F413079

General Info

Members Datasets Scaffolds Average Seq Length
337 230 668 342

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10051114|Ga0157374_100511142
Length 395
Sequence LDEPAFQRHAERIAVKVLQARVRRVFKEWRNPMTTAKSSHEAAMQKGYRSKGVRALTTFTLGGIIAMTQLAAAQTPNAATDDRIDPQVRAFLAELNKASSPFWELPQPKPQEILTALQNQTPVDMSGVTTVEKTITQDRRTVKLYIMTPQHPAPKPGVLLFIHGGVWIVGNFQNHQRLLRDLVVGSGQVGVFVEYTPLPAAVFPTQLEESYAALKWVAAHAQEFGADGTRIAIAGNSVGGNMTAALTLMAKDRRGPKIAYQVLFIPATDASVDTDSYHEFGTGRFLARDFMKYGWDLYAPDHKTRNNPYVSPLRATTEELQGLPPALVITAENDPLREEGEAYARKLKDAGVPVTATRYNGMIHDFVLLNAIHEVPGVQTALREATDGIREALKP

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
25 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
26 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
34 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
35 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
36 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
37 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
38 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
39 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
40 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
41 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
43 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
44 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
47 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
64 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
65 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
66 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
67 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
68 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
69 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
72 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
73 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
74 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
75 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
78 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
79 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
80 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
81 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
82 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
83 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
84 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
85 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
86 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
87 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
88 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
89 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
92 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
93 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
94 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
100 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
103 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
104 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
116 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
117 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
120 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
134 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
137 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
138 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
144 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
150 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
151 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
155 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
158 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
161 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
162 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
163 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
166 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
167 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
168 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
169 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
170 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
171 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
172 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
173 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
174 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
