0003346 3300046459 Bacteria 12111
168 Ga0495651_0174799 3300046462 Bacteria 1526
169 Ga0495653_0127657 3300046463 Bacteria 1804
170 Ga0495653_0188600 3300046463 Bacteria 1409
171 Ga0495639_0554968 3300046475 Bacteria 589
172 Ga0495662_0001984 3300046476 Bacteria 10266
173 Ga0495584_0308913 3300046491 Bacteria 803
174 Ga0495596_0030296 3300046500 Bacteria 2167
175 Ga0495608_0000056 3300046511 Bacteria 91026
176 Ga0495616_0437352 3300046513 Bacteria 532
177 Ga0495618_0277562 3300046514 Bacteria 1046
178 Ga0495618_0421982 3300046514 Bacteria 813
179 Ga0495628_0001941 3300046516 Bacteria 18745
180 Ga0495628_0019228 3300046516 Bacteria 5649
181 Ga0495630_0049794 3300046517 Bacteria 3135
182 Ga0495630_0141665 3300046517 Bacteria 1828
183 Ga0495630_0321654 3300046517 Bacteria 1183
184 Ga0495642_0164128 3300046528 Bacteria 964
185 Ga0495652_0231740 3300046529 Bacteria 1381
186 Ga0495652_0267477 3300046529 Bacteria 1258
187 Ga0495640_0127080 3300046533 Bacteria 1652
188 Ga0495640_0673090 3300046533 Bacteria 622
189 Ga0495586_0001701 3300046535 Bacteria 12041
190 Ga0495586_0086854 3300046535 Bacteria 1724
191 Ga0495587_0053342 3300046536 Bacteria 2384
192 Ga0495621_0478886 3300046539 Bacteria 535
193 Ga0495645_0049534 3300046543 Bacteria 3059
194 Ga0495645_0336946 3300046543 Bacteria 975
195 Ga0495656_0000342 3300046615 Bacteria 15822
196 Ga0495656_0644995 3300046615 Bacteria 568
197 Ga0495634_0000212 3300046642 Bacteria 53864
198 Ga0495625_0620611 3300046660 Bacteria 647
199 Ga0495635_0059883 3300046663 Bacteria 2618
200 Ga0495657_0000023 3300046675 Bacteria 145522
201 Ga0495646_0080527 3300046680 Bacteria 1899
202 Ga0495646_0114096 3300046680 Bacteria 1535
203 Ga0495658_0246809 3300046683 Bacteria 1122
204 Ga0495669_0000130 3300046684 Bacteria 48500
205 Ga0495624_0082596 3300046690 Bacteria 1988
206 Ga0495649_0006497 3300046694 Bacteria 7276
207 Ga0495649_0334659 3300046694 Bacteria 767
208 Ga0495589_0045398 3300046794 Bacteria 2183
209 Ga0495604_0000806 3300047317 Bacteria 26348
210 Ga0495604_0001326 3300047317 Bacteria 20202
211 Ga0495604_0064803 3300047317 Bacteria 2783
212 Ga0495604_0165826 3300047317 Bacteria 1557
213 Ga0495674_0094370 3300047319 Bacteria 2552
214 Ga0495676_0000283 3300047321 Bacteria 40939
215 Ga0495676_0005012 3300047321 Bacteria 12147
216 Ga0495680_0004998 3300047322 Bacteria 12542
217 Ga0495680_0179360 3300047322 Bacteria 1529
218 Ga0495683_0363796 3300047323 Bacteria 608
219 Ga0495675_0000039 3300047444 Bacteria 91025
220 Ga0495675_0368947 3300047444 Bacteria 841
221 Ga0495679_033422 3300047446 Bacteria 1643
222 Ga0495602_0000032 3300048088 Bacteria 141185
223 Ga0495602_0172400 3300048088 Bacteria 1678
224 Ga0496100_0000007 3300048903 Bacteria 261266
225 Ga0496100_0000049 3300048903 Bacteria 75590
226 Ga0496100_0054174 3300048903 Bacteria 2615
227 Ga0496101_0000010 3300048904 Bacteria 281990
