F413096

General Info

Members Datasets Scaffolds Average Seq Length
337 161 337 295

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10059192|Ga0213876_100591922
Length 315
Sequence MLSALTKTQQIPFHMHRRAFIKHTGKTAIATSVFGSIRWSNNHFIGDTPTTTDILGPYYRPGAPFRTNINPPGFSGELLHFNGRVLGNGGKTPVQNCLVEIWQCDADQHYDNISEDFRYRGAQKTDASGKYSFVTTQPVAYPIEEGSSIYRPAHIHMRIAGDGQQDLITQIYFKGDSMLEHDGPASAPTAINRILTIGKNDKNEKELRFDIVLADEVKPTDEVFKKLTGIYKMNDKSMIEFYREGDLLFMKLDGQIIEALSYKGKDGFSGGVNSTTTAKFEIMPGKKTKVFLHFYAVQDMTIKELILEGVITFKY

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
65 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
69 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
79 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
80 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
129 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
142 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
155 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
156 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
157 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
158 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 0.59
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c003930 3300000043 Bacteria 1430
2 Ga0065712_10161904 3300005290 Bacteria 1296
3 Ga0070658_10216899 3300005327 Bacteria 1617
4 Ga0070676_10395877 3300005328 Bacteria 960
5 Ga0070683_100030484 3300005329 Unclassified 4898
6 Ga0070683_100032942 3300005329 Bacteria 4722
7 Ga0070683_100302005 3300005329 Bacteria 1523
8 Ga0070683_100326121 3300005329 Bacteria 1462
9 Ga0070690_100077416 3300005330 Bacteria 2171
10 Ga0070670_100106386 3300005331 Bacteria 2417
11 Ga0070670_100147243 3300005331 Bacteria 2038
12 Ga0070670_100172137 3300005331 Bacteria 1878
13 Ga0070670_100309408 3300005331 Bacteria 1383
14 Ga0070677_10028693 3300005333 Bacteria 2104
15 Ga0068869_100034178 3300005334 Bacteria 3595
16 Ga0068869_100066972 3300005334 Bacteria 2648
17 Ga0068869_100131975 3300005334 Bacteria 1921
18 Ga0068869_100135128 3300005334 Bacteria 1899
19 Ga0070666_10013196 3300005335 Bacteria 5238
20 Ga0068868_100006692 3300005338 Bacteria 8175
21 Ga0068868_100008325 3300005338 Bacteria 7423
22 Ga0070660_100043524 3300005339 Bacteria 3431
23 Ga0070660_100134429 3300005339 Unclassified 1981
24 Ga0070660_100378281 3300005339 Bacteria 1169
25 Ga0070689_100010707 3300005340 Bacteria 6545
26 Ga0070689_100012566 3300005340 Bacteria 6105
27 Ga0070689_100065045 3300005340 Bacteria 2839
28 Ga0070661_100021491 3300005344 Bacteria 4610
29 Ga0070668_100014582 3300005347 Bacteria 5874
30 Ga0070668_100244579 3300005347 Bacteria 1487
31 Ga0070675_100026919 3300005354 Bacteria 4617
32 Ga0070675_100060958 3300005354 Bacteria 3114
33 Ga0070675_100295839 3300005354 Bacteria 1425
34 Ga0070671_100135164 3300005355 Bacteria 2079
35 Ga0070674_100020274 3300005356 Bacteria 4242
36 Ga0070674_100287290 3300005356 Bacteria 1306
37 Ga0070673_100053371 3300005364 Unclassified 3175
38 Ga0070673_100225824 3300005364 Bacteria 1623
39 Ga0070688_100078971 3300005365 Bacteria 2124
40 Ga0070659_100237583 3300005366 Bacteria 1507
41 Ga0070667_100018520 3300005367 Bacteria 5776
42 Ga0070678_100244307 3300005456 Bacteria 1502
43 Ga0070662_100014388 3300005457 Bacteria 5285
44 Ga0070662_100038721 3300005457 Bacteria 3387
45 Ga0070662_100117371 3300005457 Bacteria 2035
46 Ga0068867_100008783 3300005459 Bacteria 7135
47 Ga0068867_100026518 3300005459 Bacteria 4162
48 Ga0068867_100055738 3300005459 Bacteria 2923
49 Ga0070698_100004394 3300005471 Bacteria 15489
50 Ga0070698_100006556 3300005471 Bacteria 12626
51 Ga0070698_100024680 3300005471 Bacteria 6271
52 Ga0070679_100194181 3300005530 Bacteria 1998
53 Ga0070679_100278805 3300005530 Bacteria 1625
54 Ga0070684_100002508 3300005535 Bacteria 13526
55 Ga0070684_100345141 3300005535 Bacteria 1369
56 Ga0068853_100109690 3300005539 Bacteria 2450
57 Ga0068853_100118990 3300005539 Bacteria 2354
58 Ga0068853_100317438 3300005539 Bacteria 1444
59 Ga0070672_100120596 3300005543 Bacteria 2146
60 Ga0070672_100278607 3300005543 Bacteria 1413
61 Ga0070672_100330829 3300005543 Bacteria 1296
62 Ga0070665_100049122 3300005548 Bacteria 4233
63 Ga0070665_100489594 3300005548 Bacteria 1241
64 Ga0068855_100047898 3300005563 Bacteria 5047
65 Ga0068855_100321671 3300005563 Unclassified 1710
66 Ga0068855_100348126 3300005563 Unclassified 1633
67 Ga0068855_100374296 3300005563 Bacteria 1565
68 Ga0068855_100495719 3300005563 Bacteria 1328
69 Ga0070664_100260684 3300005564 Bacteria 1560
70 Ga0070664_100388785 3300005564 Unclassified 1274
71 Ga0068857_100021002 3300005577 Bacteria 5745
72 Ga0068857_100241963 3300005577 Bacteria 1652
73 Ga0068854_100098406 3300005578 Unclassified 2189
74 Ga0068856_100434612 3300005614 Bacteria 1333
75 Ga0068852_100046447 3300005616 Bacteria 3700
76 Ga0068852_100110318 3300005616 Bacteria 2500
77 Ga0068852_100177193 3300005616 Bacteria 2002