175 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
176 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
177 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
178 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
179 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
180 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
181 2739367700 Dyella sp. YR388 Isolate Unclassified
182 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
183 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
184 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
185 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
186 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
187 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
188 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
189 2922368715
190 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
191 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
192 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
193 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
194 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
195 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
196 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
197 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
198 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
199 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
200 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
201 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
202 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
203 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
204 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
205 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
206 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
207 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
208 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
209 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
210 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
211 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
212 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
213 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
214 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
215 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
216 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
217 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
218 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
219 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
220 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
221 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
222 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
223 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
224 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
225 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
226 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
227 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
228 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
229 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
230 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.93
Metatranscriptomes 0
Isolates 16.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 13.65
Rhizoplane 7.12
Rhizosphere 64.09
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10051114 3300013296 Bacteria 3845
2 MRS1b_contig_948318 2162886011 Bacteria 2099
3 MBSR1b_contig_868394 2162886012 Bacteria 1871
4 rootL2_10204211 3300003322 Bacteria 2106
5 Ga0055542_1000010 3300003762 Bacteria 414813
6 Ga0065715_10089138 3300005293 Bacteria 13651
7 Ga0065715_10105464 3300005293 Bacteria 2891
8 Ga0070661_100310296 3300005344 Bacteria 1230
9 Ga0070671_100011929 3300005355 Bacteria 6990
10 Ga0070673_100231436 3300005364 Bacteria 1603
11 Ga0070667_100038986 3300005367 Bacteria 3983
12 Ga0070667_100074591 3300005367 Bacteria 2894
13 Ga0070709_10048541 3300005434 Bacteria 2649
14 Ga0070708_100054788 3300005445 Bacteria 3544
15 Ga0070663_100028250 3300005455 Bacteria 3817
16 Ga0070706_100024613 3300005467 Bacteria 5542
17 Ga0070706_100031383 3300005467 Bacteria 4900
18 Ga0070706_100053488 3300005467 Bacteria 3726
19 Ga0070707_100000407 3300005468 Bacteria 42543
20 Ga0070707_100025054 3300005468 Bacteria 5658
