F412993

General Info

Members Datasets Scaffolds Average Seq Length
337 220 336 172

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100141574|Ga0068855_1001415742
Length 189
Sequence MTRRPLPPRFLPHLSRSRVFHAGLLPVLVLPLALAACSGSEHSDLKQELVVLTKDQRGKIDPLPVVKPYEPVPYQAFDQPDPFGTQKIELVAKSLKPDLNRPKEPLEAYPLETLKMVGVLQQKKQTFALVRADTSLYRIKVGNYLGQNFGLVTGISDNQVQLRELIQDAGGDWSERQSTLQLQDAGSGK

Samples

Sample ID Description Type Environment
1 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
134 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
144 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
147 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
167 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
170 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
171 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
172 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
173 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
174 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
175 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
180 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
181 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
200 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
201 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
204 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
215 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
216 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
220 639633007 Azoarcus olearius BH72 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.81
Metatranscriptomes 0.89
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 1.48
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058861_11357333 3300004800 Bacteria 1475
2 Ga0058862_11271760 3300004803 Bacteria 916
3 Ga0070670_100080624 3300005331 Bacteria 2797
4 Ga0068869_100000748 3300005334 Bacteria 18490
5 Ga0070666_10189437 3300005335 Unclassified 1445
6 Ga0070689_100134005 3300005340 Unclassified 1988
7 Ga0070689_101816551 3300005340 Bacteria 556
8 Ga0070687_100595969 3300005343 Unclassified 758
9 Ga0070669_101375144 3300005353 Unclassified 612
10 Ga0070675_100024903 3300005354 Bacteria 4796
11 Ga0070674_100131805 3300005356 Bacteria 1864
12 Ga0070659_100113247 3300005366 Bacteria 2191
13 Ga0070667_101091700 3300005367 Unclassified 746
14 Ga0070709_10404080 3300005434 Unclassified 1020
15 Ga0070710_10039476 3300005437 Bacteria 2598
16 Ga0070705_100111440 3300005440 Bacteria 1749
17 Ga0070705_100204312 3300005440 Unclassified 1357
18 Ga0070700_100256176 3300005441 Unclassified 1258
19 Ga0070694_100622675 3300005444 Bacteria 871
20 Ga0070678_100060614 3300005456 Bacteria 2786
21 Ga0070681_10035900 3300005458 Bacteria 4979
22 Ga0068867_100156291 3300005459 Bacteria 1795
23 Ga0070698_100427600 3300005471 Unclassified 1259
24 Ga0070698_100534607 3300005471 Unclassified 1111
25 Ga0070699_100981482 3300005518 Unclassified 774
26 Ga0068853_100001374 3300005539 Bacteria 17558
27 Ga0068853_101054318 3300005539 Unclassified 783
28 Ga0070686_100155734 3300005544 Bacteria 1604
29 Ga0070695_100035059 3300005545 Bacteria 3150
30 Ga0070696_100484693 3300005546 Bacteria 981
31 Ga0070693_100202460 3300005547 Bacteria 1290
32 Ga0070665_100010415 3300005548 Bacteria 9409
33 Ga0070704_100003706 3300005549 Bacteria 8802
34 Ga0070704_100447922 3300005549 Bacteria 1111
35 Ga0068855_100055617 3300005563 Bacteria 4647
36 Ga0068855_100141574 3300005563 Bacteria 2741
37 Ga0068857_100034517 3300005577 Bacteria 4474
38 Ga0068854_100874294 3300005578 Unclassified 788
39 Ga0068856_100343836 3300005614 Bacteria 1510
40 Ga0068856_100605841 3300005614 Bacteria 1116
41 Ga0070702_100051058 3300005615 Unclassified 2366
42 Ga0068859_100004039 3300005617 Bacteria 14959
43 Ga0068864_100063600 3300005618 Bacteria 3198
44 Ga0068861_100289117 3300005719 Bacteria 1415
45 Ga0068863_100043046 3300005841 Bacteria 4287
46 Ga0068858_100026206 3300005842 Bacteria 5420
47 Ga0068858_100039504 3300005842 Bacteria 4375
48 Ga0068862_100075876 3300005844 Bacteria 2909
49 Ga0075365_10458896 3300006038 Bacteria 900
50 Ga0070715_10371884 3300006163 Unclassified 786
51 Ga0070716_100002115 3300006173 Bacteria 9124
52 Ga0097621_100041446 3300006237 Bacteria 3706
53 Ga0075370_10107779 3300006353 Unclassified 1616
54 Ga0068871_100432303 3300006358 Bacteria 1177
55 Ga0075430_100140515 3300006846 Bacteria 2011
56 Ga0075431_100000324 3300006847 Bacteria 37752
57 Ga0075431_100043332 3300006847 Bacteria 4644
58 Ga0075431_100125345 3300006847 Bacteria 2650
59 Ga0075434_101509881 3300006871 Bacteria 681
60 Ga0068865_100406725 3300006881 Bacteria 1116
61 Ga0075436_100026936 3300006914 Bacteria 3958
62 Ga0075436_100156201 3300006914 Bacteria 1607
63 Ga0097620_100004039 3300006931 Bacteria 14959
64 Ga0075435_100189917 3300007076 Bacteria 1739
65 Ga0099794_10037357 3300007265 Unclassified 2299
66 Ga0099794_10057924 3300007265 Bacteria 1878
67 Ga0099794_10285043 3300007265 Bacteria 854
68 Ga0099795_10015261 3300007788 Bacteria 2402
69 Ga0099795_10022052 3300007788 Bacteria 2098