78 Ga0068852_100219869 3300005616 Bacteria 1806
79 Ga0068859_100045704 3300005617 Bacteria 4399
80 Ga0068859_100103293 3300005617 Bacteria 2908
81 Ga0068859_100120487 3300005617 Bacteria 2691
82 Ga0068864_100003633 3300005618 Bacteria 12754
83 Ga0068864_100281827 3300005618 Bacteria 1551
84 Ga0068864_100316870 3300005618 Bacteria 1464
85 Ga0068864_100472061 3300005618 Bacteria 1203
86 Ga0068866_10063782 3300005718 Bacteria 1922
87 Ga0068861_100029513 3300005719 Bacteria 4013
88 Ga0068861_100084173 3300005719 Bacteria 2497
89 Ga0068861_100111829 3300005719 Bacteria 2189
90 Ga0068861_100289093 3300005719 Bacteria 1415
91 Ga0068870_10020104 3300005840 Bacteria 3247
92 Ga0068863_100122149 3300005841 Bacteria 2484
93 Ga0068863_100165401 3300005841 Bacteria 2121
94 Ga0068858_100060883 3300005842 Bacteria 3490
95 Ga0068860_100004702 3300005843 Bacteria 13930
96 Ga0068860_100069603 3300005843 Bacteria 3345
97 Ga0068862_100235029 3300005844 Bacteria 1664
98 Ga0068862_100266008 3300005844 Bacteria 1567
99 Ga0081539_10023819 3300005985 Bacteria 3995
100 Ga0070715_10215582 3300006163 Bacteria 984
101 Ga0075366_10140667 3300006195 Bacteria 1459
102 Ga0068871_100039948 3300006358 Unclassified 3756
103 Ga0068871_100231289 3300006358 Bacteria 1604
104 Ga0068871_100244436 3300006358 Bacteria 1561
105 Ga0075428_100001878 3300006844 Bacteria 22540
106 Ga0075428_100187610 3300006844 Bacteria 2237
107 Ga0075429_100011304 3300006880 Bacteria 7729
108 Ga0068865_100049678 3300006881 Bacteria 2893
109 Ga0068865_100162773 3300006881 Bacteria 1704
110 Ga0097620_100045705 3300006931 Bacteria 4399
111 Ga0097620_100103294 3300006931 Bacteria 2908
112 Ga0097620_100120487 3300006931 Bacteria 2691
113 Ga0105251_10095747 3300009011 Bacteria 1360
114 Ga0105240_10009461 3300009093 Bacteria 13795
115 Ga0105240_10020225 3300009093 Bacteria 8886
116 Ga0105240_10373810 3300009093 Bacteria 1611
117 Ga0111539_10034373 3300009094 Bacteria 6147
118 Ga0111539_10036138 3300009094 Bacteria 5975
119 Ga0111539_10146771 3300009094 Bacteria 2762
120 Ga0105242_10018324 3300009176 Bacteria 5472
121 Ga0105242_10046447 3300009176 Bacteria 3523
122 Ga0105242_10081917 3300009176 Bacteria 2699
123 Ga0105242_10104406 3300009176 Bacteria 2405
124 Ga0105242_10154324 3300009176 Bacteria 2005
125 Ga0105248_10191315 3300009177 Bacteria 2306
126 Ga0105248_10326008 3300009177 Bacteria 1730
127 Ga0105248_10647134 3300009177 Bacteria 1193
128 Ga0105237_10002155 3300009545 Bacteria 24769
129 Ga0105249_10000611 3300009553 Bacteria 32583
130 Ga0105249_10001968 3300009553 Bacteria 17825
131 Ga0105249_10017860 3300009553 Bacteria 6303
132 Ga0105249_10045632 3300009553 Bacteria 3987
133 Ga0105249_10739119 3300009553 Bacteria 1046
134 Ga0105239_10002568 3300010375 Bacteria 23031
135 Ga0105239_10065290 3300010375 Bacteria 3996
136 Ga0105246_10052790 3300011119 Bacteria 2795
137 Ga0105246_10126484 3300011119 Bacteria 1902
138 Ga0157373_10028080 3300013100 Bacteria 4060
139 Ga0157373_10028773 3300013100 Bacteria 4007
140 Ga0157373_10267500 3300013100 Bacteria 1210
141 Ga0157373_10272879 3300013100 Bacteria 1197
142 Ga0157371_10030636 3300013102 Bacteria 3880
143 Ga0157371_10102260 3300013102 Unclassified 2033
144 Ga0157370_10481833 3300013104 Bacteria 1140
145 Ga0157370_10674561 3300013104 Unclassified 944
146 Ga0157369_10057001 3300013105 Bacteria 4216
147 Ga0157369_10208325 3300013105 Bacteria 2050
148 Ga0157369_10243556 3300013105 Bacteria 1878
149 Ga0157374_10001852 3300013296 Bacteria 17789
150 Ga0157374_10006784 3300013296 Bacteria 9735
151 Ga0157374_10027661 3300013296 Bacteria 5119
152 Ga0157374_10234013 3300013296 Bacteria 1805
153 Ga0157374_10300777 3300013296 Bacteria 1587
154 Ga0157378_10159934 3300013297 Bacteria 2106
155 Ga0157378_10401318 3300013297 Bacteria 1351
156 Ga0163162_10003191 3300013306 Bacteria 15680
157 Ga0163162_10004465 3300013306 Bacteria 13479
158 Ga0163162_10010052 3300013306 Bacteria 9201
159 Ga0163162_10036395 3300013306 Bacteria 4906
160 Ga0163162_10113758 3300013306 Bacteria 2805
161 Ga0163162_10343152 3300013306 Bacteria 1626
162 Ga0163162_10467049 3300013306 Bacteria 1393
163 Ga0157372_10022934 3300013307 Bacteria 6761
164 Ga0157372_10056172 3300013307 Bacteria 4399
165 Ga0157372_10284595 3300013307 Bacteria 1922
166 Ga0157372_10336222 3300013307 Bacteria 1759
167 Ga0157372_10654031 3300013307 Bacteria 1224
168 Ga0157372_10840316 3300013307 Bacteria 1066
169 Ga0157375_10029398 3300013308 Bacteria 5167
170 Ga0157375_10048721 3300013308 Bacteria 4146
171 Ga0157375_10131394 3300013308 Unclassified 2623
172 Ga0157375_10140438 3300013308 Unclassified 2542
173 Ga0157375_10146621 3300013308 Bacteria 2491
174 Ga0157375_10361407 3300013308 Bacteria 1618
175 Ga0163163_10000348 3300014325 Bacteria 44508
176 Ga0157380_10183451 3300014326 Bacteria 1841
177 Ga0157380_10244757 3300014326 Unclassified 1619
178 Ga0157380_10587250 3300014326 Bacteria 1100
179 Ga0157377_10043687 3300014745 Bacteria 2495