21 Ga0070698_100084748 3300005471 Bacteria 3157
22 Ga0068855_100170773 3300005563 Bacteria 2463
23 Ga0068859_100337387 3300005617 Bacteria 1601
24 Ga0081540_1000785 3300005983 Bacteria 29131
25 Ga0070716_100001567 3300006173 Bacteria 10266
26 Ga0070712_100217159 3300006175 Bacteria 1511
27 Ga0068871_100166772 3300006358 Bacteria 1886
28 Ga0097620_100337395 3300006931 Bacteria 1601
29 Ga0099823_1042042 3300006944 Bacteria 3219
30 Ga0105251_10037859 3300009011 Bacteria 2365
31 Ga0105247_10005629 3300009101 Bacteria 7862
32 Ga0105248_10008540 3300009177 Bacteria 11244
33 Ga0105248_10017835 3300009177 Bacteria 7835
34 Ga0105238_10019803 3300009551 Bacteria 6849
35 Ga0105238_10021253 3300009551 Bacteria 6613
36 Ga0157370_10289384 3300013104 Bacteria 1513
37 Ga0157369_10125224 3300013105 Bacteria 2725
38 Ga0157374_10178997 3300013296 Bacteria 2070
39 Ga0157378_10071258 3300013297 Bacteria 3121
40 Ga0157378_10389884 3300013297 Bacteria 1370
41 Ga0163162_10000297 3300013306 Bacteria 45730
42 Ga0163162_10002427 3300013306 Bacteria 17557
43 Ga0157372_10012427 3300013307 Bacteria 9075
44 Ga0157375_10005402 3300013308 Bacteria 11107
45 Ga0157375_10005788 3300013308 Bacteria 10753
46 Ga0163163_10173763 3300014325 Bacteria 2201
47 Ga0157379_10244421 3300014968 Bacteria 1628
48 Ga0157376_10050785 3300014969 Bacteria 3442
49 Ga0157376_10341809 3300014969 Bacteria 1429
50 Ga0182006_1000027 3300015261 Bacteria 252946
51 Ga0182006_1000181 3300015261 Bacteria 66126
52 Ga0182007_10006080 3300015262 Bacteria 5219
53 Ga0182007_10033545 3300015262 Bacteria 1739
54 Ga0163161_10091764 3300017792 Bacteria 2248
55 Ga0163161_10197599 3300017792 Bacteria 1548
56 Ga0209672_101852 3300025228 Bacteria 6306
57 Ga0207427_101019 3300025231 Bacteria 11712
58 Ga0209437_100180 3300025233 Bacteria 133661
59 Ga0209258_100718 3300025242 Bacteria 22152
60 Ga0209148_1000005 3300025254 Bacteria 1806504
61 Ga0209148_1000995 3300025254 Bacteria 18242
62 Ga0209233_1018285 3300025261 Bacteria 1889
63 Ga0209455_1001189 3300025272 Bacteria 12439
64 Ga0209455_1003388 3300025272 Bacteria 5664
65 Ga0207692_10081074 3300025898 Bacteria 1736
66 Ga0207710_10006737 3300025900 Bacteria 4897
67 Ga0207684_10042161 3300025910 Bacteria 3868
68 Ga0207684_10048598 3300025910 Bacteria 3598
69 Ga0207684_10134868 3300025910 Bacteria 2119
70 Ga0207693_10028785 3300025915 Bacteria 4391
71 Ga0207693_10084271 3300025915 Bacteria 2490
72 Ga0207663_10300363 3300025916 Bacteria 1199
73 Ga0207646_10000736 3300025922 Bacteria 42554
74 Ga0207646_10032795 3300025922 Bacteria 4698
75 Ga0207700_10169739 3300025928 Bacteria 1819
76 Ga0207665_10010065 3300025939 Bacteria 6211
77 Ga0207711_10032088 3300025941 Bacteria 4440
78 Ga0207711_10033006 3300025941 Bacteria 4378
79 Ga0207711_10243226 3300025941 Bacteria 1650
80 Ga0207651_10245800 3300025960 Bacteria 1461
81 Ga0207658_10039383 3300025986 Bacteria 3410
82 Ga0207678_10041646 3300026067 Bacteria 3982
83 Ga0207678_10090524 3300026067 Bacteria 2615
84 Ga0207676_10165652 3300026095 Bacteria 1920
85 Ga0265338_10000258 3300028800 Bacteria 96517
86 Ga0265338_10141366 3300028800 Unclassified 1885
87 Ga0265339_10014293 3300031249 Bacteria 4787
88 Ga0373936_0007904 3300035113 Bacteria 3995
89 Ga0373945_0005388 3300035116 Bacteria 4095
90 Ga0373935_0043866 3300035692 Bacteria 2816
91 Ga0373927_0031223 3300035695 Bacteria 3473
92 Ga0373927_0203364 3300035695 Bacteria 1300
93 Ga0373927_0204513 3300035695 Bacteria 1296
94 Ga0373933_0048205 3300035724 Bacteria 2536
95 Ga0373933_0063251 3300035724 Bacteria 2237
96 Ga0373933_0114762 3300035724 Bacteria 1683
97 Ga0373947_0032228 3300035725 Bacteria 3087
98 Ga0373947_0051629 3300035725 Bacteria 2474
99 Ga0373947_0214369 3300035725 Bacteria 1264
100 Ga0373937_0084296 3300036401 Bacteria 2940
101 Ga0373937_0131886 3300036401 Bacteria 2334
102 Ga0373925_0027153 3300037068 Bacteria 4193
103 Ga0373925_0029165 3300037068 Bacteria 4047
104 Ga0373925_0141352 3300037068 Bacteria 1884
105 Ga0450908_000740 3300042184 Bacteria 6272
106 Ga0466982_0000002 3300044672 Bacteria 454900
107 Ga0466971_0002548 3300044719 Bacteria 7709
108 Ga0466968_0089977 3300044735 Bacteria 1358
109 Ga0466970_0026300 3300044765 Bacteria 3050
110 Ga0495617_000220 3300046452 Bacteria 34639
111 Ga0495617_001361 3300046452 Bacteria 10838
112 Ga0495592_0026529 3300046454 Bacteria 4392