228 Ga0496101_0000013 3300048904 Bacteria 261266
229 Ga0496101_0152146 3300048904 Bacteria 1770
230 Ga0496102_0000546 3300048905 Bacteria 40572
231 Ga0496102_0229478 3300048905 Bacteria 1750
232 Ga0496102_0509536 3300048905 Bacteria 1126
233 Ga0496102_1096491 3300048905 Bacteria 716
234 Ga0496102_1576306 3300048905 Bacteria 575
235 Ga0496103_0000368 3300048906 Bacteria 40572
236 Ga0496104_0000001 3300048907 Bacteria 711867
237 Ga0496104_0000002 3300048907 Bacteria 686017
238 Ga0496104_0000013 3300048907 Bacteria 397163
239 Ga0496104_0011315 3300048907 Bacteria 7987
240 Ga0496104_0176165 3300048907 Bacteria 2049
241 Ga0496105_0000001 3300048908 Bacteria 1328178
242 Ga0496105_0000006 3300048908 Bacteria 393578
243 Ga0496106_0000006 3300048909 Bacteria 251855
244 Ga0496106_0000018 3300048909 Bacteria 175028
245 Ga0496106_0029190 3300048909 Bacteria 4109
246 Ga0496107_0000007 3300048910 Bacteria 257113
247 Ga0496107_0000032 3300048910 Bacteria 99848
248 Ga0496107_0021611 3300048910 Bacteria 4548
249 Ga0496108_0000001 3300048911 Bacteria 919044
250 Ga0496108_0178984 3300048911 Bacteria 1836
251 Ga0496109_0000006 3300048912 Bacteria 325513
252 Ga0496109_0183293 3300048912 Bacteria 1967
253 Ga0496109_0917274 3300048912 Bacteria 814
254 Ga0496110_0001924 3300048913 Bacteria 15367
255 Ga0496110_0159058 3300048913 Bacteria 2047
256 Ga0496111_0112129 3300048914 Bacteria 2009
257 Ga0496112_0000258 3300048915 Bacteria 33904
258 Ga0496113_0000009 3300048916 Bacteria 88223
259 Ga0496113_0206626 3300048916 Bacteria 1562
260 Ga0496114_0000003 3300048917 Bacteria 630981
261 Ga0496114_0002643 3300048917 Bacteria 13674
262 Ga0496114_0135894 3300048917 Bacteria 2126
263 Ga0496114_0466028 3300048917 Bacteria 1118
264 Ga0496115_0000036 3300048918 Bacteria 127774
265 Ga0496115_0013647 3300048918 Bacteria 6148
266 Ga0496115_0387933 3300048918 Bacteria 1135
267 Ga0496117_0016112 3300048920 Bacteria 6325
268 Ga0496118_0005870 3300048921 Bacteria 13757
269 Ga0496119_0021835 3300048922 Bacteria 4607
270 Ga0496120_0101123 3300048923 Bacteria 1523
271 Ga0496121_0005287 3300048924 Bacteria 16629
272 Ga0501032_0217831 3300049569 Bacteria 1243
273 Ga0501038_0443858 3300049574 Bacteria 999
274 Ga0501039_0486753 3300049575 Bacteria 969
275 Ga0501040_0367615 3300049576 Bacteria 1031
276 Ga0501041_0119458 3300049577 Bacteria 1638
277 Ga0501042_0038053 3300049578 Bacteria 3416
278 Ga0501046_0079841 3300049580 Bacteria 2529
279 Ga0501047_0032687 3300049581 Bacteria 5024
280 Ga0501067_0248111 3300049583 Bacteria 991
281 Ga0501068_0147183 3300049584 Bacteria 1479
282 Ga0501069_0144240 3300049585 Bacteria 1367
283 Ga0501070_0027078 3300049586 Bacteria 4809
284 Ga0501070_0030677 3300049586 Bacteria 4504
285 Ga0501070_0274775 3300049586 Bacteria 1375
286 Ga0501070_0275938 3300049586 Bacteria 1372
287 Ga0501071_0236128 3300049587 Bacteria 1378