70 Ga0105240_10092411 3300009093 Bacteria 3695
71 Ga0111539_10257931 3300009094 Unclassified 2030
72 Ga0105245_10104933 3300009098 Bacteria 2621
73 Ga0105243_10439672 3300009148 Unclassified 1221
74 Ga0105241_10021802 3300009174 Bacteria 4740
75 Ga0105241_10126964 3300009174 Bacteria 2061
76 Ga0105242_10042298 3300009176 Bacteria 3678
77 Ga0105242_11033785 3300009176 Unclassified 831
78 Ga0105242_11330280 3300009176 Unclassified 743
79 Ga0105248_10001876 3300009177 Bacteria 23307
80 Ga0105237_10008914 3300009545 Bacteria 10810
81 Ga0105238_10060911 3300009551 Bacteria 3777
82 Ga0105238_10195945 3300009551 Unclassified 1996
83 Ga0099796_10087022 3300010159 Bacteria 1156
84 Ga0105239_10061863 3300010375 Bacteria 4109
85 Ga0105239_10168074 3300010375 Bacteria 2452
86 Ga0105246_10007889 3300011119 Bacteria 6532
87 Ga0105246_10990813 3300011119 Unclassified 760
88 Ga0157369_10885463 3300013105 Bacteria 916
89 Ga0157374_10000127 3300013296 Bacteria 69890
90 Ga0157378_10051407 3300013297 Bacteria 3667
91 Ga0157378_10716274 3300013297 Bacteria 1021
92 Ga0157372_10089203 3300013307 Bacteria 3503
93 Ga0157375_10901408 3300013308 Bacteria 1028
94 Ga0163163_10053565 3300014325 Bacteria 3983
95 Ga0163163_10066238 3300014325 Bacteria 3587
96 Ga0163163_11585292 3300014325 Unclassified 716
97 Ga0157380_10096182 3300014326 Bacteria 2455
98 Ga0157379_10040563 3300014968 Bacteria 4155
99 Ga0157376_10584026 3300014969 Bacteria 1110
100 Ga0157376_11918660 3300014969 Unclassified 629
101 Ga0207680_10243332 3300025903 Unclassified 1240
102 Ga0207685_10221524 3300025905 Unclassified 900
103 Ga0207654_10004491 3300025911 Bacteria 7043
104 Ga0207707_10257858 3300025912 Bacteria 1514
105 Ga0207694_10036929 3300025924 Bacteria 3750
106 Ga0207659_10038347 3300025926 Bacteria 3332
107 Ga0207687_10219182 3300025927 Unclassified 1497
108 Ga0207690_10024182 3300025932 Bacteria 3802
109 Ga0207686_10149576 3300025934 Unclassified 1624
110 Ga0207686_10867358 3300025934 Unclassified 727
111 Ga0207670_10029654 3300025936 Bacteria 3487
112 Ga0207669_10049861 3300025937 Bacteria 2499
113 Ga0207665_10001087 3300025939 Bacteria 18295
114 Ga0207691_10230037 3300025940 Unclassified 1606
115 Ga0207711_10014208 3300025941 Bacteria 6612
116 Ga0207689_10002992 3300025942 Bacteria 15584
117 Ga0207679_10482577 3300025945 Bacteria 1104
118 Ga0207667_10070010 3300025949 Bacteria 3652
119 Ga0207667_10281531 3300025949 Bacteria 1699
120 Ga0207703_10015001 3300026035 Bacteria 6047
121 Ga0207703_10040646 3300026035 Bacteria 3722
122 Ga0207639_10010995 3300026041 Bacteria 6274
123 Ga0207639_11213559 3300026041 Unclassified 708
124 Ga0207708_10224007 3300026075 Bacteria 1508
125 Ga0207702_10374212 3300026078 Bacteria 1368
126 Ga0207702_10545353 3300026078 Bacteria 1134
127 Ga0207641_10041880 3300026088 Bacteria 3840
128 Ga0207648_10050473 3300026089 Bacteria 3638
129 Ga0207676_10110209 3300026095 Unclassified 2302
130 Ga0207674_10030131 3300026116 Bacteria 5708
131 Ga0207675_100091197 3300026118 Bacteria 2865
132 Ga0207683_10027436 3300026121 Bacteria 4921
133 Ga0209179_1004397 3300027512 Bacteria 2123
134 Ga0209588_1001855 3300027671 Bacteria 5637
135 Ga0209588_1132685 3300027671 Unclassified 794
136 Ga0268266_10055827 3300028379 Bacteria 3396
137 Ga0268265_10053174 3300028380 Bacteria 3067
138 Ga0268264_10043062 3300028381 Bacteria 3740
139 Ga0268264_11558019 3300028381 Unclassified 671
140 Ga0265323_10005124 3300028653 Bacteria 5584
141 Ga0265332_10039960 3300031238 Bacteria 2031
142 Ga0265325_10017237 3300031241 Bacteria 4016
143 Ga0265325_10079000 3300031241 Bacteria 1638
144 Ga0265316_10094425 3300031344 Bacteria 2279
145 Ga0265316_10120568 3300031344 Bacteria 1981
146 Ga0265316_10130059 3300031344 Bacteria 1897
147 Ga0307509_10000018 3300031507 Bacteria 258998
148 Ga0307416_100524070 3300032002 Bacteria 1254
149 Ga0316587_1001331 3300033529 Unclassified 3011
150 Ga0373948_0175152 3300034817 Bacteria 548
151 Ga0373934_0000011 3300035086 Bacteria 62703
152 Ga0373934_0002280 3300035086 Bacteria 7060
153 Ga0373934_0047340 3300035086 Bacteria 1701
154 Ga0373923_0005622 3300035111 Bacteria 4268
155 Ga0373936_0000889 3300035113 Bacteria 10689
156 Ga0373953_0092774 3300035117 Bacteria 1264
157 Ga0373953_0147524 3300035117 Bacteria 1007
158 Ga0373954_0002079 3300035118 Bacteria 8308
159 Ga0373954_0010175 3300035118 Bacteria 4146
160 Ga0373956_0000124 3300035119 Bacteria 27145
161 Ga0373956_0008670 3300035119 Bacteria 4117
162 Ga0373956_0014877 3300035119 Bacteria 3253
163 Ga0373956_0205085 3300035119 Bacteria 935
164 Ga0373957_0000670 3300035120 Bacteria 8831
165 Ga0373957_0011545 3300035120 Bacteria 2952
166 Ga0373943_0016637 3300035170 Bacteria 3356
167 Ga0373946_0011804 3300035171 Bacteria 3266
168 Ga0373955_0008840 3300035172 Bacteria 4695
169 Ga0373955_0076541 3300035172 Bacteria 1882
170 Ga0373955_0133319 3300035172 Bacteria 1452
171 Ga0373935_0011893 3300035692 Bacteria 5229
172 Ga0373927_0031320 3300035695 Bacteria 3467
173 Ga0373927_0349364 3300035695 Bacteria 975
