F413001

General Info

Members Datasets Scaffolds Average Seq Length
337 172 674 138

Family's Representative Sequence

Representative Sequence 3300005616|Ga0068852_100401140|Ga0068852_1004011402
Length 145
Sequence MYFAEITMNQTFHTITVPTRGPGLYEFTDEATDFVRGAKIADGLLTCFIRHTSASLLIQENADPDVQRDLQDFFAWLATSGPRFRHTTEGPDDMPSHIRSALTQVSLGIPVAKGRLALGTWQGIYVFEHRDAPHRREVTLHLIGA

Samples

Sample ID Description Type Environment
1 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
38 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
57 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
95 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
96 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
97 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
98 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
101 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
102 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
108 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
111 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
127 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
131 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
150 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
151 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
154 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
155 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
156 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
157 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
168 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
169 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.15
Nodule 0
Rhizoplane 0.3
Rhizosphere 93.47
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068852_100401140 3300005616 Bacteria 1349
2 rootH2_10001888 3300003320 Bacteria 9122
3 rootH2_10029615 3300003320 Bacteria 1983
4 Ga0070658_10017310 3300005327 Bacteria 5768
5 Ga0070658_11041738 3300005327 Bacteria 712
6 Ga0070683_101809973 3300005329 Bacteria 587
7 Ga0070670_100154306 3300005331 Bacteria 1988
8 Ga0068869_100109017 3300005334 Bacteria 2104
9 Ga0068868_100103692 3300005338 Bacteria 2304
10 Ga0070660_100586160 3300005339 Bacteria 932
11 Ga0070661_100000254 3300005344 Bacteria 43578
12 Ga0070661_101055119 3300005344 Bacteria 676
13 Ga0070668_100936613 3300005347 Bacteria 776
14 Ga0070714_101414449 3300005435 Bacteria 679
15 Ga0070713_100832030 3300005436 Bacteria 886
16 Ga0070713_101071100 3300005436 Bacteria 779
17 Ga0070713_101373299 3300005436 Bacteria 685
18 Ga0070710_10900497 3300005437 Bacteria 639
19 Ga0070710_11252823 3300005437 Bacteria 550
20 Ga0070711_100779611 3300005439 Bacteria 810
21 Ga0070700_100687498 3300005441 Bacteria 812
22 Ga0070678_100007429 3300005456 Bacteria 6500
23 Ga0070662_100542480 3300005457 Bacteria 974
24 Ga0070681_10141132 3300005458 Bacteria 2339
25 Ga0070681_10843191 3300005458 Bacteria 834
26 Ga0068867_100016001 3300005459 Bacteria 5325
27 Ga0068867_100134146 3300005459 Bacteria 1928
28 Ga0070685_10124573 3300005466 Bacteria 1604
29 Ga0070679_100119650 3300005530 Bacteria 2618
30 Ga0070679_100184525 3300005530 Bacteria 2058
31 Ga0070679_100686229 3300005530 Bacteria 967
32 Ga0070684_100169556 3300005535 Bacteria 1982
33 Ga0070684_101126001 3300005535 Bacteria 738
34 Ga0070684_101769050 3300005535 Bacteria 583
35 Ga0068853_100037237 3300005539 Bacteria 4139
