F413108

General Info

Members Datasets Scaffolds Average Seq Length
337 182 674 182

Family's Representative Sequence

Representative Sequence 3300025914|Ga0207671_10588990|Ga0207671_105889901
Length 211
Sequence VAHLYDLLITQKNICLICDVSFLSYSTLSPKQKISLSEENLIQALRNRERIAIEALYDMYSASLNGVIVRIVVEQELAEDILQETFVKIWNSFSSYSADKGRLFTWMVNIARNLAIDKVRSKDFKNQGKNQELENNVTFIDEQRNTVYNPELLGIKEMVATLKPEQRAILDLVYFKGYTHVEAAEELGVPLGTIKTRLRMAIQQLRKHFNE

Samples

Sample ID Description Type Environment
1 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
49 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
61 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
62 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
65 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
70 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
97 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
98 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
108 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
109 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
122 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
141 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
142 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
143 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
144 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
145 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
148 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
156 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
157 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
165 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
168 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
169 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
170 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
171 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
172 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
173 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
174 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
175 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
178 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
179 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
180 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
181 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
182 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.63
Metatranscriptomes 0.89
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.31
Nodule 0
Rhizoplane 0.3
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 1.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207671_10588990 3300025914 Bacteria 886
2 JGI24740J21852_10021961 3300001979 Bacteria 2205
3 JGI24735J21928_10004207 3300002067 Bacteria 4858
4 JGI24744J21845_10003437 3300002077 Bacteria 3255
5 JGI25157J39369_1003056 3300002741 Bacteria 3625
6 JGI25164J39214_1001152 3300002772 Bacteria 7380
7 JGI25165J46597_1000658 3300003214 Bacteria 28305
8 rootH1_10023440 3300003316 Bacteria 5453
9 rootH2_10024240 3300003320 Bacteria 36961
10 rootH2_10045376 3300003320 Bacteria 1388
11 rootH1_10005386 3300003323 Bacteria 37172
12 rootH1_10301927 3300003323 Bacteria 3189
13 Ga0058862_12654724 3300004803 Bacteria 4128
14 Ga0065714_10003429 3300005288 Bacteria 8285
15 Ga0065714_10032952 3300005288 Bacteria 1090
16 Ga0065714_10096723 3300005288 Bacteria 1754
17 Ga0070658_10055797 3300005327 Bacteria 3210
18 Ga0070658_10099792 3300005327 Bacteria 2399
19 Ga0070658_11082748 3300005327 Bacteria 697
20 Ga0070676_10000133 3300005328 Bacteria 28281
21 Ga0070683_100284082 3300005329 Bacteria 1574
22 Ga0070680_100040878 3300005336 Bacteria 3758
23 Ga0070680_100124006 3300005336 Bacteria 2158
24 Ga0068868_100034639 3300005338 Bacteria 3899
25 Ga0070660_100027447 3300005339 Bacteria 4249