288 Ga0501073_0203351 3300049589 Bacteria 1369
289 Ga0501073_0787165 3300049589 Bacteria 656
290 Ga0501074_0002038 3300049590 Bacteria 13944
291 Ga0501074_0005646 3300049590 Bacteria 9013
292 Ga0501074_0363731 3300049590 Bacteria 1026
293 Ga0501074_1191174 3300049590 Bacteria 534
294 Ga0501075_0380013 3300049591 Bacteria 1077
295 Ga0501076_0370518 3300049592 Bacteria 1177
296 Ga0501079_0333373 3300049741 Bacteria 1188
297 Ga0501080_0024118 3300049742 Bacteria 5639
298 Ga0501080_0039062 3300049742 Bacteria 4429
299 Ga0501080_0937798 3300049742 Bacteria 753
300 Ga0501045_0179982 3300049824 Bacteria 1575
301 Ga0501045_0420872 3300049824 Bacteria 994
302 Ga0501045_0910612 3300049824 Bacteria 646
303 nmdc:mga03683_10666_c2 3300050489 Bacteria 2190
304 nmdc:mga00v17_10171_c1 3300050491 Bacteria 5127
305 nmdc:mga00v17_98604_c1 3300050491 Bacteria 1843
306 nmdc:mga0yw44_32919_c1 3300050492 Bacteria 3024
307 nmdc:mga0yw44_468470_c1 3300050492 Bacteria 854
308 nmdc:mga0yw44_523218_c1 3300050492 Bacteria 805
309 nmdc:mga06z11_35263_c1 3300050494 Bacteria 2461
310 nmdc:mga06z11_7947_c1 3300050494 Bacteria 4393
311 nmdc:mga06z11_8550_c1 3300050494 Bacteria 4279
312 nmdc:mga04h51_1078_c1 3300050495 Bacteria 6293
313 nmdc:mga07m45_12848_c1 3300050496 Bacteria 4430
314 nmdc:mga07m45_30734_c1 3300050496 Bacteria 2976
315 nmdc:mga0rr50_415363_c1 3300050513 Bacteria 1138
316 Ga0495601_0000260 3300053077 Bacteria 28505
317 Ga0495601_0014155 3300053077 Bacteria 4806
318 Ga0495601_0031420 3300053077 Bacteria 3300
319 Ga0495655_0000004 3300053083 Bacteria 293683
320 Ga0495655_0328003 3300053083 Bacteria 531
321 Ga0495595_0000029 3300053084 Bacteria 91026
322 Ga0495595_0019170 3300053084 Bacteria 2966
323 Ga0495619_0000029 3300053085 Bacteria 158166
324 Ga0495619_0000075 3300053085 Bacteria 76341
325 Ga0495619_0001065 3300053085 Bacteria 18004
326 Ga0495619_0038401 3300053085 Bacteria 3123
327 Ga0495619_0429172 3300053085 Bacteria 912
328 Ga0500566_0001322 3300053094 Bacteria 14466
329 Ga0500628_000049 3300053129 Bacteria 41425
330 Ga0501084_0112273 3300054114 Bacteria 2290
331 Ga0501084_0559061 3300054114 Bacteria 967
332 Ga0530510_0343456 3300061734 Bacteria 1121
333 2508675579 2508501039 Bacteria 9978592
334 2676199988 2675902999 Bacteria 9438463
335 2689962637 2687453737 Bacteria 11203906
336 2774844566 2773857921 Bacteria 9435764
337 8002781688 8002775197 Bacteria 10728764
338 Ga0070665_100000068
339 Ga0070677_10000011
340 Ga0070682_100000028
341 Ga0070682_100247186
342 Ga0070660_100119418
343 Ga0070714_100012544
344 Ga0070714_101799179
345 Ga0070713_100000112
346 Ga0070713_100983538
347 Ga0070710_11126597
348 Ga0070701_10564472
349 Ga0070681_10004765
350 Ga0068867_100420983
351 Ga0070679_100000401
352 Ga0068853_100100284
353 Ga0068855_101874821
354 Ga0068854_100037476
355 Ga0068856_100008862
356 Ga0068856_100145108