174 Ga0373933_0000331 3300035724 Bacteria 30365
175 Ga0373933_0014198 3300035724 Bacteria 4424
176 Ga0373933_0126226 3300035724 Bacteria 1605
177 Ga0373933_0411808 3300035724 Bacteria 882
178 Ga0373933_0975769 3300035724 Unclassified 558
179 Ga0373937_0001929 3300036401 Bacteria 17353
180 Ga0373937_0005477 3300036401 Bacteria 10872
181 Ga0373937_0805140 3300036401 Bacteria 887
182 Ga0373937_0805146 3300036401 Unclassified 887
183 Ga0373925_0011254 3300037068 Bacteria 6489
184 Ga0373925_0121641 3300037068 Bacteria 2027
185 Ga0395905_0190029 3300037471 Bacteria 1926
186 Ga0242420_054334 3300038996 Unclassified 788
187 Ga0451843_0749695 3300041509 Bacteria 951
188 Ga0451577_0000489 3300042876 Bacteria 67100
189 Ga0451577_0036235 3300042876 Bacteria 4442
190 Ga0451577_0056873 3300042876 Bacteria 3489
191 Ga0451577_0060561 3300042876 Bacteria 3375
192 Ga0453683_0159516 3300044673 Bacteria 1427
193 Ga0453684_0000014 3300044712 Bacteria 993311
194 Ga0453684_0000189 3300044712 Bacteria 269690
195 Ga0453684_0000731 3300044712 Bacteria 115326
196 Ga0453684_0001597 3300044712 Bacteria 62266
197 Ga0453684_0002735 3300044712 Bacteria 41744
198 Ga0453684_0006614 3300044712 Bacteria 21910
199 Ga0453684_0228279 3300044712 Bacteria 2151
200 Ga0453684_0796631 3300044712 Bacteria 1019
201 Ga0451576_0000272 3300045051 Bacteria 126530
202 Ga0451576_0049679 3300045051 Bacteria 4402
203 Ga0451576_0126320 3300045051 Bacteria 2665
204 Ga0495592_0009535 3300046454 Bacteria 7304
205 Ga0495592_0012190 3300046454 Bacteria 6524
206 Ga0495592_0084287 3300046454 Bacteria 2294
207 Ga0495641_0000646 3300046461 Bacteria 29404
208 Ga0495651_0000570 3300046462 Bacteria 28594
209 Ga0495651_0001148 3300046462 Bacteria 20475
210 Ga0495653_0016472 3300046463 Bacteria 6017
211 Ga0495653_0725629 3300046463 Unclassified 602
212 Ga0495580_0026721 3300046472 Bacteria 4204
213 Ga0495582_0029451 3300046473 Bacteria 3014
214 Ga0495662_0001966 3300046476 Bacteria 10318
215 Ga0495664_0015795 3300046477 Bacteria 4296
216 Ga0495594_0014199 3300046499 Bacteria 4169
217 Ga0495608_0009175 3300046511 Bacteria 6914
218 Ga0495618_0006570 3300046514 Bacteria 7052
219 Ga0495628_0000486 3300046516 Bacteria 36439
220 Ga0495628_0001568 3300046516 Bacteria 20933
221 Ga0495630_0003803 3300046517 Bacteria 10529
222 Ga0495666_0000205 3300046526 Bacteria 25319
223 Ga0495652_0002564 3300046529 Bacteria 18609
224 Ga0495652_0150602 3300046529 Unclassified 1818
225 Ga0495640_0006505 3300046533 Bacteria 9234
226 Ga0495586_0001179 3300046535 Bacteria 14671
227 Ga0495586_0060930 3300046535 Bacteria 2053
228 Ga0495587_0003401 3300046536 Bacteria 10619
229 Ga0495645_0001457 3300046543 Bacteria 15986
230 Ga0495622_0037317 3300046557 Bacteria 2264
231 Ga0495667_0008223 3300046559 Bacteria 7080
232 Ga0495667_0008352 3300046559 Bacteria 7024
233 Ga0495667_0335530 3300046559 Bacteria 956
234 Ga0495667_0492128 3300046559 Unclassified 768
235 Ga0495634_0002521 3300046642 Bacteria 15179
236 Ga0495635_0101422 3300046663 Bacteria 1967
237 Ga0495657_0002214 3300046675 Bacteria 16460
238 Ga0495657_0162256 3300046675 Bacteria 1382
239 Ga0495599_0000461 3300046678 Bacteria 23203
240 Ga0495599_0030342 3300046678 Bacteria 3392
241 Ga0495647_0006528 3300046681 Bacteria 3869
242 Ga0495658_0012677 3300046683 Bacteria 4275
243 Ga0495613_0001788 3300046689 Bacteria 16337
244 Ga0495624_0006034 3300046690 Bacteria 8639
245 Ga0495600_0000301 3300046809 Bacteria 26459
246 Ga0495604_0465058 3300047317 Unclassified 824
247 Ga0495636_0019790 3300047318 Bacteria 2708
248 Ga0495674_0016084 3300047319 Bacteria 6982
249 Ga0495680_0009365 3300047322 Bacteria 8816
250 Ga0495680_0033384 3300047322 Bacteria 4168
251 Ga0495680_0192428 3300047322 Bacteria 1467
252 Ga0495675_0001943 3300047444 Bacteria 12328
253 Ga0495684_0027256 3300047471 Bacteria 4387
254 Ga0495614_0080801 3300048089 Bacteria 1408
255 Ga0496102_0149503 3300048905 Bacteria 2194
256 Ga0496102_0439665 3300048905 Unclassified 1224
257 Ga0496109_0358945 3300048912 Unclassified 1377
258 Ga0496110_1083476 3300048913 Unclassified 709
259 Ga0496114_0026630 3300048917 Bacteria 4736
260 Ga0501290_017545 3300049513 Bacteria 959
261 Ga0501031_0040226 3300049568 Bacteria 3052
262 Ga0501031_0211391 3300049568 Bacteria 1264
263 Ga0501032_0550461 3300049569 Bacteria 736
264 Ga0501033_0437224 3300049570 Bacteria 910
265 Ga0501033_0535947 3300049570 Bacteria 807
266 Ga0501036_0027947 3300049572 Bacteria 4769
267 Ga0501036_0936775 3300049572 Unclassified 710
268 Ga0501038_0002732 3300049574 Bacteria 16442
269 Ga0501038_0324346 3300049574 Bacteria 1204
270 Ga0501039_0004582 3300049575 Bacteria 10448
271 Ga0501039_0183142 3300049575 Bacteria 1647
272 Ga0501039_0953037 3300049575 Unclassified 667
273 Ga0501040_0167493 3300049576 Bacteria 1555
274 Ga0501040_1062951 3300049576 Bacteria 587
275 Ga0501041_0016204 3300049577 Bacteria 4429
276 Ga0501042_0016770 3300049578 Bacteria 5037
277 Ga0501046_0112741 3300049580 Bacteria 2076
278 Ga0501048_0038783 3300049582 Bacteria 3418
279 Ga0501048_0138803 3300049582 Bacteria 1719