26 Ga0070660_100160772 3300005339 Bacteria 1810
27 Ga0070660_100385526 3300005339 Bacteria 1157
28 Ga0070691_10340629 3300005341 Bacteria 830
29 Ga0070675_100240036 3300005354 Bacteria 1583
30 Ga0070671_100050375 3300005355 Bacteria 3463
31 Ga0070674_100503277 3300005356 Bacteria 1009
32 Ga0070659_100000094 3300005366 Bacteria 66823
33 Ga0070659_100040004 3300005366 Bacteria 3662
34 Ga0070663_100055715 3300005455 Bacteria 2831
35 Ga0070681_10019029 3300005458 Bacteria 6873
36 Ga0068867_100000624 3300005459 Bacteria 23370
37 Ga0070679_100001886 3300005530 Bacteria 18840
38 Ga0070679_100022268 3300005530 Bacteria 6192
39 Ga0070679_100074690 3300005530 Bacteria 3380
40 Ga0070679_100156247 3300005530 Bacteria 2256
41 Ga0070679_100578020 3300005530 Bacteria 1067
42 Ga0070684_100012601 3300005535 Bacteria 6782
43 Ga0068853_100045019 3300005539 Bacteria 3779
44 Ga0068853_100152930 3300005539 Bacteria 2078
45 Ga0068853_100440919 3300005539 Bacteria 1224
46 Ga0068853_100900556 3300005539 Bacteria 850
47 Ga0068855_100000201 3300005563 Bacteria 76965
48 Ga0068855_100036838 3300005563 Bacteria 5819
49 Ga0068855_100068031 3300005563 Bacteria 4148
50 Ga0068855_100365843 3300005563 Unclassified 1586
51 Ga0068855_100463754 3300005563 Bacteria 1381
52 Ga0068857_100048407 3300005577 Bacteria 3774
53 Ga0068856_100080064 3300005614 Bacteria 3240
54 Ga0068852_100004529 3300005616 Bacteria 9834
55 Ga0068852_100079472 3300005616 Bacteria 2905
56 Ga0068866_10039370 3300005718 Bacteria 2334
57 Ga0068858_100799466 3300005842 Bacteria 920
58 Ga0075366_10000492 3300006195 Bacteria 18283
59 Ga0075366_10056203 3300006195 Bacteria 2338
60 Ga0097621_100000205 3300006237 Bacteria 38617
61 Ga0068871_100000162 3300006358 Bacteria 44419
62 Ga0068871_100927104 3300006358 Bacteria 808
63 Ga0068865_100000075 3300006881 Bacteria 51751
64 Ga0105240_10030257 3300009093 Bacteria 7038
65 Ga0105240_10120233 3300009093 Bacteria 3163
66 Ga0105240_10125233 3300009093 Bacteria 3089
67 Ga0105240_10304589 3300009093 Bacteria 1822
68 Ga0105240_11354696 3300009093 Bacteria 749
69 Ga0105243_10440335 3300009148 Bacteria 1220
70 Ga0105241_10003766 3300009174 Bacteria 11245
71 Ga0105241_10004708 3300009174 Bacteria 10067
72 Ga0105241_10092952 3300009174 Bacteria 2383
73 Ga0105241_10612465 3300009174 Bacteria 985
74 Ga0105242_10146738 3300009176 Bacteria 2053
75 Ga0105237_10000082 3300009545 Bacteria 127340
76 Ga0105237_10000620 3300009545 Bacteria 49579
77 Ga0105237_10000808 3300009545 Bacteria 42764
78 Ga0105237_10049245 3300009545 Bacteria 4235
79 Ga0105237_10094491 3300009545 Bacteria 2979
80 Ga0105237_10112772 3300009545 Bacteria 2711
81 Ga0105238_10021252 3300009551 Bacteria 6613
82 Ga0105238_10046747 3300009551 Bacteria 4365
83 Ga0105238_10316938 3300009551 Bacteria 1545
84 Ga0105238_10475055 3300009551 Bacteria 1249
85 Ga0105238_10811765 3300009551 Bacteria 951
86 Ga0105239_10000008 3300010375 Bacteria 376925
87 Ga0105239_10000045 3300010375 Bacteria 186314
88 Ga0105239_10002348 3300010375 Bacteria 24115
89 Ga0105239_10007945 3300010375 Bacteria 12126
90 Ga0105239_10009159 3300010375 Bacteria 11197
91 Ga0105239_10010933 3300010375 Bacteria 10139
92 Ga0105239_10275059 3300010375 Bacteria 1895
93 Ga0105239_11590210 3300010375 Bacteria 756
94 Ga0105246_10034972 3300011119 Bacteria 3353
95 Ga0157373_10000091 3300013100 Bacteria 75012
96 Ga0157373_10005897 3300013100 Bacteria 9166
97 Ga0157371_10000155 3300013102 Bacteria 100230
98 Ga0157371_10005700 3300013102 Bacteria 10444
99 Ga0157371_10007638 3300013102 Bacteria 8718
100 Ga0157370_10005095 3300013104 Bacteria 14823
101 Ga0157370_10070858 3300013104 Bacteria 3290
102 Ga0157370_10760507 3300013104 Bacteria 883
103 Ga0157369_10001051 3300013105 Bacteria 34842
104 Ga0157369_10194471 3300013105 Bacteria 2130