180 Ga0157377_10047096 3300014745 Bacteria 2414
181 Ga0157379_10069044 3300014968 Unclassified 3160
182 Ga0157379_10081421 3300014968 Bacteria 2900
183 Ga0157379_10097330 3300014968 Bacteria 2642
184 Ga0157379_10172839 3300014968 Bacteria 1950
185 Ga0157379_10356657 3300014968 Bacteria 1340
186 Ga0157376_10571304 3300014969 Bacteria 1122
187 Ga0157376_10800017 3300014969 Unclassified 955
188 Ga0163161_10035001 3300017792 Bacteria 3593
189 Ga0163161_10075241 3300017792 Bacteria 2477
190 Ga0163161_10087082 3300017792 Bacteria 2306
191 Ga0213876_10059192 3300021384 Bacteria 2022
192 Ga0209257_1000007 3300025304 Bacteria 1564415
193 Ga0207682_10024251 3300025893 Bacteria 2400
194 Ga0207642_10195524 3300025899 Bacteria 1113
195 Ga0207688_10078609 3300025901 Bacteria 1880
196 Ga0207680_10010443 3300025903 Bacteria 4644
197 Ga0207647_10050122 3300025904 Bacteria 2587
198 Ga0207645_10002157 3300025907 Bacteria 15725
199 Ga0207645_10012167 3300025907 Bacteria 5845
200 Ga0207643_10005289 3300025908 Bacteria 6906
201 Ga0207705_10062487 3300025909 Bacteria 2690
202 Ga0207705_10138294 3300025909 Bacteria 1817
203 Ga0207654_10107876 3300025911 Bacteria 1727
204 Ga0207707_10169494 3300025912 Bacteria 1908
205 Ga0207695_10015688 3300025913 Bacteria 8912
206 Ga0207695_10021935 3300025913 Bacteria 7268
207 Ga0207671_10002836 3300025914 Bacteria 18020
208 Ga0207662_10055179 3300025918 Bacteria 2371
209 Ga0207657_10054917 3300025919 Bacteria 3442
210 Ga0207657_10188889 3300025919 Bacteria 1663
211 Ga0207657_10262005 3300025919 Unclassified 1376
212 Ga0207649_10158974 3300025920 Bacteria 1564
213 Ga0207649_10179892 3300025920 Bacteria 1479
214 Ga0207652_10152633 3300025921 Bacteria 2068
215 Ga0207650_10046118 3300025925 Bacteria 3209
216 Ga0207659_10009756 3300025926 Bacteria 6005
217 Ga0207659_10013174 3300025926 Bacteria 5290
218 Ga0207659_10127105 3300025926 Bacteria 1962
219 Ga0207659_10277990 3300025926 Bacteria 1368
220 Ga0207659_10395104 3300025926 Bacteria 1155
221 Ga0207706_10009835 3300025933 Bacteria 8773
222 Ga0207706_10175461 3300025933 Bacteria 1883
223 Ga0207706_10331753 3300025933 Bacteria 1323
224 Ga0207686_10000367 3300025934 Bacteria 31650
225 Ga0207686_10211735 3300025934 Bacteria 1394
226 Ga0207686_10214120 3300025934 Bacteria 1387
227 Ga0207670_10009415 3300025936 Bacteria 5576
228 Ga0207670_10010246 3300025936 Bacteria 5392
229 Ga0207670_10016822 3300025936 Bacteria 4406
230 Ga0207670_10022966 3300025936 Unclassified 3874
231 Ga0207704_10077143 3300025938 Bacteria 2138
232 Ga0207704_10155549 3300025938 Bacteria 1620
233 Ga0207691_10011633 3300025940 Bacteria 8447
234 Ga0207691_10046509 3300025940 Bacteria 3987
235 Ga0207691_10049425 3300025940 Bacteria 3853
236 Ga0207711_10315224 3300025941 Bacteria 1444
237 Ga0207689_10001523 3300025942 Bacteria 22061
238 Ga0207689_10011441 3300025942 Bacteria 7605
239 Ga0207689_10085760 3300025942 Bacteria 2588
240 Ga0207689_10122525 3300025942 Bacteria 2138
241 Ga0207689_10226924 3300025942 Bacteria 1544
242 Ga0207689_10338176 3300025942 Bacteria 1250
243 Ga0207661_10145303 3300025944 Bacteria 2045
244 Ga0207679_10003751 3300025945 Bacteria 9418
245 Ga0207679_10116678 3300025945 Bacteria 2117
246 Ga0207667_10078033 3300025949 Bacteria 3433
247 Ga0207667_10366770 3300025949 Bacteria 1468
248 Ga0207651_10113363 3300025960 Bacteria 2040
249 Ga0207651_10547290 3300025960 Bacteria 1006
250 Ga0207712_10002156 3300025961 Bacteria 12855
251 Ga0207712_10003748 3300025961 Bacteria 9593
252 Ga0207712_10006746 3300025961 Bacteria 7242
253 Ga0207658_10066768 3300025986 Bacteria 2707
254 Ga0207677_10003862 3300026023 Bacteria 7982
255 Ga0207677_10173546 3300026023 Bacteria 1688
256 Ga0207677_10334130 3300026023 Bacteria 1264
257 Ga0207703_10584677 3300026035 Bacteria 1055
258 Ga0207639_10088345 3300026041 Bacteria 2473
259 Ga0207639_10265498 3300026041 Bacteria 1503
260 Ga0207639_10483064 3300026041 Bacteria 1129
261 Ga0207678_10043390 3300026067 Bacteria 3892
262 Ga0207708_10023750 3300026075 Bacteria 4635
263 Ga0207708_10145566 3300026075 Bacteria 1862
264 Ga0207641_10000873 3300026088 Bacteria 31566
265 Ga0207641_10041046 3300026088 Bacteria 3877
266 Ga0207641_10045529 3300026088 Bacteria 3695
267 Ga0207641_10163412 3300026088 Bacteria 2026
268 Ga0207648_10009922 3300026089 Bacteria 9077
269 Ga0207648_10073942 3300026089 Bacteria 2970
270 Ga0207676_10001245 3300026095 Bacteria 18955
271 Ga0207676_10039993 3300026095 Bacteria 3591
272 Ga0207676_10140265 3300026095 Bacteria 2068
273 Ga0207676_10600327 3300026095 Bacteria 1057
274 Ga0207674_10033039 3300026116 Bacteria 5420
275 Ga0207674_10077067 3300026116 Bacteria 3340
276 Ga0207674_10167080 3300026116 Unclassified 2154
277 Ga0207675_100059330 3300026118 Bacteria 3570
278 Ga0207675_100104055 3300026118 Bacteria 2675
279 Ga0207675_100148459 3300026118 Bacteria 2230
280 Ga0207675_100301401 3300026118 Bacteria 1561
281 Ga0207683_10000737 3300026121 Bacteria 29767