36 Ga0068853_100142065 3300005539 Bacteria 2155
37 Ga0070672_100463987 3300005543 Bacteria 1092
38 Ga0070672_101778091 3300005543 Bacteria 554
39 Ga0070665_100001302 3300005548 Bacteria 29816
40 Ga0070665_100125846 3300005548 Bacteria 2565
41 Ga0070665_100205755 3300005548 Bacteria 1969
42 Ga0070665_100740796 3300005548 Bacteria 996
43 Ga0068855_100065280 3300005563 Bacteria 4243
44 Ga0068855_100268381 3300005563 Bacteria 1898
45 Ga0068857_100174122 3300005577 Bacteria 1957
46 Ga0068857_100179817 3300005577 Bacteria 1925
47 Ga0068856_100118813 3300005614 Bacteria 2644
48 Ga0068856_100181514 3300005614 Bacteria 2118
49 Ga0068852_101425219 3300005616 Bacteria 715
50 Ga0068866_10116445 3300005718 Bacteria 1499
51 Ga0068866_10284587 3300005718 Bacteria 1026
52 Ga0068870_10080190 3300005840 Bacteria 1803
53 Ga0068863_102032652 3300005841 Bacteria 585
54 Ga0068862_100392497 3300005844 Bacteria 1297
55 Ga0068862_100429343 3300005844 Bacteria 1242
56 Ga0068871_100042130 3300006358 Bacteria 3663
57 Ga0105240_10019617 3300009093 Bacteria 9031
58 Ga0105240_10049843 3300009093 Bacteria 5282
59 Ga0105240_10295631 3300009093 Bacteria 1854
60 Ga0105240_10296666 3300009093 Bacteria 1851
61 Ga0105240_10405960 3300009093 Bacteria 1533
62 Ga0105240_10449694 3300009093 Bacteria 1442
63 Ga0105240_10791179 3300009093 Bacteria 1028
64 Ga0105240_11419874 3300009093 Bacteria 729
65 Ga0105243_10004582 3300009148 Bacteria 10901
66 Ga0105241_10179588 3300009174 Bacteria 1755
67 Ga0105241_10309542 3300009174 Bacteria 1358
68 Ga0105242_10051210 3300009176 Bacteria 3364
69 Ga0105242_10382872 3300009176 Bacteria 1308
70 Ga0105242_11170672 3300009176 Bacteria 786
71 Ga0105248_10141690 3300009177 Bacteria 2712
72 Ga0105248_10208380 3300009177 Bacteria 2202
73 Ga0105237_10229518 3300009545 Bacteria 1857
74 Ga0105237_10292733 3300009545 Bacteria 1631
75 Ga0105237_10367097 3300009545 Bacteria 1444
76 Ga0105237_10840849 3300009545 Bacteria 925
77 Ga0105238_10104427 3300009551 Bacteria 2814
78 Ga0105238_10247833 3300009551 Bacteria 1759
79 Ga0105238_10548193 3300009551 Bacteria 1160
80 Ga0105238_11829918 3300009551 Bacteria 639
81 Ga0105238_11892276 3300009551 Bacteria 629
82 Ga0105238_12411707 3300009551 Bacteria 562
83 Ga0105249_10064235 3300009553 Bacteria 3374
84 Ga0105249_10315866 3300009553 Bacteria 1572
85 Ga0105239_10016304 3300010375 Bacteria 8215
86 Ga0105239_10149177 3300010375 Bacteria 2609
87 Ga0105239_11087442 3300010375 Bacteria 920
88 Ga0105239_11111588 3300010375 Bacteria 910
89 Ga0105239_11276586 3300010375 Bacteria 847
90 Ga0105239_11569605 3300010375 Bacteria 761
91 Ga0105239_13405419 3300010375 Bacteria 517
92 Ga0105246_11129919 3300011119 Bacteria 717
93 Ga0105246_11455412 3300011119 Bacteria 641
94 Ga0157373_10272751 3300013100 Bacteria 1198
95 Ga0157370_10025977 3300013104 Bacteria 5788
96 Ga0157370_10030611 3300013104 Bacteria 5273
97 Ga0157370_11004401 3300013104 Bacteria 755
98 Ga0157370_11204778 3300013104 Bacteria 683
99 Ga0157369_10308172 3300013105 Bacteria 1646
100 Ga0157369_10628342 3300013105 Bacteria 1108
101 Ga0157374_10182136 3300013296 Bacteria 2052
102 Ga0157378_10316955 3300013297 Bacteria 1514
103 Ga0157378_10406893 3300013297 Bacteria 1342
104 Ga0163162_10243736 3300013306 Bacteria 1929
105 Ga0163162_10270773 3300013306 Bacteria 1830
106 Ga0163162_11831129 3300013306 Bacteria 694
107 Ga0157372_11425884 3300013307 Bacteria 798