105 Ga0157374_10001433 3300013296 Bacteria 20152
106 Ga0157374_10366560 3300013296 Bacteria 1433
107 Ga0157374_10539613 3300013296 Bacteria 1173
108 Ga0157374_10609394 3300013296 Bacteria 1102
109 Ga0157374_10921823 3300013296 Bacteria 892
110 Ga0157374_12003345 3300013296 Bacteria 605
111 Ga0157378_10023282 3300013297 Bacteria 5451
112 Ga0163162_10000041 3300013306 Bacteria 132375
113 Ga0163162_10005549 3300013306 Bacteria 12198
114 Ga0163162_10092061 3300013306 Bacteria 3115
115 Ga0163162_10466438 3300013306 Bacteria 1394
116 Ga0163162_10526349 3300013306 Bacteria 1311
117 Ga0157372_10000009 3300013307 Bacteria 302051
118 Ga0157372_10004134 3300013307 Bacteria 15542
119 Ga0157372_10007451 3300013307 Bacteria 11640
120 Ga0157372_10368791 3300013307 Bacteria 1673
121 Ga0157372_10636867 3300013307 Bacteria 1242
122 Ga0157375_10025141 3300013308 Bacteria 5525
123 Ga0157375_10163360 3300013308 Bacteria 2370
124 Ga0157375_10326772 3300013308 Unclassified 1698
125 Ga0157375_11689117 3300013308 Bacteria 750
126 Ga0157376_10006003 3300014969 Bacteria 8535
127 Ga0157376_10418424 3300014969 Bacteria 1300
128 Ga0163161_10010774 3300017792 Bacteria 6335
129 Ga0206351_10688084 3300020077 Bacteria 1740
130 Ga0213872_10036408 3300021361 Bacteria 2249
131 Ga0213876_10294824 3300021384 Bacteria 862
132 Ga0224712_10041272 3300022467 Bacteria 1741
133 Ga0207427_100109 3300025231 Bacteria 116061
134 Ga0209437_100096 3300025233 Bacteria 233558
135 Ga0209258_115045 3300025242 Bacteria 889
136 Ga0209026_1000225 3300025250 Bacteria 77234
137 Ga0209026_1006773 3300025250 Bacteria 2728
138 Ga0209148_1031632 3300025254 Bacteria 784
139 Ga0209129_1006755 3300025258 Bacteria 3611
140 Ga0209233_1000029 3300025261 Bacteria 641642
141 Ga0209233_1001254 3300025261 Bacteria 10199
142 Ga0207642_10142949 3300025899 Bacteria 1264
143 Ga0207647_10000135 3300025904 Bacteria 58247
144 Ga0207645_10000014 3300025907 Bacteria 117512
145 Ga0207705_10000111 3300025909 Bacteria 92842
146 Ga0207705_10069976 3300025909 Bacteria 2542
147 Ga0207705_10119063 3300025909 Bacteria 1958
148 Ga0207705_10273089 3300025909 Bacteria 1293
149 Ga0207654_10010436 3300025911 Bacteria 4730
150 Ga0207654_10011946 3300025911 Bacteria 4440
151 Ga0207654_10055815 3300025911 Bacteria 2288
152 Ga0207695_10032001 3300025913 Bacteria 5761
153 Ga0207695_10226253 3300025913 Bacteria 1777
154 Ga0207695_10320427 3300025913 Bacteria 1440
155 Ga0207671_10000899 3300025914 Bacteria 37624
156 Ga0207671_10001286 3300025914 Bacteria 29511
157 Ga0207671_10004505 3300025914 Bacteria 13262
158 Ga0207671_10024713 3300025914 Bacteria 4512
159 Ga0207671_10033180 3300025914 Bacteria 3841
160 Ga0207660_10086791 3300025917 Bacteria 2311
161 Ga0207657_10060211 3300025919 Bacteria 3259
162 Ga0207657_10102763 3300025919 Bacteria 2370
163 Ga0207657_10137860 3300025919 Bacteria 1995
164 Ga0207652_10000027 3300025921 Bacteria 151000
165 Ga0207652_10023627 3300025921 Bacteria 5094
166 Ga0207652_10064392 3300025921 Bacteria 3172
167 Ga0207652_10195226 3300025921 Bacteria 1821
168 Ga0207652_11028899 3300025921 Bacteria 723
169 Ga0207694_10049479 3300025924 Bacteria 3254
170 Ga0207694_10295951 3300025924 Bacteria 1332
171 Ga0207694_10360414 3300025924 Bacteria 1205
172 Ga0207650_10177967 3300025925 Bacteria 1694
173 Ga0207644_10038632 3300025931 Bacteria 3364
174 Ga0207690_10000280 3300025932 Bacteria 36230
175 Ga0207690_10025756 3300025932 Bacteria 3697
176 Ga0207690_10079832 3300025932 Bacteria 2281
177 Ga0207690_10739338 3300025932 Bacteria 810
178 Ga0207686_10275774 3300025934 Bacteria 1239
179 Ga0207704_10000118 3300025938 Bacteria 43936
180 Ga0207667_10000236 3300025949 Bacteria 77019
181 Ga0207667_10007060 3300025949 Bacteria 13571
182 Ga0207667_10028187 3300025949 Bacteria 6101