113 Ga0495603_0000321 3300046455 Bacteria 25860
114 Ga0495603_0077696 3300046455 Bacteria 1947
115 Ga0495629_0015963 3300046459 Bacteria 5396
116 Ga0495629_0018023 3300046459 Bacteria 5061
117 Ga0495629_0018433 3300046459 Bacteria 4997
118 Ga0495638_0000049 3300046460 Bacteria 206725
119 Ga0495638_0000062 3300046460 Bacteria 188223
120 Ga0495638_0004907 3300046460 Bacteria 10052
121 Ga0495638_0009440 3300046460 Bacteria 6846
122 Ga0495638_0036798 3300046460 Bacteria 3116
123 Ga0495641_0008163 3300046461 Bacteria 6428
124 Ga0495651_0133383 3300046462 Bacteria 1811
125 Ga0495580_0062456 3300046472 Bacteria 2613
126 Ga0495582_0043468 3300046473 Bacteria 2475
127 Ga0495605_0028053 3300046474 Bacteria 2909
128 Ga0495639_0004663 3300046475 Bacteria 5887
129 Ga0495662_0005641 3300046476 Bacteria 6260
130 Ga0495664_0098982 3300046477 Bacteria 1756
131 Ga0495585_0008356 3300046492 Bacteria 6278
132 Ga0495585_0024520 3300046492 Bacteria 3458
133 Ga0495585_0034323 3300046492 Bacteria 2867
134 Ga0495585_0110117 3300046492 Bacteria 1465
135 Ga0495594_0000044 3300046499 Bacteria 54809
136 Ga0495594_0007861 3300046499 Bacteria 5484
137 Ga0495596_0003873 3300046500 Bacteria 7427
138 Ga0495596_0068227 3300046500 Bacteria 1382
139 Ga0495607_0112166 3300046501 Bacteria 1444
140 Ga0495583_0017042 3300046506 Bacteria 3873
141 Ga0495606_0000181 3300046507 Bacteria 111247
142 Ga0495620_0000461 3300046515 Bacteria 26697
143 Ga0495630_0027565 3300046517 Bacteria 4216
144 Ga0495631_0042799 3300046518 Bacteria 2000
145 Ga0495631_0063084 3300046518 Bacteria 1605
146 Ga0495631_0105971 3300046518 Bacteria 1209
147 Ga0495632_0047205 3300046519 Bacteria 2137
148 Ga0495644_0000041 3300046523 Bacteria 60975
149 Ga0495644_0030410 3300046523 Bacteria 2039
150 Ga0495648_0001919 3300046524 Bacteria 19808
151 Ga0495648_0071191 3300046524 Bacteria 2017
152 Ga0495666_0062025 3300046526 Bacteria 1786
153 Ga0495642_0013842 3300046528 Bacteria 3124
154 Ga0495665_0002545 3300046531 Bacteria 9835
155 Ga0495640_0017487 3300046533 Bacteria 5343
156 Ga0495640_0070630 3300046533 Bacteria 2345
157 Ga0495609_0012356 3300046538 Bacteria 4050
158 Ga0495597_0039375 3300046542 Bacteria 2117
159 Ga0495645_0011203 3300046543 Bacteria 6306
160 Ga0495622_0008892 3300046557 Bacteria 4653
161 Ga0495622_0016288 3300046557 Bacteria 3460
162 Ga0495622_0017158 3300046557 Bacteria 3370
163 Ga0495622_0072667 3300046557 Bacteria 1587
164 Ga0495633_0002414 3300046558 Bacteria 13209
165 Ga0495633_0003836 3300046558 Bacteria 9827
166 Ga0495668_0007762 3300046616 Bacteria 6806
167 Ga0495634_0015884 3300046642 Bacteria 5393
168 Ga0495634_0030202 3300046642 Bacteria 3745
169 Ga0495625_0013870 3300046660 Bacteria 6454
170 Ga0495625_0041092 3300046660 Bacteria 3367
171 Ga0495625_0046770 3300046660 Bacteria 3121
172 Ga0495625_0056796 3300046660 Bacteria 2785
173 Ga0495635_0034371 3300046663 Bacteria 3516
174 Ga0495635_0184150 3300046663 Bacteria 1419
175 Ga0495588_0018201 3300046674 Bacteria 3421
176 Ga0495599_0002014 3300046678 Bacteria 11751
177 Ga0495623_0027979 3300046679 Bacteria 3629
178 Ga0495647_0017164 3300046681 Bacteria 2558
179 Ga0495658_0002382 3300046683 Bacteria 9488
180 Ga0495669_0015280 3300046684 Bacteria 3287
181 Ga0495613_0002308 3300046689 Bacteria 14452
182 Ga0495613_0002505 3300046689 Bacteria 13851
183 Ga0495613_0033746 3300046689 Bacteria 3801
184 Ga0495613_0065069 3300046689 Bacteria 2665
185 Ga0495613_0196917 3300046689 Bacteria 1422
186 Ga0495624_0016425 3300046690 Bacteria 4982
187 Ga0495670_0186417 3300046691 Bacteria 1096
188 Ga0495671_0019871 3300046692 Bacteria 3545
189 Ga0495671_0026937 3300046692 Bacteria 2974
190 Ga0495649_0007710 3300046694 Bacteria 6535
191 Ga0495649_0046370 3300046694 Bacteria 2366
192 Ga0495589_0002956 3300046794 Bacteria 9362
193 Ga0495589_0003628 3300046794 Bacteria 8335
194 Ga0495660_0000078 3300046810 Bacteria 104055
195 Ga0495581_0009274 3300047315 Bacteria 5695
196 Ga0495581_0042625 3300047315 Bacteria 2626
197 Ga0495581_0076094 3300047315 Bacteria 1942
198 Ga0495674_0015507 3300047319 Bacteria 7120
199 Ga0495674_0102316 3300047319 Bacteria 2436
200 Ga0495672_0000346 3300047320 Bacteria 59410
201 Ga0495672_0011406 3300047320 Bacteria 6276
202 Ga0495676_0057656 3300047321 Bacteria 3061
203 Ga0495683_0130103 3300047323 Bacteria 1188
204 Ga0495679_048154 3300047446 Bacteria 1290