357 Ga0068866_10041860
358 Ga0068861_100270172
359 Ga0068858_100000012
360 Ga0068858_100000033
361 Ga0068858_100000081
362 Ga0081455_10026544
363 Ga0081540_1009793
364 Ga0075365_10301513
365 Ga0075368_10014845
366 Ga0075363_100006935
367 Ga0075363_100100753
368 Ga0075364_10006562
369 Ga0075364_10030834
370 Ga0075364_10707260
371 Ga0070712_100000006
372 Ga0075362_10013392
373 Ga0075367_10002919
374 Ga0075367_10021589
375 Ga0075370_10003859
376 Ga0075370_10006366
377 Ga0075370_10582177
378 Ga0068871_100364209
379 Ga0075428_102096782
380 Ga0068865_100000017
381 Ga0075435_100618344
382 Ga0099794_10371308
383 Ga0105240_10328139
384 Ga0105245_10000161
385 Ga0105245_10000295
386 Ga0105247_10000105
387 Ga0105247_11167969
388 Ga0105241_10810945
389 Ga0105242_10001190
390 Ga0105242_10003454
391 Ga0105242_12410761
392 Ga0105248_10000028
393 Ga0105248_10000941
394 Ga0105248_12267115
395 Ga0105249_10000165
396 Ga0157370_10004853
397 Ga0157370_10195774
398 Ga0157374_10030619
399 Ga0157374_10142188
400 Ga0157378_10045623
401 Ga0157378_11705251
402 Ga0157375_10002684
403 Ga0157375_10498308
404 Ga0157375_12206974
405 Ga0163163_10003439
406 Ga0157380_10000028
407 Ga0157377_10329536
408 Ga0157379_10000042
409 Ga0157379_10026743
410 Ga0157379_10341125
411 Ga0157376_12073847
412 Ga0207682_10000159
413 Ga0207710_10009817
414 Ga0207707_10017049
415 Ga0207695_10401910
416 Ga0207693_10001638
417 Ga0207663_10280078
418 Ga0207652_10000577
419 Ga0207687_10000026
420 Ga0207687_10000578
421 Ga0207700_10000008
422 Ga0207664_10000210
423 Ga0207664_10401521
424 Ga0207690_10006070
425 Ga0207686_10000032
426 Ga0207686_10056488
427 Ga0207686_10593688
428 Ga0207709_10550590
429 Ga0207704_10000025
430 Ga0207704_10764444
431 Ga0207711_10000132
432 Ga0207711_10000304
433 Ga0207711_11258326
434 Ga0207661_10003103
435 Ga0207712_10000037
436 Ga0207640_10009188
437 Ga0207658_10312235
438 Ga0207703_10000089
439 Ga0207703_10000091
440 Ga0207703_10000126
441 Ga0207639_10001697
442 Ga0207678_10298389
443 Ga0207702_10006884
444 Ga0207702_10116026
445 Ga0207674_10035565
446 Ga0207675_100316906
447 Ga0207698_10808702
448 Ga0209813_10030071
449 Ga0268266_10000020
450 Ga0265337_1000012
451 Ga0265326_10001927
452 Ga0265319_1000028
453 Ga0265334_10271815
454 Ga0265322_10000001
455 Ga0265336_10006074
456 Ga0265338_10001943
457 Ga0265338_10003038
458 Ga0265338_10004524
459 Ga0265324_10002100
460 Ga0265332_10106958
461 Ga0265328_10000659
462 Ga0265320_10000002
463 Ga0265329_10012150
464 Ga0265339_10183898
465 Ga0265331_10000919
466 Ga0265327_10000011
467 Ga0265327_10022380
468 Ga0265327_10044859
469 Ga0265316_10107407
470 Ga0265316_10830647
471 Ga0265313_10199185
472 Ga0265313_10289056
473 Ga0316579_10615820
474 Ga0265314_10000224
475 Ga0265342_10153288
476 Ga0373953_0168268
477 Ga0373956_0317647
478 Ga0373947_0793144
479 Ga0373937_0340649
480 Ga0436364_0647765