183 Ga0207667_10075926 3300025949 Bacteria 3488
184 Ga0207667_10081319 3300025949 Bacteria 3356
185 Ga0207640_10027769 3300025981 Bacteria 3452
186 Ga0207677_10022433 3300026023 Bacteria 3880
187 Ga0207703_10438578 3300026035 Bacteria 1218
188 Ga0207639_10001022 3300026041 Bacteria 19034
189 Ga0207639_10039702 3300026041 Bacteria 3508
190 Ga0207639_10056368 3300026041 Bacteria 3012
191 Ga0207639_10178193 3300026041 Bacteria 1806
192 Ga0207678_10075235 3300026067 Bacteria 2893
193 Ga0207702_10000088 3300026078 Bacteria 105505
194 Ga0207702_10071469 3300026078 Bacteria 2988
195 Ga0207702_10354524 3300026078 Bacteria 1405
196 Ga0207702_10564101 3300026078 Bacteria 1114
197 Ga0207648_10000963 3300026089 Bacteria 32564
198 Ga0207674_10061815 3300026116 Bacteria 3784
199 Ga0207674_10389818 3300026116 Bacteria 1346
200 Ga0207683_10087886 3300026121 Bacteria 2764
201 Ga0207683_11257666 3300026121 Bacteria 686
202 Ga0207698_10000733 3300026142 Bacteria 19000
203 Ga0207698_11137641 3300026142 Bacteria 794
204 Ga0265318_10000906 3300028577 Bacteria 19321
205 Ga0307517_10000553 3300028786 Bacteria 63892
206 Ga0307515_10000643 3300028794 Bacteria 80674
207 Ga0265338_10015163 3300028800 Bacteria 8498
208 Ga0265332_10000723 3300031238 Bacteria 20837
209 Ga0265320_10003791 3300031240 Bacteria 10038
210 Ga0265325_10109918 3300031241 Unclassified 1341
211 Ga0265339_10008136 3300031249 Bacteria 6694
212 Ga0265331_10001511 3300031250 Bacteria 17162
213 Ga0265327_10307334 3300031251 Bacteria 697
214 Ga0265316_10009527 3300031344 Bacteria 8940
215 Ga0265313_10069867 3300031595 Bacteria 1620
216 Ga0265314_10004138 3300031711 Bacteria 13656
217 Ga0265342_10001435 3300031712 Bacteria 22217
218 Ga0307414_10150764 3300032004 Unclassified 1834
219 Ga0307415_100389001 3300032126 Bacteria 1187
220 Ga0307507_10014221 3300033179 Bacteria 9519
221 Ga0307510_10000172 3300033180 Bacteria 54812
222 Ga0373941_0144527 3300035115 Bacteria 867
223 Ga0395899_0000327 3300037312 Bacteria 60343
224 Ga0395899_0008895 3300037312 Bacteria 7732
225 Ga0395899_0011280 3300037312 Bacteria 6843
226 Ga0395899_0018626 3300037312 Bacteria 5276
227 Ga0395899_0551976 3300037312 Bacteria 740
228 Ga0395900_0000413 3300037418 Bacteria 61555
229 Ga0395900_0000609 3300037418 Bacteria 48753
230 Ga0395900_0014207 3300037418 Bacteria 8129
231 Ga0395900_0040294 3300037418 Bacteria 4813
232 Ga0395900_0067500 3300037418 Bacteria 3674
233 Ga0395900_1905064 3300037418 Bacteria 505
234 Ga0395898_0002918 3300037466 Bacteria 19458
235 Ga0395898_0053540 3300037466 Bacteria 3941
236 Ga0395898_0497951 3300037466 Bacteria 1159
237 Ga0395905_0000188 3300037471 Bacteria 98070
238 Ga0395905_0007047 3300037471 Bacteria 11236
239 Ga0395901_0002175 3300038443 Bacteria 20011
240 Ga0395901_0008274 3300038443 Bacteria 10508
241 Ga0395901_0017109 3300038443 Bacteria 7392
242 Ga0436365_1414097 3300039437 Bacteria 856
243 Ga0436361_1159520 3300039447 Bacteria 26518
244 Ga0451804_0823357 3300041463 Bacteria 1113
245 Ga0451837_1479582 3300041494 Bacteria 746
246 Ga0451841_0422431 3300041498 Bacteria 728
247 Ga0466969_0025898 3300044656 Bacteria 3012
248 Ga0466966_0017247 3300044684 Bacteria 4772
249 Ga0466963_0492548 3300044694 Bacteria 865
250 Ga0453684_1307166 3300044712 Bacteria 756
251 Ga0466971_0214612 3300044719 Bacteria 911
252 Ga0466959_0088928 3300045049 Bacteria 2220
253 Ga0466959_0217163 3300045049 Bacteria 1327
254 Ga0466958_0124858 3300045836 Bacteria 1613
255 Ga0495638_0068733 3300046460 Bacteria 2172
256 Ga0495638_0135025 3300046460 Bacteria 1446
257 Ga0495651_0123918 3300046462 Bacteria 1895
258 Ga0495651_0518372 3300046462 Bacteria 761
259 Ga0495650_0000225 3300046471 Bacteria 117898
260 Ga0495585_0000074 3300046492 Bacteria 102651
261 Ga0495585_0010616 3300046492 Bacteria 5474