108 Ga0157372_12148173 3300013307 Bacteria 641
109 Ga0157375_10118439 3300013308 Bacteria 2754
110 Ga0163163_10000012 3300014325 Bacteria 257369
111 Ga0163163_10169880 3300014325 Bacteria 2227
112 Ga0163163_10327960 3300014325 Bacteria 1585
113 Ga0163163_12943690 3300014325 Unclassified 531
114 Ga0157379_10003912 3300014968 Bacteria 12701
115 Ga0157379_10498286 3300014968 Bacteria 1129
116 Ga0157379_10696466 3300014968 Bacteria 953
117 Ga0157376_10259642 3300014969 Bacteria 1627
118 Ga0157376_11185013 3300014969 Bacteria 792
119 Ga0163161_10077000 3300017792 Bacteria 2449
120 Ga0209233_1000006 3300025261 Bacteria 1473685
121 Ga0209233_1004865 3300025261 Bacteria 4522
122 Ga0209455_1011654 3300025272 Bacteria 2151
123 Ga0207688_10025364 3300025901 Bacteria 3255
124 Ga0207680_10246382 3300025903 Bacteria 1233
125 Ga0207645_10402500 3300025907 Bacteria 921
126 Ga0207705_10067321 3300025909 Bacteria 2592
127 Ga0207654_10046246 3300025911 Bacteria 2481
128 Ga0207654_10215865 3300025911 Bacteria 1270
129 Ga0207707_10191064 3300025912 Bacteria 1786
130 Ga0207695_10017780 3300025913 Bacteria 8249
131 Ga0207695_10299379 3300025913 Bacteria 1500
132 Ga0207695_10310466 3300025913 Bacteria 1467
133 Ga0207695_10342542 3300025913 Bacteria 1382
134 Ga0207695_10443734 3300025913 Bacteria 1181
135 Ga0207695_10512024 3300025913 Bacteria 1082
136 Ga0207695_10512993 3300025913 Bacteria 1081
137 Ga0207695_10840125 3300025913 Bacteria 798
138 Ga0207695_10979182 3300025913 Bacteria 725
139 Ga0207671_10180321 3300025914 Bacteria 1643
140 Ga0207671_10775268 3300025914 Bacteria 761
141 Ga0207671_10854690 3300025914 Bacteria 720
142 Ga0207662_11183613 3300025918 Bacteria 543
143 Ga0207657_10346636 3300025919 Bacteria 1172
144 Ga0207649_10000026 3300025920 Bacteria 177395
145 Ga0207652_10939330 3300025921 Bacteria 762
146 Ga0207652_11277428 3300025921 Bacteria 636
147 Ga0207650_10315676 3300025925 Bacteria 1279
148 Ga0207659_10408966 3300025926 Bacteria 1136
149 Ga0207700_10066687 3300025928 Bacteria 2752
150 Ga0207664_10715566 3300025929 Bacteria 900
151 Ga0207644_10811211 3300025931 Bacteria 783
152 Ga0207686_10434417 3300025934 Bacteria 1007
153 Ga0207686_10839866 3300025934 Bacteria 738
154 Ga0207709_10186140 3300025935 Bacteria 1471
155 Ga0207704_10013802 3300025938 Bacteria 4058
156 Ga0207704_10199028 3300025938 Bacteria 1464
157 Ga0207665_10604638 3300025939 Bacteria 856
158 Ga0207711_10062650 3300025941 Bacteria 3208
159 Ga0207711_10427967 3300025941 Bacteria 1231
160 Ga0207689_10003177 3300025942 Bacteria 15066
161 Ga0207689_10190745 3300025942 Bacteria 1691
162 Ga0207689_10285516 3300025942 Bacteria 1367
163 Ga0207689_10791405 3300025942 Bacteria 800
164 Ga0207661_10370500 3300025944 Bacteria 1295
165 Ga0207661_10507820 3300025944 Bacteria 1102
166 Ga0207667_10077854 3300025949 Bacteria 3437
167 Ga0207667_10662468 3300025949 Bacteria 1048
168 Ga0207712_11531567 3300025961 Bacteria 597
169 Ga0207703_10050393 3300026035 Bacteria 3370
170 Ga0207703_10995148 3300026035 Bacteria 804
171 Ga0207639_10020512 3300026041 Bacteria 4730
172 Ga0207639_10293699 3300026041 Bacteria 1434
173 Ga0207639_10448844 3300026041 Bacteria 1170
174 Ga0207702_10335334 3300026078 Bacteria 1444
175 Ga0207648_10012856 3300026089 Bacteria 7817
176 Ga0207674_10212101 3300026116 Bacteria 1885
177 Ga0207674_10258480 3300026116 Bacteria 1689