282 Ga0207683_10299399 3300026121 Unclassified 1471
283 Ga0207698_10050711 3300026142 Bacteria 3168
284 Ga0207698_10052102 3300026142 Bacteria 3133
285 Ga0207698_10066383 3300026142 Bacteria 2840
286 Ga0207698_10108187 3300026142 Bacteria 2323
287 Ga0207428_10137301 3300027907 Bacteria 1869
288 Ga0207428_10285451 3300027907 Unclassified 1224
289 Ga0268266_10066246 3300028379 Bacteria 3123
290 Ga0268265_10092317 3300028380 Unclassified 2423
291 Ga0268265_10121467 3300028380 Bacteria 2153
292 Ga0268265_10328192 3300028380 Bacteria 1389
293 Ga0268264_10005567 3300028381 Bacteria 10668
294 Ga0268264_10110609 3300028381 Bacteria 2406
295 Ga0268264_10154649 3300028381 Bacteria 2060
296 Ga0307515_10000024 3300028794 Bacteria 393119
297 Ga0316576_10212186 3300031727 Bacteria 1457
298 Ga0373943_0064695 3300035170 Bacteria 1837
299 Ga0373955_0012007 3300035172 Bacteria 4152
300 Ga0316574_0310863 3300035398 Bacteria 1001
301 Ga0373937_0238457 3300036401 Bacteria 1713
302 Ga0316584_0305654 3300036712 Bacteria 1151
303 Ga0395899_0078641 3300037312 Bacteria 2404
304 Ga0395900_0164370 3300037418 Bacteria 2262
305 Ga0395898_0023029 3300037466 Bacteria 6297
306 Ga0395898_0210402 3300037466 Bacteria 1855
307 Ga0395905_0110186 3300037471 Bacteria 2585
308 Ga0395901_0035860 3300038443 Bacteria 5125
309 Ga0436365_1398823 3300039437 Bacteria 37103
310 Ga0436365_1597568 3300039437 Bacteria 12609
311 Ga0451800_1585672 3300041459 Bacteria 1097
312 Ga0439462_0022618 3300042015 Bacteria 1646
313 Ga0450923_005502 3300042125 Bacteria 2050
314 Ga0439446_0051860 3300042156 Bacteria 1227
315 Ga0451577_0007617 3300042876 Bacteria 10620
316 Ga0453683_0029467 3300044673 Bacteria 3470
317 Ga0453684_0015052 3300044712 Bacteria 12276
318 Ga0451576_0076706 3300045051 Bacteria 3478
319 Ga0451576_0104387 3300045051 Bacteria 2948
320 Ga0451576_0123040 3300045051 Bacteria 2702
321 Ga0466967_0082000 3300045976 Bacteria 2914
322 Ga0495630_0119069 3300046517 Unclassified 2003
323 Ga0495621_0026922 3300046539 Bacteria 1944
324 Ga0495646_0158602 3300046680 Bacteria 1254
325 Ga0496112_0289278 3300048915 Bacteria 1585
326 Ga0501217_006456 3300049661 Bacteria 2492
327 Ga0501217_013920 3300049661 Bacteria 1810
328 Ga0501227_055736 3300049665 Bacteria 1005
329 Ga0501221_005785 3300049704 Bacteria 2076
330 Ga0501225_0025718 3300049705 Bacteria 1619
331 Ga0501234_001818 3300049707 Bacteria 3369
332 nmdc:mga09592_390850_c1 3300050508 Unclassified 1202
333 nmdc:mga09592_823_c1 3300050508 Bacteria 24005
334 nmdc:mga06r32_388759_c1 3300050510 Bacteria 1377
335 nmdc:mga08y16_46514_c1 3300050511 Bacteria 4543
336 nmdc:mga08y16_49539_c1 3300050511 Bacteria 4396
337 nmdc:mga08y16_499746_c1 3300050511 Unclassified 1236

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049705 Ga0501225_0025718 Ga0501225_0025718_753_1499 244
2 3300025926 Ga0207659_10395104 Ga0207659_103951042 259
3 3300005330 Ga0070690_100077416 Ga0070690_1000774162 261
4 3300035398 Ga0316574_0310863 Ga0316574_0310863_27_893 261
5 3300028794 Ga0307515_10000024 Ga0307515_1000002435 279
6 3300009094 Ga0111539_10146771 Ga0111539_101467712 281
7 3300027907 Ga0207428_10137301 Ga0207428_101373012 281
8 3300050511 nmdc:mga08y16_49539_c1 nmdc:mga08y16_49539_c1_3189_4034 281
9 3300005331 Ga0070670_100106386 Ga0070670_1001063863 282
10 3300005335 Ga0070666_10013196 Ga0070666_100131964 282
11 3300005340 Ga0070689_100012566 Ga0070689_1000125663 282
12 3300005364 Ga0070673_100225824 Ga0070673_1002258241 282
13 3300005367 Ga0070667_100018520 Ga0070667_1000185207 282
14 3300005471 Ga0070698_100004394 Ga0070698_1000043944 282
15 3300005539 Ga0068853_100118990 Ga0068853_1001189902 282
16 3300005616 Ga0068852_100110318 Ga0068852_1001103183 282
17 3300005719 Ga0068861_100029513 Ga0068861_1000295132 282
18 3300009177 Ga0105248_10647134 Ga0105248_106471341 282
19 3300009553 Ga0105249_10000611 Ga0105249_1000061141 282
20 3300013296 Ga0157374_10300777 Ga0157374_103007772 282
21 3300013306 Ga0163162_10010052 Ga0163162_100100528 282
22 3300014968 Ga0157379_10356657 Ga0157379_103566572 282
23 3300014969 Ga0157376_10571304 Ga0157376_105713041 282
24 3300025903 Ga0207680_10010443 Ga0207680_100104431 282
25 3300025934 Ga0207686_10211735 Ga0207686_102117352 282
26 3300025942 Ga0207689_10226924 Ga0207689_102269241 282
27 3300025961 Ga0207712_10003748 Ga0207712_1000374810 282
28 3300026095 Ga0207676_10039993 Ga0207676_100399932 282
29 3300048915 Ga0496112_0289278 Ga0496112_0289278_44_898 282
30 3300009093 Ga0105240_10009461 Ga0105240_100094617 284
31 3300010375 Ga0105239_10065290 Ga0105239_100652904 284
32 3300013100 Ga0157373_10028773 Ga0157373_100287733 284
33 3300013104 Ga0157370_10481833 Ga0157370_104818331 284
34 3300013104 Ga0157370_10674561 Ga0157370_106745611 284
35 3300013105 Ga0157369_10057001 Ga0157369_100570011 284
36 3300013307 Ga0157372_10284595 Ga0157372_102845952 284
37 3300009094 Ga0111539_10034373 Ga0111539_100343735 286