262 Ga0495583_0022835 3300046506 Bacteria 3181
263 Ga0495606_0000074 3300046507 Bacteria 170848
264 Ga0495606_0027098 3300046507 Bacteria 4069
265 Ga0495606_0028081 3300046507 Bacteria 3975
266 Ga0495606_0033701 3300046507 Bacteria 3529
267 Ga0495606_0113640 3300046507 Bacteria 1630
268 Ga0495610_0022856 3300046512 Bacteria 3410
269 Ga0495616_0000806 3300046513 Bacteria 22928
270 Ga0495616_0022069 3300046513 Bacteria 3440
271 Ga0495631_0003005 3300046518 Bacteria 9331
272 Ga0495632_0170004 3300046519 Bacteria 1002
273 Ga0495637_0112602 3300046520 Bacteria 1053
274 Ga0495644_0000790 3300046523 Bacteria 13026
275 Ga0495648_0000818 3300046524 Bacteria 32866
276 Ga0495642_0291654 3300046528 Bacteria 714
277 Ga0495652_0049063 3300046529 Bacteria 3615
278 Ga0495652_0088934 3300046529 Bacteria 2530
279 Ga0495652_0130634 3300046529 Bacteria 1989
280 Ga0495654_0034723 3300046530 Bacteria 2543
281 Ga0495609_0002238 3300046538 Bacteria 12091
282 Ga0495622_0019977 3300046557 Bacteria 3118
283 Ga0495633_0055062 3300046558 Bacteria 1870
284 Ga0495668_0000122 3300046616 Bacteria 115217
285 Ga0495668_0378133 3300046616 Unclassified 778
286 Ga0495668_0630676 3300046616 Unclassified 592
287 Ga0495625_0000067 3300046660 Bacteria 171483
288 Ga0495625_0000486 3300046660 Bacteria 59478
289 Ga0495625_0007386 3300046660 Bacteria 9575
290 Ga0495625_0030611 3300046660 Bacteria 4013
291 Ga0495625_0042569 3300046660 Bacteria 3299
292 Ga0495625_0059540 3300046660 Bacteria 2709
293 Ga0495625_0133646 3300046660 Bacteria 1679
294 Ga0495661_0022119 3300046665 Bacteria 4139
295 Ga0495661_0147579 3300046665 Bacteria 1273
296 Ga0495661_0175656 3300046665 Bacteria 1138
297 Ga0495671_0420272 3300046692 Bacteria 639
298 Ga0495649_0000054 3300046694 Bacteria 107048
299 Ga0495649_0058541 3300046694 Bacteria 2076
300 Ga0495589_0138569 3300046794 Bacteria 1166
301 Ga0495660_0002682 3300046810 Bacteria 11256
302 Ga0495683_0070287 3300047323 Bacteria 1719
303 Ga0495683_0150638 3300047323 Bacteria 1083
304 Ga0495687_001083 3300047443 Bacteria 26756
305 Ga0495687_002879 3300047443 Bacteria 13149
306 Ga0495687_034452 3300047443 Bacteria 2288
307 Ga0495677_0058806 3300047445 Bacteria 1422
308 Ga0495685_062819 3300047447 Bacteria 1250
309 Ga0495673_0078551 3300047469 Bacteria 1371
310 Ga0495673_0207157 3300047469 Bacteria 731
311 Ga0495686_0001571 3300047472 Bacteria 24245
312 Ga0495686_0004631 3300047472 Bacteria 11183
313 Ga0495686_0131214 3300047472 Bacteria 1485
314 Ga0495614_0019667 3300048089 Bacteria 2922
315 Ga0495678_008557 3300049459 Bacteria 5149
316 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
317 nmdc:mga0k408_230_c2 3300050493 Bacteria 23722
318 nmdc:mga0k408_55035_c1 3300050493 Bacteria 2306
319 Ga0500635_0000482 3300053080 Bacteria 11190
320 Ga0500635_0016957 3300053080 Bacteria 2174
321 Ga0500647_0096691 3300053091 Bacteria 1412
322 Ga0500569_066513 3300053109 Bacteria 1125
323 Ga0500608_031437 3300053122 Bacteria 2519
324 Ga0500608_034296 3300053122 Bacteria 2417
325 Ga0500618_000218 3300053125 Bacteria 45135
326 Ga0500642_0104303 3300053130 Bacteria 1321
327 Ga0500561_0001312 3300053137 Bacteria 4041
328 Ga0500579_144146 3300053143 Bacteria 1064
329 Ga0500619_069878 3300053154 Bacteria 1167
330 Ga0500622_0000173 3300053156 Bacteria 69414
331 Ga0500622_0047249 3300053156 Bacteria 2224
332 Ga0500624_000813 3300053157 Bacteria 7221
333 2839992483 2839989709 Bacteria 3773432
334 2852625712 2852623160 Bacteria 4376875
335 2884935763 2884933994 Bacteria 4535041
336 2919440167 2919437846 Bacteria 6199444
337 2977235567 2977232053 Bacteria 5485925
338 Ga0207671_10588990
339 JGI24740J21852_10021961
340 JGI24735J21928_10004207
341 JGI24744J21845_10003437
342 JGI25157J39369_1003056
343 JGI25164J39214_1001152