280 Ga0501048_0306833 3300049582 Bacteria 1129
281 Ga0501048_0508073 3300049582 Bacteria 864
282 Ga0501068_0034963 3300049584 Bacteria 2999
283 Ga0501068_0540396 3300049584 Bacteria 757
284 Ga0501071_0004083 3300049587 Bacteria 9228
285 Ga0501071_0072415 3300049587 Bacteria 2513
286 Ga0501071_0424916 3300049587 Bacteria 1016
287 Ga0501072_0013326 3300049588 Bacteria 6293
288 Ga0501072_0045043 3300049588 Bacteria 3468
289 Ga0501072_0231928 3300049588 Bacteria 1470
290 Ga0501073_0034116 3300049589 Bacteria 3623
291 Ga0501075_0007246 3300049591 Bacteria 7689
292 Ga0501075_0025759 3300049591 Bacteria 4322
293 Ga0501075_0091747 3300049591 Bacteria 2305
294 Ga0501076_0001824 3300049592 Bacteria 14464
295 Ga0501076_0007792 3300049592 Bacteria 7806
296 Ga0501076_0125237 3300049592 Bacteria 2082
297 Ga0501077_0025159 3300049593 Bacteria 3781
298 Ga0501216_109617 3300049660 Bacteria 618
299 Ga0501229_068307 3300049706 Bacteria 553
300 Ga0501079_0002099 3300049741 Bacteria 14306
301 Ga0501079_0547381 3300049741 Unclassified 910
302 Ga0501080_0004298 3300049742 Bacteria 12649
303 Ga0501080_0198030 3300049742 Bacteria 1845
304 Ga0501080_1794999 3300049742 Bacteria 515
305 Ga0501081_0021197 3300049743 Bacteria 4337
306 Ga0501081_0094932 3300049743 Bacteria 2102
307 Ga0501081_0322133 3300049743 Bacteria 1136
308 Ga0501083_0152680 3300049744 Unclassified 1512
309 Ga0501044_0775861 3300049823 Bacteria 839
310 Ga0501044_1090539 3300049823 Bacteria 668
311 Ga0501045_0001682 3300049824 Bacteria 14887
312 Ga0501045_0168690 3300049824 Bacteria 1630
313 Ga0501045_0827279 3300049824 Bacteria 681
314 nmdc:mga07m45_117709_c1 3300050496 Unclassified 1533
315 nmdc:mga0qj67_1428300_c1 3300050509 Unclassified 533
316 nmdc:mga06r32_288048_c1 3300050510 Bacteria 1629
317 nmdc:mga06r32_37691_c1 3300050510 Bacteria 4573
318 nmdc:mga06r32_812_c1 3300050510 Bacteria 27757
319 nmdc:mga08y16_201246_c1 3300050511 Unclassified 2064
320 nmdc:mga0rr50_504468_c1 3300050513 Bacteria 1029
321 nmdc:mga08x19_109454_c1 3300050514 Bacteria 1842
322 nmdc:mga08x19_232853_c1 3300050514 Unclassified 1268
323 Ga0495601_0000559 3300053077 Bacteria 19741
324 Ga0495601_0193978 3300053077 Bacteria 1327
325 Ga0495601_0262439 3300053077 Unclassified 1127
326 Ga0495601_0471988 3300053077 Unclassified 811
327 Ga0495595_0030494 3300053084 Bacteria 2419
328 Ga0495619_0252283 3300053085 Bacteria 1222
329 Ga0500566_0065726 3300053094 Bacteria 2045
330 Ga0501084_0008717 3300054114 Bacteria 8386
331 Ga0501084_0070915 3300054114 Bacteria 2917
332 Ga0501082_0010973 3300060353 Bacteria 7796
333 Ga0501082_0260523 3300060353 Bacteria 1508
334 Ga0501082_0278144 3300060353 Bacteria 1457
335 Ga0501082_0864470 3300060353 Unclassified 791
336 Ga0530510_0001032 3300061734 Bacteria 18419

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046454 Ga0495592_0012190 Ga0495592_0012190_782_1309 140
2 3300046516 Ga0495628_0001568 Ga0495628_0001568_13155_13682 140
3 3300046535 Ga0495586_0060930 Ga0495586_0060930_826_1353 140
4 3300049742 Ga0501080_1794999 Ga0501080_1794999_18_467 140
5 3300053077 Ga0495601_0000559 Ga0495601_0000559_13806_14333 140
6 3300009094 Ga0111539_10257931 Ga0111539_102579313 143
7 3300034817 Ga0373948_0175152 Ga0373948_0175152_33_497 143
8 3300048905 Ga0496102_0439665 Ga0496102_0439665_409_852 143
9 3300048912 Ga0496109_0358945 Ga0496109_0358945_319_762 143
10 3300048913 Ga0496110_1083476 Ga0496110_1083476_155_598 143
11 3300048917 Ga0496114_0026630 Ga0496114_0026630_3073_3516 143
12 3300049513 Ga0501290_017545 Ga0501290_017545_49_513 143
13 3300049582 Ga0501048_0508073 Ga0501048_0508073_11_448 143
14 3300050511 nmdc:mga08y16_201246_c1 nmdc:mga08y16_201246_c1_294_737 143
15 3300049706 Ga0501229_068307 Ga0501229_068307_85_543 147
16 3300045051 Ga0451576_0126320 Ga0451576_0126320_600_1127 151
17 3300005437 Ga0070710_10039476 Ga0070710_100394762 153
18 3300035086 Ga0373934_0047340 Ga0373934_0047340_670_1209 153
19 3300035117 Ga0373953_0092774 Ga0373953_0092774_681_1220 153
20 3300035120 Ga0373957_0011545 Ga0373957_0011545_756_1295 153
21 3300035724 Ga0373933_0411808 Ga0373933_0411808_61_600 153
22 3300036401 Ga0373937_0005477 Ga0373937_0005477_2992_3531 153
23 3300037471 Ga0395905_0190029 Ga0395905_0190029_869_1405 153
24 3300047322 Ga0495680_0033384 Ga0495680_0033384_788_1327 153
25 3300006353 Ga0075370_10107779 Ga0075370_101077793 157
26 3300049660 Ga0501216_109617 Ga0501216_109617_105_593 157
27 3300050496 nmdc:mga07m45_117709_c1 nmdc:mga07m45_117709_c1_110_661 157
28 3300005546 Ga0070696_100484693 Ga0070696_1004846932 158
29 3300035119 Ga0373956_0014877 Ga0373956_0014877_1087_1626 158
30 3300049568 Ga0501031_0211391 Ga0501031_0211391_748_1251 158
31 3300035086 Ga0373934_0002280 Ga0373934_0002280_4021_4548 159
32 3300035111 Ga0373923_0005622 Ga0373923_0005622_200_727 159
33 3300035113 Ga0373936_0000889 Ga0373936_0000889_2768_3295 159
34 3300035117 Ga0373953_0147524 Ga0373953_0147524_52_579 159
35 3300035118 Ga0373954_0010175 Ga0373954_0010175_1444_1971 159
36 3300035119 Ga0373956_0008670 Ga0373956_0008670_1218_1745 159