205 Ga0495673_0000001 3300047469 Bacteria 1630730
206 Ga0495673_0000010 3300047469 Bacteria 709599
207 Ga0495684_0243643 3300047471 Bacteria 1310
208 Ga0495686_0000105 3300047472 Bacteria 176098
209 Ga0495686_0000440 3300047472 Bacteria 63165
210 Ga0495686_0000576 3300047472 Bacteria 52136
211 Ga0495686_0002216 3300047472 Bacteria 18870
212 Ga0495686_0034095 3300047472 Bacteria 3281
213 Ga0495686_0067399 3300047472 Bacteria 2209
214 Ga0495593_0009057 3300047673 Bacteria 5775
215 Ga0495614_0008732 3300048089 Bacteria 4502
216 Ga0495614_0019587 3300048089 Bacteria 2928
217 Ga0496101_0003285 3300048904 Bacteria 10054
218 Ga0496101_0246805 3300048904 Bacteria 1390
219 Ga0496102_0004927 3300048905 Bacteria 11312
220 Ga0496102_0020605 3300048905 Bacteria 5827
221 Ga0496104_0032165 3300048907 Bacteria 4881
222 Ga0496104_0101225 3300048907 Bacteria 2758
223 Ga0496105_0006788 3300048908 Bacteria 8801
224 Ga0496105_0043828 3300048908 Bacteria 3690
225 Ga0496105_0073222 3300048908 Bacteria 2831
226 Ga0496106_0151419 3300048909 Bacteria 1830
227 Ga0496106_0254970 3300048909 Bacteria 1403
228 Ga0496107_0013544 3300048910 Bacteria 5701
229 Ga0496107_0032567 3300048910 Bacteria 3726
230 Ga0496110_0104065 3300048913 Bacteria 2547
231 Ga0496110_0227726 3300048913 Bacteria 1695
232 Ga0496112_0035115 3300048915 Bacteria 4880
233 Ga0496113_0006713 3300048916 Bacteria 7329
234 Ga0496113_0204469 3300048916 Bacteria 1570
235 Ga0496114_0131026 3300048917 Bacteria 2165
236 Ga0496115_0000096 3300048918 Bacteria 82735
237 Ga0496115_0039098 3300048918 Bacteria 3767
238 Ga0496115_0128205 3300048918 Bacteria 2090
239 Ga0496115_0284010 3300048918 Bacteria 1358
240 Ga0496119_0065373 3300048922 Bacteria 2154
241 Ga0496120_0011303 3300048923 Bacteria 6147
242 Ga0496121_0002184 3300048924 Bacteria 30622
243 Ga0496121_0006812 3300048924 Bacteria 13995
244 Ga0496121_0022765 3300048924 Bacteria 6061
245 Ga0496121_0270277 3300048924 Bacteria 1169
246 Ga0496125_0140172 3300048928 Bacteria 1683
247 Ga0496126_0003232 3300048929 Bacteria 20840
248 Ga0496126_0045138 3300048929 Bacteria 4053
249 Ga0496126_0070077 3300048929 Bacteria 3125
250 Ga0496126_0117127 3300048929 Bacteria 2315
251 Ga0495678_015884 3300049459 Bacteria 3455
252 Ga0495682_0000540 3300049460 Bacteria 26138
253 Ga0495682_0000694 3300049460 Bacteria 22096
254 Ga0501034_0249671 3300049571 Bacteria 1719
255 Ga0501068_0033487 3300049584 Bacteria 3060
256 Ga0501080_0083651 3300049742 Bacteria 2965
257 Ga0501044_0033717 3300049823 Bacteria 5377
258 Ga0495601_0006095 3300053077 Bacteria 7035
259 Ga0495612_0004289 3300053078 Bacteria 5919
260 Ga0495619_0015190 3300053085 Bacteria 4867
261 Ga0500578_0063154 3300053086 Bacteria 2363
262 Ga0500651_0054028 3300053093 Bacteria 2519
263 Ga0500640_055519 3300053095 Bacteria 1725
264 Ga0500572_000465 3300053111 Bacteria 14081
265 Ga0500595_002366 3300053119 Bacteria 9421
266 Ga0500595_002699 3300053119 Bacteria 8602
267 Ga0500595_003460 3300053119 Bacteria 7356
268 Ga0500595_008469 3300053119 Unclassified 4197
269 Ga0500614_001232 3300053123 Bacteria 6229
270 Ga0500655_001603 3300053133 Bacteria 4273
271 Ga0500559_0001191 3300053136 Bacteria 15465
272 Ga0500559_0005167 3300053136 Bacteria 6027
273 Ga0500573_0173122 3300053140 Bacteria 1166
274 Ga0500616_0045792 3300053153 Bacteria 2329
275 Ga0500639_053330 3300053163 Bacteria 2104
276 Ga0500636_0000047 3300053177 Bacteria 62796
277 Ga0500596_000165 3300053735 Bacteria 10394
278 Ga0500601_000032 3300053737 Bacteria 31109
279 Ga0501082_0036172 3300060353 Bacteria 4254
280 2509154449 2508501128 Bacteria 8613869
281 2513893865 2513237141 Bacteria 8496279
282 2517894197 2517572143 Bacteria 9484767
283 2739733077 2739367700 Bacteria 4747630
284 2739733079 2739367700 Bacteria 4747630
285 2821448275 2821443989 Bacteria 7658172
286 2824664694 2824661429 Bacteria 9877870
287 2824757602 2824753945 Bacteria 9787441
288 2824764192 2824763712 Bacteria 9792355
289 2879109929 2879099564 Bacteria 10442239
290 2883356614 2883354860 Bacteria 5865246
291 2904713419 2904711408 Bacteria 9771557
292 2922372265
293 2929616531 2929615660 Bacteria 9193770
294 2929625275 2929624759 Bacteria 9339455
295 2932786793 2932784394 Bacteria 9704911
296 2932793368 2932784394 Bacteria 9704911
297 2932818033 2932809354 Bacteria 9135765
298 2932827828 2932818245 Bacteria 9955613