38 3300027907 Ga0207428_10285451 Ga0207428_102854512 286
39 3300050511 nmdc:mga08y16_499746_c1 nmdc:mga08y16_499746_c1_288_1160 286
40 3300005563 Ga0068855_100321671 Ga0068855_1003216711 289
41 3300025909 Ga0207705_10138294 Ga0207705_101382942 289
42 3300044673 Ga0453683_0029467 Ga0453683_0029467_752_1630 289
43 3300045051 Ga0451576_0076706 Ga0451576_0076706_924_1802 289
44 3300005339 Ga0070660_100378281 Ga0070660_1003782812 292
45 3300005563 Ga0068855_100348126 Ga0068855_1003481262 292
46 3300005563 Ga0068855_100495719 Ga0068855_1004957192 292
47 3300005577 Ga0068857_100241963 Ga0068857_1002419632 292
48 3300005618 Ga0068864_100003633 Ga0068864_1000036337 292
49 3300006358 Ga0068871_100039948 Ga0068871_1000399481 292
50 3300006844 Ga0075428_100001878 Ga0075428_10000187820 292
51 3300006880 Ga0075429_100011304 Ga0075429_1000113045 292
52 3300009553 Ga0105249_10001968 Ga0105249_100019684 292
53 3300013100 Ga0157373_10272879 Ga0157373_102728792 292
54 3300013105 Ga0157369_10208325 Ga0157369_102083252 292
55 3300013307 Ga0157372_10654031 Ga0157372_106540311 292
56 3300025919 Ga0207657_10188889 Ga0207657_101888893 292
57 3300025949 Ga0207667_10078033 Ga0207667_100780337 292
58 3300025961 Ga0207712_10002156 Ga0207712_100021564 292
59 3300026116 Ga0207674_10077067 Ga0207674_100770673 292
60 3300031727 Ga0316576_10212186 Ga0316576_102121862 292
61 3300036712 Ga0316584_0305654 Ga0316584_0305654_217_1104 292
62 3300037312 Ga0395899_0078641 Ga0395899_0078641_348_1232 292
63 3300037418 Ga0395900_0164370 Ga0395900_0164370_382_1266 292
64 3300037466 Ga0395898_0023029 Ga0395898_0023029_3308_4192 292
65 3300037466 Ga0395898_0210402 Ga0395898_0210402_791_1672 292
66 3300037471 Ga0395905_0110186 Ga0395905_0110186_499_1383 292
67 3300038443 Ga0395901_0035860 Ga0395901_0035860_3434_4318 292
68 3300042156 Ga0439446_0051860 Ga0439446_0051860_109_987 292
69 3300050508 nmdc:mga09592_823_c1 nmdc:mga09592_823_c1_5900_6778 292
70 3300005290 Ga0065712_10161904 Ga0065712_101619042 293
71 3300005329 Ga0070683_100030484 Ga0070683_1000304842 293
72 3300005333 Ga0070677_10028693 Ga0070677_100286933 293
73 3300005340 Ga0070689_100065045 Ga0070689_1000650453 293
74 3300005354 Ga0070675_100060958 Ga0070675_1000609583 293
75 3300005365 Ga0070688_100078971 Ga0070688_1000789712 293
76 3300005457 Ga0070662_100117371 Ga0070662_1001173712 293
77 3300005459 Ga0068867_100026518 Ga0068867_1000265182 293
78 3300005471 Ga0070698_100024680 Ga0070698_1000246806 293
79 3300005543 Ga0070672_100120596 Ga0070672_1001205962 293
80 3300005543 Ga0070672_100278607 Ga0070672_1002786072 293
81 3300005616 Ga0068852_100219869 Ga0068852_1002198692 293
82 3300005618 Ga0068864_100281827 Ga0068864_1002818271 293
83 3300005719 Ga0068861_100289093 Ga0068861_1002890931 293
84 3300005985 Ga0081539_10023819 Ga0081539_100238193 293
85 3300006358 Ga0068871_100231289 Ga0068871_1002312892 293
86 3300006844 Ga0075428_100187610 Ga0075428_1001876102 293
87 3300009094 Ga0111539_10036138 Ga0111539_100361386 293
88 3300009177 Ga0105248_10326008 Ga0105248_103260082 293
89 3300009553 Ga0105249_10017860 Ga0105249_100178602 293
90 3300014326 Ga0157380_10183451 Ga0157380_101834513 293
91 3300014326 Ga0157380_10587250 Ga0157380_105872501 293
92 3300014968 Ga0157379_10172839 Ga0157379_101728392 293
93 3300017792 Ga0163161_10035001 Ga0163161_100350012 293
94 3300017792 Ga0163161_10075241 Ga0163161_100752412 293
95 3300025893 Ga0207682_10024251 Ga0207682_100242513 293
96 3300025918 Ga0207662_10055179 Ga0207662_100551792 293
97 3300025926 Ga0207659_10009756 Ga0207659_100097562 293
98 3300025934 Ga0207686_10000367 Ga0207686_100003672 293
99 3300025936 Ga0207670_10009415 Ga0207670_100094155 293
100 3300025936 Ga0207670_10022966 Ga0207670_100229665 293
101 3300025940 Ga0207691_10011633 Ga0207691_100116334 293
102 3300025940 Ga0207691_10046509 Ga0207691_100465095 293
103 3300025961 Ga0207712_10006746 Ga0207712_100067462 293
104 3300025986 Ga0207658_10066768 Ga0207658_100667682 293
105 3300026023 Ga0207677_10173546 Ga0207677_101735462 293
106 3300026035 Ga0207703_10584677 Ga0207703_105846772 293
107 3300026075 Ga0207708_10023750 Ga0207708_100237502 293
108 3300026088 Ga0207641_10000873 Ga0207641_1000087317 293
109 3300026088 Ga0207641_10041046 Ga0207641_100410462 293
110 3300026095 Ga0207676_10140265 Ga0207676_101402652 293
111 3300026116 Ga0207674_10167080 Ga0207674_101670802 293
112 3300026118 Ga0207675_100104055 Ga0207675_1001040552 293
113 3300026121 Ga0207683_10299399 Ga0207683_102993992 293
114 3300026142 Ga0207698_10050711 Ga0207698_100507112 293
115 3300026142 Ga0207698_10052102 Ga0207698_100521023 293
116 3300028380 Ga0268265_10092317 Ga0268265_100923171 293
117 3300028380 Ga0268265_10328192 Ga0268265_103281921 293
118 3300028381 Ga0268264_10154649 Ga0268264_101546493 293
119 3300042015 Ga0439462_0022618 Ga0439462_0022618_654_1535 293
120 3300042125 Ga0450923_005502 Ga0450923_005502_662_1543 293