178 Ga0207674_10769696 3300026116 Bacteria 929
179 Ga0207683_10012265 3300026121 Bacteria 7315
180 Ga0207683_10043437 3300026121 Bacteria 3928
181 Ga0207683_10388925 3300026121 Bacteria 1282
182 Ga0207698_10135508 3300026142 Bacteria 2112
183 Ga0268266_10000847 3300028379 Bacteria 39858
184 Ga0268266_10005124 3300028379 Bacteria 12352
185 Ga0268266_10074199 3300028379 Bacteria 2954
186 Ga0268266_10078860 3300028379 Bacteria 2866
187 Ga0268265_12103456 3300028380 Bacteria 571
188 Ga0268264_10775567 3300028381 Bacteria 956
189 Ga0265338_10004163 3300028800 Bacteria 19762
190 Ga0265338_10285441 3300028800 Bacteria 1204
191 Ga0265330_10003149 3300031235 Bacteria 8730
192 Ga0265332_10017562 3300031238 Bacteria 3156
193 Ga0265325_10001683 3300031241 Bacteria 15359
194 Ga0265340_10090079 3300031247 Bacteria 1435
195 Ga0265339_10006313 3300031249 Bacteria 7791
196 Ga0265339_10042424 3300031249 Bacteria 2519
197 Ga0265331_10000008 3300031250 Bacteria 324311
198 Ga0265331_10035880 3300031250 Bacteria 2437
199 Ga0265331_10131481 3300031250 Bacteria 1141
200 Ga0265327_10000036 3300031251 Bacteria 312827
201 Ga0265316_10019292 3300031344 Bacteria 5837
202 Ga0265316_10074673 3300031344 Bacteria 2609
203 Ga0307513_10214087 3300031456 Bacteria 1755
204 Ga0265313_10009088 3300031595 Bacteria 6501
205 Ga0265313_10112848 3300031595 Bacteria 1193
206 Ga0265314_10012288 3300031711 Bacteria 6997
207 Ga0265342_10013775 3300031712 Bacteria 5400
208 Ga0265342_10026742 3300031712 Bacteria 3613
209 Ga0265342_10060988 3300031712 Bacteria 2223
210 Ga0307516_10070469 3300031730 Bacteria 3359
211 Ga0373926_0129244 3300035083 Bacteria 956
212 Ga0373923_0373472 3300035111 Unclassified 683
213 Ga0373941_0067547 3300035115 Unclassified 1179
214 Ga0373945_0081986 3300035116 Bacteria 1237
215 Ga0373943_0003007 3300035170 Bacteria 7654
216 Ga0373946_0023585 3300035171 Bacteria 2406
217 Ga0373935_0011561 3300035692 Bacteria 5300
218 Ga0373927_0396158 3300035695 Bacteria 911
219 Ga0373947_0164233 3300035725 Bacteria 1437
220 Ga0373925_0001182 3300037068 Bacteria 23075
221 Ga0373925_0067791 3300037068 Bacteria 2692
222 Ga0395900_0363077 3300037418 Bacteria 1419
223 Ga0395898_0015029 3300037466 Bacteria 7946
224 Ga0395901_0349763 3300038443 Bacteria 1525
225 Ga0436363_0134827 3300039450 Bacteria 506
226 Ga0466963_0426828 3300044694 Bacteria 935
227 Ga0466957_0814944 3300044842 Bacteria 664
228 Ga0466960_0812365 3300044901 Bacteria 567
229 Ga0466967_1437056 3300045976 Bacteria 687
230 Ga0495585_0390793 3300046492 Bacteria 671
231 Ga0495628_0580095 3300046516 Bacteria 803
232 Ga0495648_0316112 3300046524 Bacteria 726
233 Ga0495587_0368170 3300046536 Unclassified 800
234 Ga0495611_0131968 3300046648 Bacteria 1165
235 Ga0495625_0383416 3300046660 Bacteria 881
236 Ga0495625_0506820 3300046660 Bacteria 737
237 Ga0495600_0595321 3300046809 Unclassified 672
238 Ga0495686_0254891 3300047472 Bacteria 985
239 Ga0495686_0485341 3300047472 Bacteria 652
240 Ga0495602_0041073 3300048088 Bacteria 4230
241 Ga0496101_0250203 3300048904 Bacteria 1381
242 Ga0496121_0071754 3300048924 Bacteria 2783
243 Ga0496126_0000463 3300048929 Bacteria 80860
244 Ga0501031_0007877 3300049568 Bacteria 6933
245 Ga0501031_0111873 3300049568 Bacteria 1783
246 Ga0501032_0019863 3300049569 Bacteria 4690
247 Ga0501032_0044836 3300049569 Bacteria 2992
248 Ga0501032_0163522 3300049569 Bacteria 1461