299 2932832617 2932828146 Bacteria 9745859
300 2933578186 2933577622 Bacteria 9116884
301 2935619318 2935616580 Bacteria 9032984
302 2935645295 2935638405 Bacteria 10015038
303 2935671393 2935665750 Bacteria 9571747
304 2935683757 2935675223 Bacteria 9928132
305 2935691944 2935684952 Bacteria 9590419
306 2935708032 2935703347 Bacteria 10242284
307 2935721783 2935713505 Bacteria 9608509
308 2935731219 2935722832 Bacteria 9608746
309 2935738919 2935732158 Bacteria 9706831
310 2935747896 2935741537 Bacteria 9707219
311 2935756480 2935750917 Bacteria 9590372
312 2935761538 2935760218 Bacteria 9817913
313 2935804981 2935801545 Bacteria 9301974
314 2935812145 2935810662 Bacteria 9401221
315 2935834862 2935827899 Bacteria 10038562
316 2935838927 2935837841 Bacteria 9454360
317 2935857683 2935855204 Bacteria 9035059
318 2935873314 2935864058 Bacteria 9784707
319 2935882905 2935873716 Bacteria 9632195
320 2935997449 2935992306 Bacteria 9802711
321 2936005230 2936002035 Bacteria 9362176
322 2936038739 2936037263 Bacteria 9446081
323 2940562394 2940556831 Bacteria 9590747
324 2941539616 2941538514 Bacteria 9402094
325 8005306224 8005301065 Bacteria 6614431
326 8005694079 8005688590 Bacteria 6610080
327 8006941681 8006933436 Bacteria 10410654
328 8006981395 8006973647 Bacteria 10679141
329 8017061036 8017057580 Bacteria 10023680
330 8019580507 8019576017 Bacteria 10049540
331 8019603111 8019597564 Bacteria 10041141
332 8019615423 8019608314 Bacteria 10042931
333 8055748177 8055742211 Bacteria 9226248
334 8056968894 8056967851 Bacteria 9038162
335 Ga0157374_10051114
336 MRS1b_contig_948318
337 MBSR1b_contig_868394
338 rootL2_10204211
339 Ga0055542_1000010
340 Ga0065715_10089138
341 Ga0065715_10105464
342 Ga0070661_100310296
343 Ga0070671_100011929
344 Ga0070673_100231436
345 Ga0070667_100038986
346 Ga0070667_100074591
347 Ga0070709_10048541
348 Ga0070708_100054788
349 Ga0070663_100028250
350 Ga0070706_100024613
351 Ga0070706_100031383
352 Ga0070706_100053488
353 Ga0070707_100000407
354 Ga0070707_100025054
355 Ga0070698_100084748
356 Ga0068855_100170773
357 Ga0068859_100337387
358 Ga0081540_1000785
359 Ga0070716_100001567
360 Ga0070712_100217159
361 Ga0068871_100166772
362 Ga0097620_100337395
363 Ga0099823_1042042
364 Ga0105251_10037859
365 Ga0105247_10005629
366 Ga0105248_10008540
367 Ga0105248_10017835
368 Ga0105238_10019803
369 Ga0105238_10021253
370 Ga0157370_10289384
371 Ga0157369_10125224
372 Ga0157374_10178997
373 Ga0157378_10071258
374 Ga0157378_10389884
375 Ga0163162_10000297
376 Ga0163162_10002427
377 Ga0157372_10012427
378 Ga0157375_10005402
379 Ga0157375_10005788
380 Ga0163163_10173763
381 Ga0157379_10244421
382 Ga0157376_10050785
383 Ga0157376_10341809
384 Ga0182006_1000027
385 Ga0182006_1000181
386 Ga0182007_10006080
387 Ga0182007_10033545
388 Ga0163161_10091764
389 Ga0163161_10197599
390 Ga0209672_101852
391 Ga0207427_101019
392 Ga0209437_100180
393 Ga0209258_100718
394 Ga0209148_1000005
395 Ga0209148_1000995
396 Ga0209233_1018285
397 Ga0209455_1001189
398 Ga0209455_1003388
399 Ga0207692_10081074
400 Ga0207710_10006737
401 Ga0207684_10042161
402 Ga0207684_10048598
403 Ga0207684_10134868
404 Ga0207693_10028785
405 Ga0207693_10084271
406 Ga0207663_10300363
407 Ga0207646_10000736
408 Ga0207646_10032795
409 Ga0207700_10169739
410 Ga0207665_10010065
411 Ga0207711_10032088
412 Ga0207711_10033006
413 Ga0207711_10243226
414 Ga0207651_10245800
415 Ga0207658_10039383
416 Ga0207678_10041646
417 Ga0207678_10090524
418 Ga0207676_10165652
419 Ga0265338_10000258
420 Ga0265338_10141366
421 Ga0265339_10014293
422 Ga0373936_0007904
423 Ga0373945_0005388
424 Ga0373935_0043866
425 Ga0373927_0031223
426 Ga0373927_0203364
427 Ga0373927_0204513
428 Ga0373933_0048205
429 Ga0373933_0063251
430 Ga0373933_0114762
431 Ga0373947_0032228
432 Ga0373947_0051629
433 Ga0373947_0214369
434 Ga0373937_0084296
435 Ga0373937_0131886
436 Ga0373925_0027153
437 Ga0373925_0029165
438 Ga0373925_0141352
439 Ga0450908_000740
440 Ga0466982_0000002
441 Ga0466971_0002548
442 Ga0466968_0089977
443 Ga0466970_0026300
444 Ga0495617_000220
445 Ga0495617_001361
446 Ga0495592_0026529
447 Ga0495603_0000321
448 Ga0495603_0077696
449 Ga0495629_0015963
450 Ga0495629_0018023
451 Ga0495629_0018433
452 Ga0495638_0000049
453 Ga0495638_0000062
454 Ga0495638_0004907
455 Ga0495638_0009440
456 Ga0495638_0036798