121 3300045051 Ga0451576_0123040 Ga0451576_0123040_1357_2250 293
122 3300046539 Ga0495621_0026922 Ga0495621_0026922_74_955 293
123 3300050508 nmdc:mga09592_390850_c1 nmdc:mga09592_390850_c1_86_967 293
124 3300050511 nmdc:mga08y16_46514_c1 nmdc:mga08y16_46514_c1_3100_3984 293
125 3300005331 Ga0070670_100172137 Ga0070670_1001721372 294
126 3300005331 Ga0070670_100309408 Ga0070670_1003094082 294
127 3300005334 Ga0068869_100135128 Ga0068869_1001351282 294
128 3300005338 Ga0068868_100006692 Ga0068868_1000066922 294
129 3300005347 Ga0070668_100014582 Ga0070668_1000145823 294
130 3300005356 Ga0070674_100020274 Ga0070674_1000202742 294
131 3300005456 Ga0070678_100244307 Ga0070678_1002443072 294
132 3300005471 Ga0070698_100006556 Ga0070698_1000065568 294
133 3300005548 Ga0070665_100049122 Ga0070665_1000491223 294
134 3300005840 Ga0068870_10020104 Ga0068870_100201042 294
135 3300005843 Ga0068860_100069603 Ga0068860_1000696033 294
136 3300009176 Ga0105242_10018324 Ga0105242_100183243 294
137 3300009553 Ga0105249_10739119 Ga0105249_107391191 294
138 3300011119 Ga0105246_10052790 Ga0105246_100527903 294
139 3300013296 Ga0157374_10234013 Ga0157374_102340131 294
140 3300013297 Ga0157378_10401318 Ga0157378_104013182 294
141 3300013306 Ga0163162_10343152 Ga0163162_103431522 294
142 3300013308 Ga0157375_10361407 Ga0157375_103614072 294
143 3300025901 Ga0207688_10078609 Ga0207688_100786092 294
144 3300025907 Ga0207645_10002157 Ga0207645_1000215716 294
145 3300025908 Ga0207643_10005289 Ga0207643_100052892 294
146 3300025925 Ga0207650_10046118 Ga0207650_100461184 294
147 3300025933 Ga0207706_10331753 Ga0207706_103317531 294
148 3300025942 Ga0207689_10001523 Ga0207689_1000152323 294
149 3300026041 Ga0207639_10265498 Ga0207639_102654981 294
150 3300026089 Ga0207648_10009922 Ga0207648_100099229 294
151 3300026118 Ga0207675_100301401 Ga0207675_1003014011 294
152 3300026121 Ga0207683_10000737 Ga0207683_1000073711 294
153 3300028379 Ga0268266_10066246 Ga0268266_100662463 294
154 3300042876 Ga0451577_0007617 Ga0451577_0007617_2306_3208 294
155 3300044712 Ga0453684_0015052 Ga0453684_0015052_4974_5876 294
156 3300045051 Ga0451576_0104387 Ga0451576_0104387_554_1456 294
157 3300049661 Ga0501217_013920 Ga0501217_013920_617_1513 294
158 3300049665 Ga0501227_055736 Ga0501227_055736_71_967 294
159 3300049707 Ga0501234_001818 Ga0501234_001818_165_1061 294
160 3300050510 nmdc:mga06r32_388759_c1 nmdc:mga06r32_388759_c1_84_968 294
161 3300005327 Ga0070658_10216899 Ga0070658_102168992 295
162 3300005329 Ga0070683_100032942 Ga0070683_1000329422 295
163 3300005329 Ga0070683_100302005 Ga0070683_1003020052 295
164 3300005329 Ga0070683_100326121 Ga0070683_1003261212 295
165 3300005331 Ga0070670_100147243 Ga0070670_1001472431 295
166 3300005334 Ga0068869_100034178 Ga0068869_1000341782 295
167 3300005334 Ga0068869_100066972 Ga0068869_1000669722 295
168 3300005334 Ga0068869_100131975 Ga0068869_1001319752 295
169 3300005338 Ga0068868_100008325 Ga0068868_1000083254 295
170 3300005339 Ga0070660_100043524 Ga0070660_1000435243 295
171 3300005339 Ga0070660_100134429 Ga0070660_1001344291 295
172 3300005340 Ga0070689_100010707 Ga0070689_1000107075 295
173 3300005344 Ga0070661_100021491 Ga0070661_1000214911 295
174 3300005354 Ga0070675_100026919 Ga0070675_1000269194 295
175 3300005354 Ga0070675_100295839 Ga0070675_1002958392 295
176 3300005355 Ga0070671_100135164 Ga0070671_1001351643 295
177 3300005356 Ga0070674_100287290 Ga0070674_1002872901 295
178 3300005364 Ga0070673_100053371 Ga0070673_1000533713 295
179 3300005366 Ga0070659_100237583 Ga0070659_1002375832 295
180 3300005457 Ga0070662_100014388 Ga0070662_1000143885 295
181 3300005457 Ga0070662_100038721 Ga0070662_1000387211 295
182 3300005459 Ga0068867_100008783 Ga0068867_1000087834 295
183 3300005530 Ga0070679_100194181 Ga0070679_1001941811 295
184 3300005530 Ga0070679_100278805 Ga0070679_1002788051 295
185 3300005535 Ga0070684_100002508 Ga0070684_1000025085 295
186 3300005535 Ga0070684_100345141 Ga0070684_1003451411 295
187 3300005539 Ga0068853_100109690 Ga0068853_1001096903 295
188 3300005539 Ga0068853_100317438 Ga0068853_1003174381 295
189 3300005543 Ga0070672_100330829 Ga0070672_1003308291 295
190 3300005548 Ga0070665_100489594 Ga0070665_1004895941 295
191 3300005563 Ga0068855_100047898 Ga0068855_1000478982 295
192 3300005563 Ga0068855_100374296 Ga0068855_1003742962 295
193 3300005564 Ga0070664_100260684 Ga0070664_1002606842 295
194 3300005564 Ga0070664_100388785 Ga0070664_1003887852 295
195 3300005577 Ga0068857_100021002 Ga0068857_1000210023 295
196 3300005578 Ga0068854_100098406 Ga0068854_1000984063 295
197 3300005614 Ga0068856_100434612 Ga0068856_1004346121 295
198 3300005616 Ga0068852_100046447 Ga0068852_1000464472 295
199 3300005616 Ga0068852_100177193 Ga0068852_1001771932 295
200 3300005617 Ga0068859_100045704 Ga0068859_1000457044 295
201 3300005617 Ga0068859_100103293 Ga0068859_1001032934 295