481 Ga0451800_0314821
482 Ga0451807_1812733
483 Ga0451807_2046680
484 Ga0451833_0204672
485 Ga0451849_0174761
486 Ga0466966_0218843
487 Ga0466966_0225172
488 Ga0466966_0287301
489 Ga0466961_0162678
490 Ga0466963_0000025
491 Ga0466963_0113015
492 Ga0466971_0209398
493 Ga0466970_0886166
494 Ga0466957_0058393
495 Ga0466957_0435446
496 Ga0466959_0046404
497 Ga0466959_0094988
498 Ga0466958_0114070
499 Ga0466958_0549466
500 Ga0466967_0000045
501 Ga0466967_1648235
502 Ga0466967_1750981
503 Ga0495590_0186293
504 Ga0495629_0003346
505 Ga0495651_0174799
506 Ga0495653_0127657
507 Ga0495653_0188600
508 Ga0495639_0554968
509 Ga0495662_0001984
510 Ga0495584_0308913
511 Ga0495596_0030296
512 Ga0495608_0000056
513 Ga0495616_0437352
514 Ga0495618_0277562
515 Ga0495618_0421982
516 Ga0495628_0001941
517 Ga0495628_0019228
518 Ga0495630_0049794
519 Ga0495630_0141665
520 Ga0495630_0321654
521 Ga0495642_0164128
522 Ga0495652_0231740
523 Ga0495652_0267477
524 Ga0495640_0127080
525 Ga0495640_0673090
526 Ga0495586_0001701
527 Ga0495586_0086854
528 Ga0495587_0053342
529 Ga0495621_0478886
530 Ga0495645_0049534
531 Ga0495645_0336946
532 Ga0495656_0000342
533 Ga0495656_0644995
534 Ga0495634_0000212
535 Ga0495625_0620611
536 Ga0495635_0059883
537 Ga0495657_0000023
538 Ga0495646_0080527
539 Ga0495646_0114096
540 Ga0495658_0246809
541 Ga0495669_0000130
542 Ga0495624_0082596
543 Ga0495649_0006497
544 Ga0495649_0334659
545 Ga0495589_0045398
546 Ga0495604_0000806
547 Ga0495604_0001326
548 Ga0495604_0064803
549 Ga0495604_0165826
550 Ga0495674_0094370
551 Ga0495676_0000283
552 Ga0495676_0005012
553 Ga0495680_0004998
554 Ga0495680_0179360
555 Ga0495683_0363796
556 Ga0495675_0000039
557 Ga0495675_0368947
558 Ga0495679_033422
559 Ga0495602_0000032
560 Ga0495602_0172400
561 Ga0496100_0000007
562 Ga0496100_0000049
563 Ga0496100_0054174
564 Ga0496101_0000010
565 Ga0496101_0000013
566 Ga0496101_0152146
567 Ga0496102_0000546
568 Ga0496102_0229478
569 Ga0496102_0509536
570 Ga0496102_1096491
571 Ga0496102_1576306
572 Ga0496103_0000368
573 Ga0496104_0000001
574 Ga0496104_0000002
575 Ga0496104_0000013
576 Ga0496104_0011315
577 Ga0496104_0176165
578 Ga0496105_0000001
579 Ga0496105_0000006
580 Ga0496106_0000006
581 Ga0496106_0000018
582 Ga0496106_0029190
583 Ga0496107_0000007
584 Ga0496107_0000032
585 Ga0496107_0021611
586 Ga0496108_0000001
587 Ga0496108_0178984
588 Ga0496109_0000006
589 Ga0496109_0183293
590 Ga0496109_0917274
591 Ga0496110_0001924
592 Ga0496110_0159058
593 Ga0496111_0112129
594 Ga0496112_0000258
595 Ga0496113_0000009
596 Ga0496113_0206626
597 Ga0496114_0000003
598 Ga0496114_0002643
599 Ga0496114_0135894
600 Ga0496114_0466028
601 Ga0496115_0000036
602 Ga0496115_0013647
603 Ga0496115_0387933
604 Ga0496117_0016112
605 Ga0496118_0005870
606 Ga0496119_0021835
607 Ga0496120_0101123
608 Ga0496121_0005287
609 Ga0501032_0217831
610 Ga0501038_0443858