37 3300035120 Ga0373957_0000670 Ga0373957_0000670_3493_4020 159
38 3300035170 Ga0373943_0016637 Ga0373943_0016637_352_879 159
39 3300035171 Ga0373946_0011804 Ga0373946_0011804_1846_2373 159
40 3300035172 Ga0373955_0008840 Ga0373955_0008840_3351_3878 159
41 3300035692 Ga0373935_0011893 Ga0373935_0011893_2513_3040 159
42 3300035695 Ga0373927_0031320 Ga0373927_0031320_79_606 159
43 3300035724 Ga0373933_0014198 Ga0373933_0014198_1160_1687 159
44 3300035724 Ga0373933_0126226 Ga0373933_0126226_745_1272 159
45 3300036401 Ga0373937_0805140 Ga0373937_0805140_161_688 159
46 3300036401 Ga0373937_0805146 Ga0373937_0805146_200_727 159
47 3300037068 Ga0373925_0011254 Ga0373925_0011254_635_1162 159
48 3300046454 Ga0495592_0009535 Ga0495592_0009535_1862_2389 159
49 3300046461 Ga0495641_0000646 Ga0495641_0000646_13948_14475 159
50 3300046462 Ga0495651_0001148 Ga0495651_0001148_13084_13611 159
51 3300046463 Ga0495653_0016472 Ga0495653_0016472_2640_3167 159
52 3300046472 Ga0495580_0026721 Ga0495580_0026721_1589_2116 159
53 3300046473 Ga0495582_0029451 Ga0495582_0029451_1826_2353 159
54 3300046476 Ga0495662_0001966 Ga0495662_0001966_2438_2965 159
55 3300046477 Ga0495664_0015795 Ga0495664_0015795_1811_2338 159
56 3300046499 Ga0495594_0014199 Ga0495594_0014199_274_801 159
57 3300046511 Ga0495608_0009175 Ga0495608_0009175_995_1522 159
58 3300046514 Ga0495618_0006570 Ga0495618_0006570_3642_4169 159
59 3300046517 Ga0495630_0003803 Ga0495630_0003803_6315_6842 159
60 3300046526 Ga0495666_0000205 Ga0495666_0000205_13203_13730 159
61 3300046529 Ga0495652_0150602 Ga0495652_0150602_429_956 159
62 3300046533 Ga0495640_0006505 Ga0495640_0006505_6788_7315 159
63 3300046535 Ga0495586_0001179 Ga0495586_0001179_3572_4099 159
64 3300046536 Ga0495587_0003401 Ga0495587_0003401_8095_8622 159
65 3300046559 Ga0495667_0008223 Ga0495667_0008223_2738_3265 159
66 3300046559 Ga0495667_0492128 Ga0495667_0492128_161_688 159
67 3300046642 Ga0495634_0002521 Ga0495634_0002521_2513_3040 159
68 3300046663 Ga0495635_0101422 Ga0495635_0101422_224_751 159
69 3300046675 Ga0495657_0002214 Ga0495657_0002214_425_952 159
70 3300046678 Ga0495599_0030342 Ga0495599_0030342_2394_2921 159
71 3300046681 Ga0495647_0006528 Ga0495647_0006528_689_1216 159
72 3300046683 Ga0495658_0012677 Ga0495658_0012677_1559_2086 159
73 3300046689 Ga0495613_0001788 Ga0495613_0001788_9116_9643 159
74 3300046690 Ga0495624_0006034 Ga0495624_0006034_7138_7665 159
75 3300046809 Ga0495600_0000301 Ga0495600_0000301_2979_3506 159
76 3300047317 Ga0495604_0465058 Ga0495604_0465058_200_727 159
77 3300047319 Ga0495674_0016084 Ga0495674_0016084_2640_3167 159
78 3300047322 Ga0495680_0009365 Ga0495680_0009365_7423_7950 159
79 3300047444 Ga0495675_0001943 Ga0495675_0001943_9298_9825 159
80 3300047471 Ga0495684_0027256 Ga0495684_0027256_254_781 159
81 3300048089 Ga0495614_0080801 Ga0495614_0080801_238_765 159
82 3300053077 Ga0495601_0193978 Ga0495601_0193978_346_873 159
83 3300053084 Ga0495595_0030494 Ga0495595_0030494_552_1079 159
84 3300053085 Ga0495619_0252283 Ga0495619_0252283_100_627 159
85 3300053094 Ga0500566_0065726 Ga0500566_0065726_926_1453 159
86 3300005471 Ga0070698_100534607 Ga0070698_1005346072 160
87 3300005518 Ga0070699_100981482 Ga0070699_1009814821 160
88 3300007076 Ga0075435_100189917 Ga0075435_1001899172 161
89 3300014325 Ga0163163_10066238 Ga0163163_100662382 161
90 3300035118 Ga0373954_0002079 Ga0373954_0002079_4695_5222 161
91 3300046559 Ga0495667_0008352 Ga0495667_0008352_5031_5558 161
92 3300050509 nmdc:mga0qj67_1428300_c1 nmdc:mga0qj67_1428300_c1_11_514 161
93 3300050513 nmdc:mga0rr50_504468_c1 nmdc:mga0rr50_504468_c1_119_643 161
94 3300050514 nmdc:mga08x19_109454_c1 nmdc:mga08x19_109454_c1_616_1140 161
95 3300035119 Ga0373956_0205085 Ga0373956_0205085_329_835 162
96 3300035172 Ga0373955_0076541 Ga0373955_0076541_99_638 162
97 3300044673 Ga0453683_0159516 Ga0453683_0159516_301_801 162
98 3300032002 Ga0307416_100524070 Ga0307416_1005240702 163
99 3300042876 Ga0451577_0056873 Ga0451577_0056873_246_770 163
100 3300031344 Ga0265316_10130059 Ga0265316_101300592 164
101 3300006914 Ga0075436_100156201 Ga0075436_1001562012 165
102 3300038996 Ga0242420_054334 Ga0242420_054334_222_749 165
103 3300046454 Ga0495592_0084287 Ga0495592_0084287_950_1477 165
104 3300046516 Ga0495628_0000486 Ga0495628_0000486_21542_22069 165
105 3300046529 Ga0495652_0002564 Ga0495652_0002564_16182_16709 165
106 3300046543 Ga0495645_0001457 Ga0495645_0001457_12749_13276 165
107 3300046678 Ga0495599_0000461 Ga0495599_0000461_6673_7200 165
108 iso_pu_bacteria 639633007 639788813 165
109 3300005545 Ga0070695_100035059 Ga0070695_1000350593 166
110 3300006173 Ga0070716_100002115 Ga0070716_1000021155 166
111 3300006914 Ga0075436_100026936 Ga0075436_1000269365 166
112 3300007788 Ga0099795_10015261 Ga0099795_100152614 166
113 3300010159 Ga0099796_10087022 Ga0099796_100870222 166
114 3300025939 Ga0207665_10001087 Ga0207665_100010875 166
115 3300049568 Ga0501031_0040226 Ga0501031_0040226_223_741 166
116 3300049569 Ga0501032_0550461 Ga0501032_0550461_106_627 166