457 Ga0495641_0008163
458 Ga0495651_0133383
459 Ga0495580_0062456
460 Ga0495582_0043468
461 Ga0495605_0028053
462 Ga0495639_0004663
463 Ga0495662_0005641
464 Ga0495664_0098982
465 Ga0495585_0008356
466 Ga0495585_0024520
467 Ga0495585_0034323
468 Ga0495585_0110117
469 Ga0495594_0000044
470 Ga0495594_0007861
471 Ga0495596_0003873
472 Ga0495596_0068227
473 Ga0495607_0112166
474 Ga0495583_0017042
475 Ga0495606_0000181
476 Ga0495620_0000461
477 Ga0495630_0027565
478 Ga0495631_0042799
479 Ga0495631_0063084
480 Ga0495631_0105971
481 Ga0495632_0047205
482 Ga0495644_0000041
483 Ga0495644_0030410
484 Ga0495648_0001919
485 Ga0495648_0071191
486 Ga0495666_0062025
487 Ga0495642_0013842
488 Ga0495665_0002545
489 Ga0495640_0017487
490 Ga0495640_0070630
491 Ga0495609_0012356
492 Ga0495597_0039375
493 Ga0495645_0011203
494 Ga0495622_0008892
495 Ga0495622_0016288
496 Ga0495622_0017158
497 Ga0495622_0072667
498 Ga0495633_0002414
499 Ga0495633_0003836
500 Ga0495668_0007762
501 Ga0495634_0015884
502 Ga0495634_0030202
503 Ga0495625_0013870
504 Ga0495625_0041092
505 Ga0495625_0046770
506 Ga0495625_0056796
507 Ga0495635_0034371
508 Ga0495635_0184150
509 Ga0495588_0018201
510 Ga0495599_0002014
511 Ga0495623_0027979
512 Ga0495647_0017164
513 Ga0495658_0002382
514 Ga0495669_0015280
515 Ga0495613_0002308
516 Ga0495613_0002505
517 Ga0495613_0033746
518 Ga0495613_0065069
519 Ga0495613_0196917
520 Ga0495624_0016425
521 Ga0495670_0186417
522 Ga0495671_0019871
523 Ga0495671_0026937
524 Ga0495649_0007710
525 Ga0495649_0046370
526 Ga0495589_0002956
527 Ga0495589_0003628
528 Ga0495660_0000078
529 Ga0495581_0009274
530 Ga0495581_0042625
531 Ga0495581_0076094
532 Ga0495674_0015507
533 Ga0495674_0102316
534 Ga0495672_0000346
535 Ga0495672_0011406
536 Ga0495676_0057656
537 Ga0495683_0130103
538 Ga0495679_048154
539 Ga0495673_0000001
540 Ga0495673_0000010
541 Ga0495684_0243643
542 Ga0495686_0000105
543 Ga0495686_0000440
544 Ga0495686_0000576
545 Ga0495686_0002216
546 Ga0495686_0034095
547 Ga0495686_0067399
548 Ga0495593_0009057
549 Ga0495614_0008732
550 Ga0495614_0019587
551 Ga0496101_0003285
552 Ga0496101_0246805
553 Ga0496102_0004927
554 Ga0496102_0020605
555 Ga0496104_0032165
556 Ga0496104_0101225
557 Ga0496105_0006788
558 Ga0496105_0043828
559 Ga0496105_0073222
560 Ga0496106_0151419
561 Ga0496106_0254970
562 Ga0496107_0013544
563 Ga0496107_0032567
564 Ga0496110_0104065
565 Ga0496110_0227726
566 Ga0496112_0035115
567 Ga0496113_0006713
568 Ga0496113_0204469
569 Ga0496114_0131026
570 Ga0496115_0000096
571 Ga0496115_0039098
572 Ga0496115_0128205
573 Ga0496115_0284010
574 Ga0496119_0065373
575 Ga0496120_0011303
576 Ga0496121_0002184
577 Ga0496121_0006812
578 Ga0496121_0022765
579 Ga0496121_0270277
580 Ga0496125_0140172
581 Ga0496126_0003232
582 Ga0496126_0045138
583 Ga0496126_0070077
584 Ga0496126_0117127
585 Ga0495678_015884
586 Ga0495682_0000540
587 Ga0495682_0000694
588 Ga0501034_0249671
589 Ga0501068_0033487
590 Ga0501080_0083651
591 Ga0501044_0033717
592 Ga0495601_0006095
593 Ga0495612_0004289
594 Ga0495619_0015190
595 Ga0500578_0063154
596 Ga0500651_0054028
597 Ga0500640_055519
598 Ga0500572_000465
599 Ga0500595_002366
600 Ga0500595_002699
601 Ga0500595_003460
602 Ga0500595_008469
603 Ga0500614_001232
604 Ga0500655_001603
605 Ga0500559_0001191
606 Ga0500559_0005167
607 Ga0500573_0173122
608 Ga0500616_0045792
609 Ga0500639_053330
610 Ga0500636_0000047
611 Ga0500596_000165
612 Ga0500601_000032
613 Ga0501082_0036172
614 2509154449
615 2513893865
616 2517894197
617 2739733077
618 2739733079
619 2821448275
620 2824664694
621 2824757602
622 2824764192
623 2879109929
624 2883356614
625 2904713419
626 2922372265
627 2929616531
628 2929625275
629 2932786793
630 2932793368
631 2932818033
632 2932827828
633 2932832617
634 2933578186
635 2935619318
636 2935645295
637 2935671393
638 2935683757
639 2935691944
640 2935708032
641 2935721783
642 2935731219
643 2935738919
644 2935747896
645 2935756480
646 2935761538
647 2935804981
648 2935812145
649 2935834862
650 2935838927
651 2935857683
652 2935873314
653 2935882905
654 2935997449
655 2936005230
656 2936038739
657 2940562394
658 2941539616
659 8005306224
660 8005694079
661 8006941681
662 8006981395
663 8017061036
664 8019580507
665 8019603111
666 8019615423
667 8055748177
668 8056968894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07859