611 Ga0501039_0486753
612 Ga0501040_0367615
613 Ga0501041_0119458
614 Ga0501042_0038053
615 Ga0501046_0079841
616 Ga0501047_0032687
617 Ga0501067_0248111
618 Ga0501068_0147183
619 Ga0501069_0144240
620 Ga0501070_0027078
621 Ga0501070_0030677
622 Ga0501070_0274775
623 Ga0501070_0275938
624 Ga0501071_0236128
625 Ga0501073_0203351
626 Ga0501073_0787165
627 Ga0501074_0002038
628 Ga0501074_0005646
629 Ga0501074_0363731
630 Ga0501074_1191174
631 Ga0501075_0380013
632 Ga0501076_0370518
633 Ga0501079_0333373
634 Ga0501080_0024118
635 Ga0501080_0039062
636 Ga0501080_0937798
637 Ga0501045_0179982
638 Ga0501045_0420872
639 Ga0501045_0910612
640 nmdc:mga03683_10666_c2
641 nmdc:mga00v17_10171_c1
642 nmdc:mga00v17_98604_c1
643 nmdc:mga0yw44_32919_c1
644 nmdc:mga0yw44_468470_c1
645 nmdc:mga0yw44_523218_c1
646 nmdc:mga06z11_35263_c1
647 nmdc:mga06z11_7947_c1
648 nmdc:mga06z11_8550_c1
649 nmdc:mga04h51_1078_c1
650 nmdc:mga07m45_12848_c1
651 nmdc:mga07m45_30734_c1
652 nmdc:mga0rr50_415363_c1
653 Ga0495601_0000260
654 Ga0495601_0014155
655 Ga0495601_0031420
656 Ga0495655_0000004
657 Ga0495655_0328003
658 Ga0495595_0000029
659 Ga0495595_0019170
660 Ga0495619_0000029
661 Ga0495619_0000075
662 Ga0495619_0001065
663 Ga0495619_0038401
664 Ga0495619_0429172
665 Ga0500566_0001322
666 Ga0500628_000049
667 Ga0501084_0112273
668 Ga0501084_0559061
669 Ga0530510_0343456
670 2508675579
671 2676199988
672 2689962637
673 2774844566
674 8002781688

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

143

0.93

PF18029

Glyoxalase_6

Glyoxalase-like domain

21

143

0.9

PF12681

Glyoxalase_2

Glyoxalase-like domain

19

146

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cky-assembly1.cif.gz_B crystal structure of ucms2 0.862 1 130
5umw-assembly2.cif.gz_B crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8605 2 131
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8578 1 133
5ump-assembly1.cif.gz_B crystal structure of tnms3, an antibiotic binding protein from streptomyces sp. cb03234 0.8446 1 133
5umw-assembly3.cif.gz_D crystal structure of tnms2, an antibiotic binding protein from streptomyces sp. cb03234 0.8408 1 131
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9436 82 129 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9291 80 131 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8944 80 132 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8531 80 131 3.30.720.110
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8511 1 59 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A1G6UKA2-F1-model_v4 Uncharacterized conserved protein PhnB, glyoxalase superfamily 0.9527 1 130
AF-A0A317LTC7-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9481 1 133
AF-A0A7W1BQU6-F1-model_v4 VOC family protein 0.948 59 133
AF-A0A7Y6VW70-F1-model_v4 deleted 0.9469 79 135
AF-A0A0Q1CJ93-F1-model_v4 Glyoxalase 0.9448 1 130

Map