202 3300005617 Ga0068859_100120487 Ga0068859_1001204872 295
203 3300005618 Ga0068864_100316870 Ga0068864_1003168702 295
204 3300005618 Ga0068864_100472061 Ga0068864_1004720611 295
205 3300005719 Ga0068861_100111829 Ga0068861_1001118291 295
206 3300005841 Ga0068863_100122149 Ga0068863_1001221491 295
207 3300005841 Ga0068863_100165401 Ga0068863_1001654012 295
208 3300005842 Ga0068858_100060883 Ga0068858_1000608833 295
209 3300005844 Ga0068862_100266008 Ga0068862_1002660082 295
210 3300006163 Ga0070715_10215582 Ga0070715_102155821 295
211 3300006358 Ga0068871_100244436 Ga0068871_1002444361 295
212 3300006881 Ga0068865_100049678 Ga0068865_1000496783 295
213 3300006881 Ga0068865_100162773 Ga0068865_1001627731 295
214 3300006931 Ga0097620_100045705 Ga0097620_1000457053 295
215 3300006931 Ga0097620_100103294 Ga0097620_1001032944 295
216 3300006931 Ga0097620_100120487 Ga0097620_1001204873 295
217 3300009011 Ga0105251_10095747 Ga0105251_100957472 295
218 3300009093 Ga0105240_10373810 Ga0105240_103738102 295
219 3300009176 Ga0105242_10046447 Ga0105242_100464472 295
220 3300009176 Ga0105242_10081917 Ga0105242_100819173 295
221 3300009176 Ga0105242_10154324 Ga0105242_101543242 295
222 3300009177 Ga0105248_10191315 Ga0105248_101913153 295
223 3300009553 Ga0105249_10045632 Ga0105249_100456322 295
224 3300011119 Ga0105246_10126484 Ga0105246_101264842 295
225 3300013100 Ga0157373_10267500 Ga0157373_102675002 295
226 3300013102 Ga0157371_10030636 Ga0157371_100306364 295
227 3300013102 Ga0157371_10102260 Ga0157371_101022601 295
228 3300013105 Ga0157369_10243556 Ga0157369_102435561 295
229 3300013296 Ga0157374_10001852 Ga0157374_100018522 295
230 3300013296 Ga0157374_10027661 Ga0157374_100276617 295
231 3300013297 Ga0157378_10159934 Ga0157378_101599341 295
232 3300013306 Ga0163162_10003191 Ga0163162_1000319110 295
233 3300013306 Ga0163162_10004465 Ga0163162_1000446511 295
234 3300013306 Ga0163162_10036395 Ga0163162_100363956 295
235 3300013306 Ga0163162_10467049 Ga0163162_104670492 295
236 3300013307 Ga0157372_10022934 Ga0157372_100229344 295
237 3300013307 Ga0157372_10056172 Ga0157372_100561725 295
238 3300013307 Ga0157372_10336222 Ga0157372_103362221 295
239 3300013307 Ga0157372_10840316 Ga0157372_108403161 295
240 3300013308 Ga0157375_10029398 Ga0157375_100293985 295
241 3300013308 Ga0157375_10048721 Ga0157375_100487213 295
242 3300013308 Ga0157375_10131394 Ga0157375_101313942 295
243 3300013308 Ga0157375_10140438 Ga0157375_101404382 295
244 3300013308 Ga0157375_10146621 Ga0157375_101466212 295
245 3300014325 Ga0163163_10000348 Ga0163163_100003488 295
246 3300014745 Ga0157377_10043687 Ga0157377_100436873 295
247 3300014745 Ga0157377_10047096 Ga0157377_100470963 295
248 3300014968 Ga0157379_10069044 Ga0157379_100690441 295
249 3300014968 Ga0157379_10081421 Ga0157379_100814212 295
250 3300014969 Ga0157376_10800017 Ga0157376_108000171 295
251 3300017792 Ga0163161_10087082 Ga0163161_100870822 295
252 3300025304 Ga0209257_1000007 Ga0209257_100000799 295
253 3300025899 Ga0207642_10195524 Ga0207642_101955241 295
254 3300025904 Ga0207647_10050122 Ga0207647_100501222 295
255 3300025907 Ga0207645_10012167 Ga0207645_100121674 295
256 3300025909 Ga0207705_10062487 Ga0207705_100624871 295
257 3300025911 Ga0207654_10107876 Ga0207654_101078763 295
258 3300025912 Ga0207707_10169494 Ga0207707_101694941 295
259 3300025913 Ga0207695_10021935 Ga0207695_100219354 295
260 3300025919 Ga0207657_10054917 Ga0207657_100549171 295
261 3300025919 Ga0207657_10262005 Ga0207657_102620052 295
262 3300025920 Ga0207649_10158974 Ga0207649_101589741 295
263 3300025920 Ga0207649_10179892 Ga0207649_101798922 295
264 3300025921 Ga0207652_10152633 Ga0207652_101526333 295
265 3300025926 Ga0207659_10013174 Ga0207659_100131742 295
266 3300025926 Ga0207659_10127105 Ga0207659_101271051 295
267 3300025926 Ga0207659_10277990 Ga0207659_102779901 295
268 3300025933 Ga0207706_10009835 Ga0207706_100098354 295
269 3300025933 Ga0207706_10175461 Ga0207706_101754613 295
270 3300025934 Ga0207686_10214120 Ga0207686_102141202 295
271 3300025936 Ga0207670_10010246 Ga0207670_100102464 295
272 3300025936 Ga0207670_10016822 Ga0207670_100168222 295
273 3300025938 Ga0207704_10077143 Ga0207704_100771432 295
274 3300025938 Ga0207704_10155549 Ga0207704_101555491 295
275 3300025940 Ga0207691_10049425 Ga0207691_100494252 295
276 3300025941 Ga0207711_10315224 Ga0207711_103152241 295
277 3300025942 Ga0207689_10011441 Ga0207689_100114416 295
278 3300025942 Ga0207689_10085760 Ga0207689_100857602 295
279 3300025942 Ga0207689_10338176 Ga0207689_103381761 295
280 3300025944 Ga0207661_10145303 Ga0207661_101453033 295
281 3300025945 Ga0207679_10003751 Ga0207679_100037517 295
282 3300025945 Ga0207679_10116678 Ga0207679_101166783 295
283 3300025949 Ga0207667_10366770 Ga0207667_103667702 295
284 3300025960 Ga0207651_10113363 Ga0207651_101133632 295
285 3300025960 Ga0207651_10547290 Ga0207651_105472901 295
286 3300026023 Ga0207677_10003862 Ga0207677_100038624 295