344 JGI25165J46597_1000658
345 rootH1_10023440
346 rootH2_10024240
347 rootH2_10045376
348 rootH1_10005386
349 rootH1_10301927
350 Ga0058862_12654724
351 Ga0065714_10003429
352 Ga0065714_10032952
353 Ga0065714_10096723
354 Ga0070658_10055797
355 Ga0070658_10099792
356 Ga0070658_11082748
357 Ga0070676_10000133
358 Ga0070683_100284082
359 Ga0070680_100040878
360 Ga0070680_100124006
361 Ga0068868_100034639
362 Ga0070660_100027447
363 Ga0070660_100160772
364 Ga0070660_100385526
365 Ga0070691_10340629
366 Ga0070675_100240036
367 Ga0070671_100050375
368 Ga0070674_100503277
369 Ga0070659_100000094
370 Ga0070659_100040004
371 Ga0070663_100055715
372 Ga0070681_10019029
373 Ga0068867_100000624
374 Ga0070679_100001886
375 Ga0070679_100022268
376 Ga0070679_100074690
377 Ga0070679_100156247
378 Ga0070679_100578020
379 Ga0070684_100012601
380 Ga0068853_100045019
381 Ga0068853_100152930
382 Ga0068853_100440919
383 Ga0068853_100900556
384 Ga0068855_100000201
385 Ga0068855_100036838
386 Ga0068855_100068031
387 Ga0068855_100365843
388 Ga0068855_100463754
389 Ga0068857_100048407
390 Ga0068856_100080064
391 Ga0068852_100004529
392 Ga0068852_100079472
393 Ga0068866_10039370
394 Ga0068858_100799466
395 Ga0075366_10000492
396 Ga0075366_10056203
397 Ga0097621_100000205
398 Ga0068871_100000162
399 Ga0068871_100927104
400 Ga0068865_100000075
401 Ga0105240_10030257
402 Ga0105240_10120233
403 Ga0105240_10125233
404 Ga0105240_10304589
405 Ga0105240_11354696
406 Ga0105243_10440335
407 Ga0105241_10003766
408 Ga0105241_10004708
409 Ga0105241_10092952
410 Ga0105241_10612465
411 Ga0105242_10146738
412 Ga0105237_10000082
413 Ga0105237_10000620
414 Ga0105237_10000808
415 Ga0105237_10049245
416 Ga0105237_10094491
417 Ga0105237_10112772
418 Ga0105238_10021252
419 Ga0105238_10046747
420 Ga0105238_10316938
421 Ga0105238_10475055
422 Ga0105238_10811765
423 Ga0105239_10000008
424 Ga0105239_10000045
425 Ga0105239_10002348
426 Ga0105239_10007945
427 Ga0105239_10009159
428 Ga0105239_10010933
429 Ga0105239_10275059
430 Ga0105239_11590210
431 Ga0105246_10034972
432 Ga0157373_10000091
433 Ga0157373_10005897
434 Ga0157371_10000155
435 Ga0157371_10005700
436 Ga0157371_10007638
437 Ga0157370_10005095
438 Ga0157370_10070858
439 Ga0157370_10760507
440 Ga0157369_10001051
441 Ga0157369_10194471
442 Ga0157374_10001433
443 Ga0157374_10366560
444 Ga0157374_10539613
445 Ga0157374_10609394
446 Ga0157374_10921823
447 Ga0157374_12003345
448 Ga0157378_10023282
449 Ga0163162_10000041
450 Ga0163162_10005549
451 Ga0163162_10092061
452 Ga0163162_10466438
453 Ga0163162_10526349
454 Ga0157372_10000009
455 Ga0157372_10004134
456 Ga0157372_10007451
457 Ga0157372_10368791
458 Ga0157372_10636867
459 Ga0157375_10025141
460 Ga0157375_10163360
461 Ga0157375_10326772
462 Ga0157375_11689117
463 Ga0157376_10006003
464 Ga0157376_10418424
465 Ga0163161_10010774
466 Ga0206351_10688084
467 Ga0213872_10036408
468 Ga0213876_10294824
469 Ga0224712_10041272
470 Ga0207427_100109
471 Ga0209437_100096
472 Ga0209258_115045
473 Ga0209026_1000225
474 Ga0209026_1006773
475 Ga0209148_1031632
476 Ga0209129_1006755
477 Ga0209233_1000029
478 Ga0209233_1001254
479 Ga0207642_10142949
480 Ga0207647_10000135
481 Ga0207645_10000014
482 Ga0207705_10000111
483 Ga0207705_10069976
484 Ga0207705_10119063
485 Ga0207705_10273089
486 Ga0207654_10010436
487 Ga0207654_10011946
488 Ga0207654_10055815
489 Ga0207695_10032001
490 Ga0207695_10226253
491 Ga0207695_10320427
492 Ga0207671_10000899
493 Ga0207671_10001286
494 Ga0207671_10004505
495 Ga0207671_10024713
496 Ga0207671_10033180
497 Ga0207660_10086791
498 Ga0207657_10060211
499 Ga0207657_10102763
500 Ga0207657_10137860
501 Ga0207652_10000027
502 Ga0207652_10023627
503 Ga0207652_10064392
504 Ga0207652_10195226
505 Ga0207652_11028899
506 Ga0207694_10049479