Abhydrolase_3

alpha/beta hydrolase fold

159

368

0.97

PF20434

BD-FAE

BD-FAE

144

280

0.89

PF00326

Peptidase_S9

Prolyl oligopeptidase family

208

374

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7yc0-assembly2.cif.gz_C-2 acetylesterase (lgesti) w.t. 0.9427 18 328
4ou4-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant s159a complexed with (s)-ac-cpa 0.9415 15 330
4ob7-assembly1.cif.gz_A-2 crystal structure of esterase rppe mutant w187h 0.9405 15 330
4ob8-assembly1.cif.gz_A-2 crystal structure of a novel thermostable esterase from pseudomonas putida ecu1011 0.9405 15 330
4ou5-assembly1.cif.gz_A crystal structure of esterase rppe mutant s159a/w187h 0.9398 15 330
ID Description Score Start End Superfamily
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9405 15 330 3.40.50.1820
3aikA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9293 45 327 3.40.50.1820
4ob8A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9292 15 330 3.40.50.1820
af_Q54L36_11_325_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9287 24 328 3.40.50.1820
4v2iB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9215 18 329 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A136QGY0-F1-model_v4 deleted 0.9655 146 328
AF-A0A136QGY0-F1-model_v4 deleted 0.9604 146 328
AF-A0A165J9X0-F1-model_v4 Alpha/beta hydrolase fold-3 0.9509 103 327 GO:0016787
AF-A0A4U9HKL8-F1-model_v4 Lipase 2 (EC 3.1.1.3) 0.9498 190 328 GO:0004806
AF-A0A0D5BJU0-F1-model_v4 deleted 0.948 95 329

Map