117 3300049574 Ga0501038_0002732 Ga0501038_0002732_949_1467 166
118 3300049823 Ga0501044_0775861 Ga0501044_0775861_233_751 166
119 3300049823 Ga0501044_1090539 Ga0501044_1090539_87_608 166
120 3300050514 nmdc:mga08x19_232853_c1 nmdc:mga08x19_232853_c1_628_1158 166
121 3300005340 Ga0070689_101816551 Ga0070689_1018165511 167
122 3300005366 Ga0070659_100113247 Ga0070659_1001132472 167
123 3300005434 Ga0070709_10404080 Ga0070709_104040802 167
124 3300005440 Ga0070705_100111440 Ga0070705_1001114402 167
125 3300005458 Ga0070681_10035900 Ga0070681_100359002 167
126 3300005539 Ga0068853_100001374 Ga0068853_1000013742 167
127 3300005547 Ga0070693_100202460 Ga0070693_1002024602 167
128 3300005549 Ga0070704_100003706 Ga0070704_1000037066 167
129 3300005549 Ga0070704_100447922 Ga0070704_1004479221 167
130 3300005563 Ga0068855_100055617 Ga0068855_1000556173 167
131 3300005563 Ga0068855_100141574 Ga0068855_1001415742 167
132 3300005577 Ga0068857_100034517 Ga0068857_1000345173 167
133 3300005614 Ga0068856_100343836 Ga0068856_1003438362 167
134 3300005614 Ga0068856_100605841 Ga0068856_1006058412 167
135 3300005842 Ga0068858_100026206 Ga0068858_1000262065 167
136 3300006358 Ga0068871_100432303 Ga0068871_1004323032 167
137 3300007265 Ga0099794_10037357 Ga0099794_100373572 167
138 3300007265 Ga0099794_10057924 Ga0099794_100579241 167
139 3300007265 Ga0099794_10285043 Ga0099794_102850432 167
140 3300007788 Ga0099795_10022052 Ga0099795_100220522 167
141 3300009093 Ga0105240_10092411 Ga0105240_100924111 167
142 3300009174 Ga0105241_10021802 Ga0105241_100218023 167
143 3300009545 Ga0105237_10008914 Ga0105237_100089146 167
144 3300009551 Ga0105238_10060911 Ga0105238_100609113 167
145 3300010375 Ga0105239_10168074 Ga0105239_101680743 167
146 3300013105 Ga0157369_10885463 Ga0157369_108854631 167
147 3300013297 Ga0157378_10716274 Ga0157378_107162742 167
148 3300013307 Ga0157372_10089203 Ga0157372_100892032 167
149 3300013308 Ga0157375_10901408 Ga0157375_109014082 167
150 3300025911 Ga0207654_10004491 Ga0207654_100044917 167
151 3300025912 Ga0207707_10257858 Ga0207707_102578582 167
152 3300025924 Ga0207694_10036929 Ga0207694_100369293 167
153 3300025932 Ga0207690_10024182 Ga0207690_100241823 167
154 3300025945 Ga0207679_10482577 Ga0207679_104825772 167
155 3300025949 Ga0207667_10070010 Ga0207667_100700103 167
156 3300025949 Ga0207667_10281531 Ga0207667_102815312 167
157 3300026035 Ga0207703_10015001 Ga0207703_100150012 167
158 3300026041 Ga0207639_10010995 Ga0207639_100109955 167
159 3300026078 Ga0207702_10374212 Ga0207702_103742122 167
160 3300026078 Ga0207702_10545353 Ga0207702_105453532 167
161 3300026116 Ga0207674_10030131 Ga0207674_100301314 167
162 3300027512 Ga0209179_1004397 Ga0209179_10043972 167
163 3300027671 Ga0209588_1001855 Ga0209588_10018552 167
164 3300027671 Ga0209588_1132685 Ga0209588_11326851 167
165 3300035086 Ga0373934_0000011 Ga0373934_0000011_24438_24965 167
166 3300035119 Ga0373956_0000124 Ga0373956_0000124_1512_2039 167
167 3300035724 Ga0373933_0000331 Ga0373933_0000331_1028_1555 167
168 3300036401 Ga0373937_0001929 Ga0373937_0001929_3293_3820 167
169 3300042876 Ga0451577_0036235 Ga0451577_0036235_3676_4212 167
170 3300046462 Ga0495651_0000570 Ga0495651_0000570_1512_2039 167
171 3300046463 Ga0495653_0725629 Ga0495653_0725629_57_584 167
172 3300046557 Ga0495622_0037317 Ga0495622_0037317_1468_1995 167
173 3300046559 Ga0495667_0335530 Ga0495667_0335530_97_624 167
174 3300046675 Ga0495657_0162256 Ga0495657_0162256_404_931 167
175 3300047322 Ga0495680_0192428 Ga0495680_0192428_810_1337 167
176 3300048905 Ga0496102_0149503 Ga0496102_0149503_1599_2129 167
177 3300049572 Ga0501036_0936775 Ga0501036_0936775_19_537 167
178 3300049741 Ga0501079_0547381 Ga0501079_0547381_46_570 167
179 3300053077 Ga0495601_0262439 Ga0495601_0262439_392_919 167
180 3300053077 Ga0495601_0471988 Ga0495601_0471988_168_695 167
181 3300005444 Ga0070694_100622675 Ga0070694_1006226751 168
182 3300005471 Ga0070698_100427600 Ga0070698_1004276002 168
183 3300006038 Ga0075365_10458896 Ga0075365_104588962 168
184 3300006163 Ga0070715_10371884 Ga0070715_103718841 168
185 3300006847 Ga0075431_100043332 Ga0075431_1000433322 168
186 3300006871 Ga0075434_101509881 Ga0075434_1015098812 168
187 3300025905 Ga0207685_10221524 Ga0207685_102215241 168
188 3300028653 Ga0265323_10005124 Ga0265323_100051244 168
189 3300031238 Ga0265332_10039960 Ga0265332_100399602 168
190 3300031344 Ga0265316_10094425 Ga0265316_100944252 168
191 3300031507 Ga0307509_10000018 Ga0307509_10000018226 168
192 3300033529 Ga0316587_1001331 Ga0316587_10013312 168
193 3300035695 Ga0373927_0349364 Ga0373927_0349364_114_653 168
194 3300041509 Ga0451843_0749695 Ga0451843_0749695_330_875 168
195 3300042876 Ga0451577_0060561 Ga0451577_0060561_599_1141 168
196 3300044712 Ga0453684_0001597 Ga0453684_0001597_11460_12002 168
197 3300044712 Ga0453684_0002735 Ga0453684_0002735_16570_17115 168
198 3300044712 Ga0453684_0006614 Ga0453684_0006614_15405_15950 168
199 3300044712 Ga0453684_0228279 Ga0453684_0228279_526_1071 168