249 Ga0501032_0293860 3300049569 Bacteria 1051
250 Ga0501032_0711254 3300049569 Bacteria 636
251 Ga0501033_0027756 3300049570 Bacteria 4255
252 Ga0501033_0035160 3300049570 Bacteria 3757
253 Ga0501033_0044818 3300049570 Bacteria 3292
254 Ga0501033_0144096 3300049570 Bacteria 1722
255 Ga0501033_0156420 3300049570 Bacteria 1642
256 Ga0501033_0541501 3300049570 Bacteria 802
257 Ga0501034_0006981 3300049571 Bacteria 12057
258 Ga0501034_0022222 3300049571 Bacteria 6464
259 Ga0501034_0157235 3300049571 Bacteria 2246
260 Ga0501034_0166706 3300049571 Bacteria 2171
261 Ga0501034_0635917 3300049571 Bacteria 970
262 Ga0501034_0661179 3300049571 Bacteria 946
263 Ga0501034_0680964 3300049571 Unclassified 928
264 Ga0501037_0008477 3300049573 Bacteria 7537
265 Ga0501037_0075833 3300049573 Bacteria 2442
266 Ga0501038_0007322 3300049574 Bacteria 10181
267 Ga0501038_0215371 3300049574 Bacteria 1535
268 Ga0501038_0570231 3300049574 Bacteria 859
269 Ga0501039_0001379 3300049575 Bacteria 17823
270 Ga0501043_0018860 3300049579 Bacteria 5414
271 Ga0501043_0075617 3300049579 Bacteria 2645
272 Ga0501043_0154284 3300049579 Bacteria 1796
273 Ga0501043_0190958 3300049579 Bacteria 1593
274 Ga0501043_0302009 3300049579 Bacteria 1223
275 Ga0501043_0596531 3300049579 Bacteria 816
276 Ga0501046_0020811 3300049580 Bacteria 5418
277 Ga0501046_0255697 3300049580 Bacteria 1288
278 Ga0501046_0525665 3300049580 Bacteria 845
279 Ga0501046_1094643 3300049580 Bacteria 550
280 Ga0501047_0015429 3300049581 Bacteria 7278
281 Ga0501047_0015784 3300049581 Bacteria 7199
282 Ga0501047_0027448 3300049581 Bacteria 5485
283 Ga0501047_0139561 3300049581 Bacteria 2302
284 Ga0501047_1305409 3300049581 Bacteria 540
285 Ga0501048_0025496 3300049582 Bacteria 4308
286 Ga0501067_0001970 3300049583 Bacteria 11308
287 Ga0501068_0014415 3300049584 Bacteria 4519
288 Ga0501068_0328283 3300049584 Bacteria 981
289 Ga0501069_0003406 3300049585 Bacteria 8164
290 Ga0501070_0011200 3300049586 Bacteria 7569
291 Ga0501070_0047024 3300049586 Bacteria 3588
292 Ga0501070_0372033 3300049586 Bacteria 1158
293 Ga0501070_0732681 3300049586 Bacteria 780
294 Ga0501071_0648752 3300049587 Bacteria 812
295 Ga0501073_0012247 3300049589 Bacteria 6259
296 Ga0501073_0124159 3300049589 Bacteria 1789
297 Ga0501073_0200527 3300049589 Bacteria 1380
298 Ga0501073_0740850 3300049589 Bacteria 678
299 Ga0501076_0223735 3300049592 Bacteria 1538
300 Ga0501079_0004716 3300049741 Bacteria 10093
301 Ga0501080_0040900 3300049742 Bacteria 4322
302 Ga0501080_0074514 3300049742 Bacteria 3157
303 Ga0501080_0082630 3300049742 Bacteria 2983
304 Ga0501080_0138827 3300049742 Bacteria 2248
305 Ga0501083_0015213 3300049744 Bacteria 5386
306 Ga0501035_0003644 3300049822 Bacteria 14691
307 Ga0501035_0008954 3300049822 Bacteria 9314
308 Ga0501035_0010036 3300049822 Bacteria 8787
309 Ga0501035_0036634 3300049822 Bacteria 4445
310 Ga0501035_0133681 3300049822 Bacteria 2161
311 Ga0501035_0180766 3300049822 Bacteria 1817
312 Ga0501035_1086961 3300049822 Bacteria 625
313 Ga0501044_0006795 3300049823 Bacteria 12608
314 Ga0501044_0007302 3300049823 Bacteria 12142
315 Ga0501044_0008500 3300049823 Bacteria 11250
316 Ga0501044_0028768 3300049823 Bacteria 5863
317 Ga0501044_0051986 3300049823 Bacteria 4224
318 Ga0501044_0222798 3300049823 Bacteria 1836
319 Ga0501044_0519005 3300049823 Bacteria 1091