507 Ga0207694_10295951
508 Ga0207694_10360414
509 Ga0207650_10177967
510 Ga0207644_10038632
511 Ga0207690_10000280
512 Ga0207690_10025756
513 Ga0207690_10079832
514 Ga0207690_10739338
515 Ga0207686_10275774
516 Ga0207704_10000118
517 Ga0207667_10000236
518 Ga0207667_10007060
519 Ga0207667_10028187
520 Ga0207667_10075926
521 Ga0207667_10081319
522 Ga0207640_10027769
523 Ga0207677_10022433
524 Ga0207703_10438578
525 Ga0207639_10001022
526 Ga0207639_10039702
527 Ga0207639_10056368
528 Ga0207639_10178193
529 Ga0207678_10075235
530 Ga0207702_10000088
531 Ga0207702_10071469
532 Ga0207702_10354524
533 Ga0207702_10564101
534 Ga0207648_10000963
535 Ga0207674_10061815
536 Ga0207674_10389818
537 Ga0207683_10087886
538 Ga0207683_11257666
539 Ga0207698_10000733
540 Ga0207698_11137641
541 Ga0265318_10000906
542 Ga0307517_10000553
543 Ga0307515_10000643
544 Ga0265338_10015163
545 Ga0265332_10000723
546 Ga0265320_10003791
547 Ga0265325_10109918
548 Ga0265339_10008136
549 Ga0265331_10001511
550 Ga0265327_10307334
551 Ga0265316_10009527
552 Ga0265313_10069867
553 Ga0265314_10004138
554 Ga0265342_10001435
555 Ga0307414_10150764
556 Ga0307415_100389001
557 Ga0307507_10014221
558 Ga0307510_10000172
559 Ga0373941_0144527
560 Ga0395899_0000327
561 Ga0395899_0008895
562 Ga0395899_0011280
563 Ga0395899_0018626
564 Ga0395899_0551976
565 Ga0395900_0000413
566 Ga0395900_0000609
567 Ga0395900_0014207
568 Ga0395900_0040294
569 Ga0395900_0067500
570 Ga0395900_1905064
571 Ga0395898_0002918
572 Ga0395898_0053540
573 Ga0395898_0497951
574 Ga0395905_0000188
575 Ga0395905_0007047
576 Ga0395901_0002175
577 Ga0395901_0008274
578 Ga0395901_0017109
579 Ga0436365_1414097
580 Ga0436361_1159520
581 Ga0451804_0823357
582 Ga0451837_1479582
583 Ga0451841_0422431
584 Ga0466969_0025898
585 Ga0466966_0017247
586 Ga0466963_0492548
587 Ga0453684_1307166
588 Ga0466971_0214612
589 Ga0466959_0088928
590 Ga0466959_0217163
591 Ga0466958_0124858
592 Ga0495638_0068733
593 Ga0495638_0135025
594 Ga0495651_0123918
595 Ga0495651_0518372
596 Ga0495650_0000225
597 Ga0495585_0000074
598 Ga0495585_0010616
599 Ga0495583_0022835
600 Ga0495606_0000074
601 Ga0495606_0027098
602 Ga0495606_0028081
603 Ga0495606_0033701
604 Ga0495606_0113640
605 Ga0495610_0022856
606 Ga0495616_0000806
607 Ga0495616_0022069
608 Ga0495631_0003005
609 Ga0495632_0170004
610 Ga0495637_0112602
611 Ga0495644_0000790
612 Ga0495648_0000818
613 Ga0495642_0291654
614 Ga0495652_0049063
615 Ga0495652_0088934
616 Ga0495652_0130634
617 Ga0495654_0034723
618 Ga0495609_0002238
619 Ga0495622_0019977
620 Ga0495633_0055062
621 Ga0495668_0000122
622 Ga0495668_0378133
623 Ga0495668_0630676
624 Ga0495625_0000067
625 Ga0495625_0000486
626 Ga0495625_0007386
627 Ga0495625_0030611
628 Ga0495625_0042569
629 Ga0495625_0059540
630 Ga0495625_0133646
631 Ga0495661_0022119
632 Ga0495661_0147579
633 Ga0495661_0175656
634 Ga0495671_0420272
635 Ga0495649_0000054
636 Ga0495649_0058541
637 Ga0495589_0138569
638 Ga0495660_0002682
639 Ga0495683_0070287
640 Ga0495683_0150638
641 Ga0495687_001083
642 Ga0495687_002879
643 Ga0495687_034452
644 Ga0495677_0058806
645 Ga0495685_062819
646 Ga0495673_0078551
647 Ga0495673_0207157
648 Ga0495686_0001571
649 Ga0495686_0004631
650 Ga0495686_0131214
651 Ga0495614_0019667
652 Ga0495678_008557
653 nmdc:mga0k408_22_c2
654 nmdc:mga0k408_230_c2
655 nmdc:mga0k408_55035_c1
656 Ga0500635_0000482
657 Ga0500635_0016957
658 Ga0500647_0096691
659 Ga0500569_066513
660 Ga0500608_031437
661 Ga0500608_034296
662 Ga0500618_000218
663 Ga0500642_0104303
664 Ga0500561_0001312
665 Ga0500579_144146
666 Ga0500619_069878
667 Ga0500622_0000173
668 Ga0500622_0047249
669 Ga0500624_000813
670 2839992483
671 2852625712
672 2884935763
673 2919440167
674 2977235567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