200 3300044712 Ga0453684_0796631 Ga0453684_0796631_290_835 168
201 3300045051 Ga0451576_0000272 Ga0451576_0000272_96056_96598 168
202 3300045051 Ga0451576_0049679 Ga0451576_0049679_316_861 168
203 3300047318 Ga0495636_0019790 Ga0495636_0019790_1561_2091 168
204 3300049570 Ga0501033_0437224 Ga0501033_0437224_19_561 168
205 3300049570 Ga0501033_0535947 Ga0501033_0535947_143_685 168
206 3300049572 Ga0501036_0027947 Ga0501036_0027947_795_1337 168
207 3300049574 Ga0501038_0324346 Ga0501038_0324346_289_831 168
208 3300049575 Ga0501039_0004582 Ga0501039_0004582_1488_2030 168
209 3300049575 Ga0501039_0183142 Ga0501039_0183142_403_927 168
210 3300049576 Ga0501040_0167493 Ga0501040_0167493_625_1167 168
211 3300049577 Ga0501041_0016204 Ga0501041_0016204_3193_3735 168
212 3300049578 Ga0501042_0016770 Ga0501042_0016770_4035_4577 168
213 3300049580 Ga0501046_0112741 Ga0501046_0112741_1191_1733 168
214 3300049582 Ga0501048_0038783 Ga0501048_0038783_262_804 168
215 3300049582 Ga0501048_0306833 Ga0501048_0306833_27_569 168
216 3300049584 Ga0501068_0034963 Ga0501068_0034963_447_971 168
217 3300049584 Ga0501068_0540396 Ga0501068_0540396_61_603 168
218 3300049587 Ga0501071_0004083 Ga0501071_0004083_307_831 168
219 3300049587 Ga0501071_0072415 Ga0501071_0072415_725_1267 168
220 3300049588 Ga0501072_0013326 Ga0501072_0013326_78_620 168
221 3300049588 Ga0501072_0045043 Ga0501072_0045043_1446_1970 168
222 3300049588 Ga0501072_0231928 Ga0501072_0231928_498_1040 168
223 3300049589 Ga0501073_0034116 Ga0501073_0034116_490_1014 168
224 3300049591 Ga0501075_0007246 Ga0501075_0007246_343_867 168
225 3300049591 Ga0501075_0025759 Ga0501075_0025759_2654_3196 168
226 3300049591 Ga0501075_0091747 Ga0501075_0091747_1003_1545 168
227 3300049592 Ga0501076_0001824 Ga0501076_0001824_7436_7978 168
228 3300049592 Ga0501076_0007792 Ga0501076_0007792_1679_2203 168
229 3300049592 Ga0501076_0125237 Ga0501076_0125237_185_727 168
230 3300049593 Ga0501077_0025159 Ga0501077_0025159_2205_2747 168
231 3300049741 Ga0501079_0002099 Ga0501079_0002099_4371_4913 168
232 3300049742 Ga0501080_0004298 Ga0501080_0004298_9846_10370 168
233 3300049743 Ga0501081_0021197 Ga0501081_0021197_1283_1825 168
234 3300049743 Ga0501081_0094932 Ga0501081_0094932_1273_1797 168
235 3300049743 Ga0501081_0322133 Ga0501081_0322133_555_1097 168
236 3300049744 Ga0501083_0152680 Ga0501083_0152680_750_1292 168
237 3300049824 Ga0501045_0001682 Ga0501045_0001682_7903_8445 168
238 3300049824 Ga0501045_0168690 Ga0501045_0168690_858_1400 168
239 3300050510 nmdc:mga06r32_37691_c1 nmdc:mga06r32_37691_c1_3145_3672 168
240 3300054114 Ga0501084_0008717 Ga0501084_0008717_5116_5658 168
241 3300060353 Ga0501082_0010973 Ga0501082_0010973_5901_6443 168
242 3300060353 Ga0501082_0260523 Ga0501082_0260523_429_971 168
243 3300060353 Ga0501082_0278144 Ga0501082_0278144_232_756 168
244 3300061734 Ga0530510_0001032 Ga0530510_0001032_6535_7077 168
245 3300005331 Ga0070670_100080624 Ga0070670_1000806243 169
246 3300005334 Ga0068869_100000748 Ga0068869_10000074812 169
247 3300005335 Ga0070666_10189437 Ga0070666_101894372 169
248 3300005340 Ga0070689_100134005 Ga0070689_1001340052 169
249 3300005343 Ga0070687_100595969 Ga0070687_1005959692 169
250 3300005353 Ga0070669_101375144 Ga0070669_1013751441 169
251 3300005354 Ga0070675_100024903 Ga0070675_1000249035 169
252 3300005356 Ga0070674_100131805 Ga0070674_1001318052 169
253 3300005367 Ga0070667_101091700 Ga0070667_1010917001 169
254 3300005440 Ga0070705_100204312 Ga0070705_1002043122 169
255 3300005441 Ga0070700_100256176 Ga0070700_1002561762 169
256 3300005456 Ga0070678_100060614 Ga0070678_1000606143 169
257 3300005459 Ga0068867_100156291 Ga0068867_1001562911 169
258 3300005544 Ga0070686_100155734 Ga0070686_1001557342 169
259 3300005548 Ga0070665_100010415 Ga0070665_1000104157 169
260 3300005578 Ga0068854_100874294 Ga0068854_1008742942 169
261 3300005615 Ga0070702_100051058 Ga0070702_1000510584 169
262 3300005617 Ga0068859_100004039 Ga0068859_1000040399 169
263 3300005618 Ga0068864_100063600 Ga0068864_1000636002 169
264 3300005719 Ga0068861_100289117 Ga0068861_1002891172 169
265 3300005841 Ga0068863_100043046 Ga0068863_1000430464 169
266 3300005842 Ga0068858_100039504 Ga0068858_1000395044 169
267 3300005844 Ga0068862_100075876 Ga0068862_1000758762 169
268 3300006237 Ga0097621_100041446 Ga0097621_1000414464 169
269 3300006846 Ga0075430_100140515 Ga0075430_1001405152 169
270 3300006847 Ga0075431_100125345 Ga0075431_1001253452 169
271 3300006881 Ga0068865_100406725 Ga0068865_1004067252 169
272 3300006931 Ga0097620_100004039 Ga0097620_1000040399 169
273 3300009098 Ga0105245_10104933 Ga0105245_101049333 169
274 3300009148 Ga0105243_10439672 Ga0105243_104396722 169
275 3300009174 Ga0105241_10126964 Ga0105241_101269642 169
276 3300009176 Ga0105242_10042298 Ga0105242_100422984 169
277 3300009176 Ga0105242_11033785 Ga0105242_110337851 169
278 3300009177 Ga0105248_10001876 Ga0105248_100018765 169
279 3300009551 Ga0105238_10195945 Ga0105238_101959453 169
280 3300010375 Ga0105239_10061863 Ga0105239_100618634 169