320 Ga0501044_1164219 3300049823 Bacteria 639
321 Ga0501045_0109139 3300049824 Bacteria 2051
322 Ga0500643_000027 3300053087 Bacteria 251062
323 Ga0500643_020314 3300053087 Bacteria 2174
324 Ga0500592_007035 3300053116 Bacteria 1789
325 Ga0500595_002521 3300053119 Bacteria 9035
326 Ga0500595_029268 3300053119 Bacteria 1870
327 Ga0500595_037337 3300053119 Bacteria 1585
328 Ga0500642_0406288 3300053130 Bacteria 593
329 Ga0500568_0017760 3300053139 Bacteria 3132
330 Ga0500573_0387569 3300053140 Bacteria 666
331 Ga0500577_0098121 3300053142 Bacteria 1194
332 Ga0500611_021458 3300053727 Bacteria 1233
333 Ga0501084_0003057 3300054114 Bacteria 13556
334 Ga0501084_0023056 3300054114 Bacteria 5196
335 Ga0501084_0280206 3300054114 Bacteria 1408
336 Ga0501082_0009507 3300060353 Bacteria 8367
337 Ga0530510_1226568 3300061734 Bacteria 575
338 Ga0068852_100401140
339 rootH2_10001888
340 rootH2_10029615
341 Ga0070658_10017310
342 Ga0070658_11041738
343 Ga0070683_101809973
344 Ga0070670_100154306
345 Ga0068869_100109017
346 Ga0068868_100103692
347 Ga0070660_100586160
348 Ga0070661_100000254
349 Ga0070661_101055119
350 Ga0070668_100936613
351 Ga0070714_101414449
352 Ga0070713_100832030
353 Ga0070713_101071100
354 Ga0070713_101373299
355 Ga0070710_10900497
356 Ga0070710_11252823
357 Ga0070711_100779611
358 Ga0070700_100687498
359 Ga0070678_100007429
360 Ga0070662_100542480
361 Ga0070681_10141132
362 Ga0070681_10843191
363 Ga0068867_100016001
364 Ga0068867_100134146
365 Ga0070685_10124573
366 Ga0070679_100119650
367 Ga0070679_100184525
368 Ga0070679_100686229
369 Ga0070684_100169556
370 Ga0070684_101126001
371 Ga0070684_101769050
372 Ga0068853_100037237
373 Ga0068853_100142065
374 Ga0070672_100463987
375 Ga0070672_101778091
376 Ga0070665_100001302
377 Ga0070665_100125846
378 Ga0070665_100205755
379 Ga0070665_100740796
380 Ga0068855_100065280
381 Ga0068855_100268381
382 Ga0068857_100174122
383 Ga0068857_100179817
384 Ga0068856_100118813
385 Ga0068856_100181514
386 Ga0068852_101425219
387 Ga0068866_10116445
388 Ga0068866_10284587
389 Ga0068870_10080190
390 Ga0068863_102032652
391 Ga0068862_100392497
392 Ga0068862_100429343
393 Ga0068871_100042130
394 Ga0105240_10019617
395 Ga0105240_10049843
396 Ga0105240_10295631
397 Ga0105240_10296666
398 Ga0105240_10405960
399 Ga0105240_10449694
400 Ga0105240_10791179
401 Ga0105240_11419874
402 Ga0105243_10004582
403 Ga0105241_10179588
404 Ga0105241_10309542
405 Ga0105242_10051210
406 Ga0105242_10382872
407 Ga0105242_11170672
408 Ga0105248_10141690
409 Ga0105248_10208380
410 Ga0105237_10229518
411 Ga0105237_10292733
412 Ga0105237_10367097
413 Ga0105237_10840849
414 Ga0105238_10104427
415 Ga0105238_10247833
416 Ga0105238_10548193
417 Ga0105238_11829918
418 Ga0105238_11892276
419 Ga0105238_12411707
420 Ga0105249_10064235
421 Ga0105249_10315866
422 Ga0105239_10016304
423 Ga0105239_10149177
424 Ga0105239_11087442
425 Ga0105239_11111588
426 Ga0105239_11276586
427 Ga0105239_11569605
428 Ga0105239_13405419
429 Ga0105246_11129919
430 Ga0105246_11455412
431 Ga0157373_10272751
432 Ga0157370_10025977
433 Ga0157370_10030611
434 Ga0157370_11004401
435 Ga0157370_11204778
436 Ga0157369_10308172
437 Ga0157369_10628342
438 Ga0157374_10182136
439 Ga0157378_10316955
440 Ga0157378_10406893
441 Ga0163162_10243736
442 Ga0163162_10270773
443 Ga0163162_11831129
444 Ga0157372_11425884
445 Ga0157372_12148173
446 Ga0157375_10118439