287 3300026041 Ga0207639_10088345 Ga0207639_100883453 295
288 3300026041 Ga0207639_10483064 Ga0207639_104830641 295
289 3300026067 Ga0207678_10043390 Ga0207678_100433903 295
290 3300026075 Ga0207708_10145566 Ga0207708_101455661 295
291 3300026088 Ga0207641_10045529 Ga0207641_100455292 295
292 3300026088 Ga0207641_10163412 Ga0207641_101634122 295
293 3300026095 Ga0207676_10001245 Ga0207676_100012452 295
294 3300026095 Ga0207676_10600327 Ga0207676_106003271 295
295 3300026116 Ga0207674_10033039 Ga0207674_100330393 295
296 3300026118 Ga0207675_100059330 Ga0207675_1000593304 295
297 3300026142 Ga0207698_10066383 Ga0207698_100663833 295
298 3300026142 Ga0207698_10108187 Ga0207698_101081873 295
299 3300028380 Ga0268265_10121467 Ga0268265_101214672 295
300 3300028381 Ga0268264_10110609 Ga0268264_101106094 295
301 3300035170 Ga0373943_0064695 Ga0373943_0064695_558_1451 295
302 3300035172 Ga0373955_0012007 Ga0373955_0012007_2989_3882 295
303 3300036401 Ga0373937_0238457 Ga0373937_0238457_371_1264 295
304 3300039437 Ga0436365_1398823 Ga0436365_1398823_26547_27440 295
305 3300041459 Ga0451800_1585672 Ga0451800_1585672_53_946 295
306 3300046517 Ga0495630_0119069 Ga0495630_0119069_876_1769 295
307 3300046680 Ga0495646_0158602 Ga0495646_0158602_295_1188 295
308 3300049661 Ga0501217_006456 Ga0501217_006456_220_1119 295
309 3300049704 Ga0501221_005785 Ga0501221_005785_887_1786 295
310 3300014326 Ga0157380_10244757 Ga0157380_102447571 296
311 3300045976 Ga0466967_0082000 Ga0466967_0082000_523_1422 296
312 3300005328 Ga0070676_10395877 Ga0070676_103958771 297
313 3300005347 Ga0070668_100244579 Ga0070668_1002445792 297
314 3300005459 Ga0068867_100055738 Ga0068867_1000557383 297
315 3300005718 Ga0068866_10063782 Ga0068866_100637823 297
316 3300005719 Ga0068861_100084173 Ga0068861_1000841732 297
317 3300005843 Ga0068860_100004702 Ga0068860_1000047025 297
318 3300005844 Ga0068862_100235029 Ga0068862_1002350292 297
319 3300006195 Ga0075366_10140667 Ga0075366_101406672 297
320 3300009093 Ga0105240_10020225 Ga0105240_1002022511 297
321 3300009176 Ga0105242_10104406 Ga0105242_101044063 297
322 3300009545 Ga0105237_10002155 Ga0105237_100021555 297
323 3300010375 Ga0105239_10002568 Ga0105239_100025689 297
324 3300013100 Ga0157373_10028080 Ga0157373_100280805 297
325 3300013306 Ga0163162_10113758 Ga0163162_101137582 297
326 3300014968 Ga0157379_10097330 Ga0157379_100973302 297
327 3300025913 Ga0207695_10015688 Ga0207695_100156882 297
328 3300025914 Ga0207671_10002836 Ga0207671_100028366 297
329 3300025942 Ga0207689_10122525 Ga0207689_101225252 297
330 3300026023 Ga0207677_10334130 Ga0207677_103341302 297
331 3300026089 Ga0207648_10073942 Ga0207648_100739424 297
332 3300026118 Ga0207675_100148459 Ga0207675_1001484592 297
333 3300028381 Ga0268264_10005567 Ga0268264_100055674 297
334 3300013296 Ga0157374_10006784 Ga0157374_100067842 298
335 3300021384 Ga0213876_10059192 Ga0213876_100591922 298
336 3300039437 Ga0436365_1597568 Ga0436365_1597568_3541_4488 298
337 3300000043 ARcpr5yngRDRAFT_c003930 ARcpr5yngRDRAFT_0039301 299

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00775

Dioxygenase_C

Dioxygenase

54

215

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8918 34 202
4ilt-assembly2.cif.gz_B structure of the dioxygenase domain of sacte_2871, a novel dioxygenase carbohydrate-binding protein fusion from the cellulolytic bacterium streptomyces sp. sirexaa-e 0.8864 34 202
3hgi-assembly1.cif.gz_A crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp 0.8491 33 202
2boy-assembly4.cif.gz_D crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp 0.8432 34 202
2xsu-assembly1.cif.gz_A-2 crystal structure of the a72g mutant of acinetobacter radioresistens catechol 1,2 dioxygenase 0.8383 33 203
ID Description Score Start End Superfamily
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8979 34 202 2.60.130.10
4iltA00 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8925 34 202 2.60.130.10
af_P86029_1_299_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8535 33 202 2.60.130.10
3hhyA02 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8479 34 202 2.60.130.10
af_Q59Z18_7_293_2.60.130.10 Mainly Beta;Sandwich;Protocatechuate 3,4-Dioxygenase, subunit A;Aromatic compound dioxygenase 0.8428 31 199 2.60.130.10
ID Description Score Start End GO Terms
AF-A0A2A4QQ87-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.9188 33 202 GO:0008199
GO:0016702
AF-A0A2G8TBZ3-F1-model_v4 Uncharacterized protein 0.9072 201 296
AF-A0A3C2D0X7-F1-model_v4 Catechol 1,2-dioxygenase 0.9068 52 296 GO:0008199
GO:0016702
AF-A0A2S9YGD8-F1-model_v4 Catechol 1,2-dioxygenase 2 (EC 1.13.11.1) 0.9059 34 200 GO:0008199
GO:0018576
AF-A0A2E7CLG0-F1-model_v4 Intradiol ring-cleavage dioxygenases domain-containing protein 0.8965 34 200 GO:0008199
GO:0016702

Feature Viewer

pLDDT pTM Quality
79.11 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map