281 3300011119 Ga0105246_10007889 Ga0105246_100078894 169
282 3300011119 Ga0105246_10990813 Ga0105246_109908131 169
283 3300014325 Ga0163163_10053565 Ga0163163_100535652 169
284 3300014325 Ga0163163_11585292 Ga0163163_115852922 169
285 3300014326 Ga0157380_10096182 Ga0157380_100961822 169
286 3300014968 Ga0157379_10040563 Ga0157379_100405634 169
287 3300014969 Ga0157376_11918660 Ga0157376_119186601 169
288 3300025903 Ga0207680_10243332 Ga0207680_102433322 169
289 3300025926 Ga0207659_10038347 Ga0207659_100383474 169
290 3300025927 Ga0207687_10219182 Ga0207687_102191822 169
291 3300025934 Ga0207686_10149576 Ga0207686_101495762 169
292 3300025936 Ga0207670_10029654 Ga0207670_100296542 169
293 3300025937 Ga0207669_10049861 Ga0207669_100498612 169
294 3300025940 Ga0207691_10230037 Ga0207691_102300372 169
295 3300025941 Ga0207711_10014208 Ga0207711_100142083 169
296 3300025942 Ga0207689_10002992 Ga0207689_100029924 169
297 3300026035 Ga0207703_10040646 Ga0207703_100406463 169
298 3300026075 Ga0207708_10224007 Ga0207708_102240072 169
299 3300026088 Ga0207641_10041880 Ga0207641_100418802 169
300 3300026089 Ga0207648_10050473 Ga0207648_100504732 169
301 3300026095 Ga0207676_10110209 Ga0207676_101102093 169
302 3300026118 Ga0207675_100091197 Ga0207675_1000911972 169
303 3300026121 Ga0207683_10027436 Ga0207683_100274362 169
304 3300028379 Ga0268266_10055827 Ga0268266_100558273 169
305 3300028380 Ga0268265_10053174 Ga0268265_100531742 169
306 3300028381 Ga0268264_10043062 Ga0268264_100430622 169
307 3300028381 Ga0268264_11558019 Ga0268264_115580191 169
308 3300031241 Ga0265325_10017237 Ga0265325_100172374 169
309 3300031344 Ga0265316_10120568 Ga0265316_101205683 169
310 3300035172 Ga0373955_0133319 Ga0373955_0133319_168_698 169
311 3300035724 Ga0373933_0975769 Ga0373933_0975769_11_541 169
312 3300037068 Ga0373925_0121641 Ga0373925_0121641_313_840 169
313 3300042876 Ga0451577_0000489 Ga0451577_0000489_35228_35773 169
314 3300044712 Ga0453684_0000014 Ga0453684_0000014_463507_464052 169
315 3300044712 Ga0453684_0000189 Ga0453684_0000189_47977_48522 169
316 3300044712 Ga0453684_0000731 Ga0453684_0000731_31194_31739 169
317 3300049575 Ga0501039_0953037 Ga0501039_0953037_52_579 169
318 3300049576 Ga0501040_1062951 Ga0501040_1062951_27_554 169
319 3300049582 Ga0501048_0138803 Ga0501048_0138803_809_1336 169
320 3300049587 Ga0501071_0424916 Ga0501071_0424916_395_919 169
321 3300049742 Ga0501080_0198030 Ga0501080_0198030_667_1188 169
322 3300049824 Ga0501045_0827279 Ga0501045_0827279_119_643 169
323 3300050510 nmdc:mga06r32_288048_c1 nmdc:mga06r32_288048_c1_821_1348 169
324 3300054114 Ga0501084_0070915 Ga0501084_0070915_199_738 169
325 3300060353 Ga0501082_0864470 Ga0501082_0864470_216_743 169
326 3300006847 Ga0075431_100000324 Ga0075431_10000032437 170
327 3300031241 Ga0265325_10079000 Ga0265325_100790003 170
328 3300050510 nmdc:mga06r32_812_c1 nmdc:mga06r32_812_c1_5882_6412 170
329 3300004800 Ga0058861_11357333 Ga0058861_113573332 171
330 3300004803 Ga0058862_11271760 Ga0058862_112717602 171
331 3300005539 Ga0068853_101054318 Ga0068853_1010543181 171
332 3300009176 Ga0105242_11330280 Ga0105242_113302801 171
333 3300013296 Ga0157374_10000127 Ga0157374_1000012742 171
334 3300013297 Ga0157378_10051407 Ga0157378_100514073 171
335 3300014969 Ga0157376_10584026 Ga0157376_105840261 171
336 3300025934 Ga0207686_10867358 Ga0207686_108673582 171
337 3300026041 Ga0207639_11213559 Ga0207639_112135591 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04351

PilP

Pilus assembly protein, PilP

44

182

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mqw-assembly1.cif.gz_A-2 structure of the mt-adprase in complex with three mn2+ ions and ampcpr, a nudix enzyme 0.9617 132 163
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9545 78 164
2y4y-assembly1.cif.gz_A-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9501 77 165
2y4y-assembly1.cif.gz_C-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9453 83 165
2y4y-assembly1.cif.gz_D-2 structure of a domain from the type iv pilus biogenesis lipoprotein pilp, from pseudomonas aeruginosa 0.9432 78 164
ID Description Score Start End Superfamily
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9453 83 165 2.30.30.830
2y4yC00 Mainly Beta;Roll;SH3 type barrels.; 0.9112 83 165 2.30.30.830
5qj4D00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9038 132 161 3.90.79.10
af_Q2FY72_1_175_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8649 132 163 3.90.79.10
2lc4A00 Mainly Beta;Roll;SH3 type barrels.; 0.8573 77 168 2.30.30.830
ID Description Score Start End GO Terms
AF-A0A645H133-F1-model_v4 Uncharacterized protein 0.9743 98 171
AF-A0A2R7TAJ7-F1-model_v4 Pilus assembly protein PilP 0.972 82 168
AF-A0A382ZGV8-F1-model_v4 Pilus assembly protein PilP 0.9575 76 168
AF-A0A1B3PKD3-F1-model_v4 Pilus assembly, PilP family protein 0.9575 97 166
AF-A0A2H0NN81-F1-model_v4 Pilus assembly protein PilP 0.9556 91 166

Feature Viewer

pLDDT pTM Quality
79.51 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map