447 Ga0163163_10000012
448 Ga0163163_10169880
449 Ga0163163_10327960
450 Ga0163163_12943690
451 Ga0157379_10003912
452 Ga0157379_10498286
453 Ga0157379_10696466
454 Ga0157376_10259642
455 Ga0157376_11185013
456 Ga0163161_10077000
457 Ga0209233_1000006
458 Ga0209233_1004865
459 Ga0209455_1011654
460 Ga0207688_10025364
461 Ga0207680_10246382
462 Ga0207645_10402500
463 Ga0207705_10067321
464 Ga0207654_10046246
465 Ga0207654_10215865
466 Ga0207707_10191064
467 Ga0207695_10017780
468 Ga0207695_10299379
469 Ga0207695_10310466
470 Ga0207695_10342542
471 Ga0207695_10443734
472 Ga0207695_10512024
473 Ga0207695_10512993
474 Ga0207695_10840125
475 Ga0207695_10979182
476 Ga0207671_10180321
477 Ga0207671_10775268
478 Ga0207671_10854690
479 Ga0207662_11183613
480 Ga0207657_10346636
481 Ga0207649_10000026
482 Ga0207652_10939330
483 Ga0207652_11277428
484 Ga0207650_10315676
485 Ga0207659_10408966
486 Ga0207700_10066687
487 Ga0207664_10715566
488 Ga0207644_10811211
489 Ga0207686_10434417
490 Ga0207686_10839866
491 Ga0207709_10186140
492 Ga0207704_10013802
493 Ga0207704_10199028
494 Ga0207665_10604638
495 Ga0207711_10062650
496 Ga0207711_10427967
497 Ga0207689_10003177
498 Ga0207689_10190745
499 Ga0207689_10285516
500 Ga0207689_10791405
501 Ga0207661_10370500
502 Ga0207661_10507820
503 Ga0207667_10077854
504 Ga0207667_10662468
505 Ga0207712_11531567
506 Ga0207703_10050393
507 Ga0207703_10995148
508 Ga0207639_10020512
509 Ga0207639_10293699
510 Ga0207639_10448844
511 Ga0207702_10335334
512 Ga0207648_10012856
513 Ga0207674_10212101
514 Ga0207674_10258480
515 Ga0207674_10769696
516 Ga0207683_10012265
517 Ga0207683_10043437
518 Ga0207683_10388925
519 Ga0207698_10135508
520 Ga0268266_10000847
521 Ga0268266_10005124
522 Ga0268266_10074199
523 Ga0268266_10078860
524 Ga0268265_12103456
525 Ga0268264_10775567
526 Ga0265338_10004163
527 Ga0265338_10285441
528 Ga0265330_10003149
529 Ga0265332_10017562
530 Ga0265325_10001683
531 Ga0265340_10090079
532 Ga0265339_10006313
533 Ga0265339_10042424
534 Ga0265331_10000008
535 Ga0265331_10035880
536 Ga0265331_10131481
537 Ga0265327_10000036
538 Ga0265316_10019292
539 Ga0265316_10074673
540 Ga0307513_10214087
541 Ga0265313_10009088
542 Ga0265313_10112848
543 Ga0265314_10012288
544 Ga0265342_10013775
545 Ga0265342_10026742
546 Ga0265342_10060988
547 Ga0307516_10070469
548 Ga0373926_0129244
549 Ga0373923_0373472
550 Ga0373941_0067547
551 Ga0373945_0081986
552 Ga0373943_0003007
553 Ga0373946_0023585
554 Ga0373935_0011561
555 Ga0373927_0396158
556 Ga0373947_0164233
557 Ga0373925_0001182
558 Ga0373925_0067791
559 Ga0395900_0363077
560 Ga0395898_0015029
561 Ga0395901_0349763
562 Ga0436363_0134827
563 Ga0466963_0426828
564 Ga0466957_0814944
565 Ga0466960_0812365
566 Ga0466967_1437056
567 Ga0495585_0390793
568 Ga0495628_0580095
569 Ga0495648_0316112
570 Ga0495587_0368170
571 Ga0495611_0131968
572 Ga0495625_0383416
573 Ga0495625_0506820
574 Ga0495600_0595321
575 Ga0495686_0254891
576 Ga0495686_0485341
577 Ga0495602_0041073
578 Ga0496101_0250203
579 Ga0496121_0071754
580 Ga0496126_0000463
581 Ga0501031_0007877
582 Ga0501031_0111873
583 Ga0501032_0019863
584 Ga0501032_0044836
585 Ga0501032_0163522
586 Ga0501032_0293860
587 Ga0501032_0711254
588 Ga0501033_0027756
589 Ga0501033_0035160
590 Ga0501033_0044818
591 Ga0501033_0144096
592 Ga0501033_0156420
593 Ga0501033_0541501
594 Ga0501034_0006981
595 Ga0501034_0022222