158

207

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

56

125

0.95

PF08281

Sigma70_r4_2

Sigma-70, region 4

152

205

0.95

PF07638

Sigma70_ECF

ECF sigma factor

32

211

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eo2-assembly1.cif.gz_A conformational dynamism for dna interaction in salmonella typhimurium rcsb response regulator. s207c crossed 0.9699 134 177
7vim-assembly1.cif.gz_B-2 the c-terminal dna binding domain of esrb from edwardsiella piscicida 0.9693 134 180
1fse-assembly2.cif.gz_C crystal structure of the bacillus subtilis regulatory protein gere 0.9641 134 177
1fse-assembly1.cif.gz_A crystal structure of the bacillus subtilis regulatory protein gere 0.9618 134 177
8a5s-assembly1.cif.gz_AAA crystal structure of light-activated dna-binding protein el222 from erythrobacter litoralis crystallized in dark, measured illuminated. 0.9616 129 178
ID Description Score Start End Superfamily
1or7A01 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9671 11 91 1.10.1740.10
3kloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9666 130 173 1.10.10.10
1fseC00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9641 134 177 1.10.10.10
af_P9WGM5_9_215_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9624 133 176 3.40.50.2300
3p7nB02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9612 129 178 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A4V1SQL6-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.887 1 120 GO:0006352
GO:0016987
AF-A0A4V1SQL6-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8526 1 120 GO:0006352
GO:0016987
AF-A0A4V1T2F8-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.791 1 135 GO:0006352
GO:0016987
AF-A0A4V1T2F8-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.7686 1 135 GO:0006352
GO:0016987
AF-A0A136PFY5-F1-model_v4 deleted 0.5943 1 151

Map