596 Ga0501034_0157235
597 Ga0501034_0166706
598 Ga0501034_0635917
599 Ga0501034_0661179
600 Ga0501034_0680964
601 Ga0501037_0008477
602 Ga0501037_0075833
603 Ga0501038_0007322
604 Ga0501038_0215371
605 Ga0501038_0570231
606 Ga0501039_0001379
607 Ga0501043_0018860
608 Ga0501043_0075617
609 Ga0501043_0154284
610 Ga0501043_0190958
611 Ga0501043_0302009
612 Ga0501043_0596531
613 Ga0501046_0020811
614 Ga0501046_0255697
615 Ga0501046_0525665
616 Ga0501046_1094643
617 Ga0501047_0015429
618 Ga0501047_0015784
619 Ga0501047_0027448
620 Ga0501047_0139561
621 Ga0501047_1305409
622 Ga0501048_0025496
623 Ga0501067_0001970
624 Ga0501068_0014415
625 Ga0501068_0328283
626 Ga0501069_0003406
627 Ga0501070_0011200
628 Ga0501070_0047024
629 Ga0501070_0372033
630 Ga0501070_0732681
631 Ga0501071_0648752
632 Ga0501073_0012247
633 Ga0501073_0124159
634 Ga0501073_0200527
635 Ga0501073_0740850
636 Ga0501076_0223735
637 Ga0501079_0004716
638 Ga0501080_0040900
639 Ga0501080_0074514
640 Ga0501080_0082630
641 Ga0501080_0138827
642 Ga0501083_0015213
643 Ga0501035_0003644
644 Ga0501035_0008954
645 Ga0501035_0010036
646 Ga0501035_0036634
647 Ga0501035_0133681
648 Ga0501035_0180766
649 Ga0501035_1086961
650 Ga0501044_0006795
651 Ga0501044_0007302
652 Ga0501044_0008500
653 Ga0501044_0028768
654 Ga0501044_0051986
655 Ga0501044_0222798
656 Ga0501044_0519005
657 Ga0501044_1164219
658 Ga0501045_0109139
659 Ga0500643_000027
660 Ga0500643_020314
661 Ga0500592_007035
662 Ga0500595_002521
663 Ga0500595_029268
664 Ga0500595_037337
665 Ga0500642_0406288
666 Ga0500568_0017760
667 Ga0500573_0387569
668 Ga0500577_0098121
669 Ga0500611_021458
670 Ga0501084_0003057
671 Ga0501084_0023056
672 Ga0501084_0280206
673 Ga0501082_0009507
674 Ga0530510_1226568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01894

UPF0047

Uncharacterised protein family UPF0047

26

142

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vmf-assembly1.cif.gz_C crystal structure of a ybjq-like fold protein of unknown function (bh3498) from bacillus halodurans at 1.46 a resolution 0.9186 5 139
1vmh-assembly1.cif.gz_A crystal structure of an uncharacterized conserved protein yjbq/upf0047 family, ortholog yugu b.subtilis (ca_c0907) from clostridium acetobutylicum at 1.31 a resolution 0.913 6 137
2p6c-assembly1.cif.gz_A crystal structure of hypothetical protein aq_2013 from aquifex aeolicus vf5. 0.9097 1 139
1xbf-assembly1.cif.gz_C x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum 0.9094 4 137
1ve0-assembly1.cif.gz_A crystal structure of uncharacterized protein st2072 from sulfolobus tokodaii 0.907 1 139
ID Description Score Start End Superfamily
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8969 1 139 2.60.120.460
2p6cB00 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8908 1 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8851 1 138 2.60.120.460
af_P0AF48_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.881 2 139 2.60.120.460
af_O14155_1_138_2.60.120.460 Mainly Beta;Sandwich;Jelly Rolls;YjbQ-like 0.8792 1 138 2.60.120.460
ID Description Score Start End GO Terms
AF-A0A2U0T9U8-F1-model_v4 deleted 0.9588 1 139
AF-A0A0D6MWM4-F1-model_v4 deleted 0.9573 1 139
AF-A0A6P2JMJ1-F1-model_v4 YjbQ family protein 0.9571 1 139
AF-A0A1X7PM13-F1-model_v4 Secondary thiamine-phosphate synthase enzyme 0.9569 5 137
AF-A0A228GMY0-F1-model_v4 deleted 0.9568 1 139

Map