F413113
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 193 | 674 | 457 |
Family's Representative Sequence
| Representative Sequence | 3300025949|Ga0207667_10025309|Ga0207667_100253094 |
| Length | 523 |
| Sequence | LVGCLKLMNDVLVGASKACKDTSAIIEQTKVTALILLRQKILLHIILLLSCQKYTSMFKASFKYFLAGCFLSLSFIRSNAQQKVLTMKDAEQVALSNYASIKAKASQLNASKAYLTESKAEYLPDLNFSAQQDYGTVNSQFGPSYGYKGLGVSSSGPALAKQNWNAGFGALYLANVNWDIFAFGRAVEKVKVQQTAVNRDETDLEQEQFQHQVRVAATYLNLLAAQQLAKAQQDNLDRTIELQRVVVARVKNGLNAGVDSSQANAEVSNARIALTNAQQTVLDQSNQLAQYMGLPHQTFTLDSIFVKKAPNNANARPAVGANDHPILKYFRNRIGVSDEEAKYLNTFSYPTFTLFGVYQGKGSGFGSAYVLDQSAYTSGYGSGVDPTRFNYLLGIGVTWDFTGIFRVRNLVKAQKFTSEQYRDEYELVSQQLHDQASLAETRIASALKNYNEVPVEVKAASDAYLQKLTLYKNGLANIVDLTQALYTLNRAEVDKDIVYNNVWQAVLYKAAATGDFGIFINNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 7 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 8 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 14 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 56 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 58 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 59 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 86 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 130 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 131 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 132 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 134 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 142 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 166 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 167 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 168 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 169 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 172 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 173 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 174 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 175 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 176 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 177 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 178 | 2582581278 | Chryseobacterium sp. CF365 | Isolate | Rhizosphere |
| 179 | 2585428045 | Chryseobacterium sp. OV705 | Isolate | Rhizosphere |
| 180 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 181 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 182 | 2588254255 | Chryseobacterium sp. YR221 | Isolate | Rhizosphere |
| 183 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 184 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 185 | 2751185877 | Chryseobacterium artocarpi UTM-3 | Isolate | Rhizosphere |
| 186 | 2765235839 | Chryseobacterium indologenes AA5 | Isolate | Unclassified |
| 187 | 2889290771 | Chryseobacterium sp. PvR013 | Isolate | Rhizosphere |
| 188 | 2919399522 | Chryseobacterium sp. 2987 | Isolate | Unclassified |
| 189 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 190 | 2919692658 | Algoriphagus sp. 4150 | Isolate | Rhizosphere |
| 191 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 192 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 193 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.96 |
| Metatranscriptomes | 0 |
| Isolates | 5.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.82 |
| Nodule | 0 |
| Rhizoplane | 0.89 |
| Rhizosphere | 86.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207667_10025309 | 3300025949 | Bacteria | 6498 |
| 2 | JGI24740J21852_10008396 | 3300001979 | Bacteria | 4116 |
| 3 | JGI24739J22299_10000332 | 3300001989 | Bacteria | 16033 |
| 4 | JGI24739J22299_10034519 | 3300001989 | Bacteria | 1723 |
| 5 | JGI24737J22298_10000014 | 3300001990 | Bacteria | 50004 |
| 6 | JGI24735J21928_10000008 | 3300002067 | Bacteria | 319819 |
| 7 | JGI25162J39368_1001777 | 3300002737 | Bacteria | 10221 |
| 8 | JGI25157J39369_1003494 | 3300002741 | Bacteria | 3185 |
| 9 | JGI25165J46597_1000461 | 3300003214 | Bacteria | 40249 |
| 10 | rootH1_10000753 | 3300003316 | Bacteria | 32397 |
| 11 | rootH1_10103452 | 3300003316 | Bacteria | 3793 |
| 12 | rootH2_10001801 | 3300003320 | Bacteria | 92828 |
| 13 | rootH2_10174654 | 3300003320 | Unclassified | 3299 |
| 14 | rootH2_10188151 | 3300003320 | Bacteria | 4909 |
| 15 | rootL2_10047864 | 3300003322 | Bacteria | 7003 |
| 16 | rootL2_10095098 | 3300003322 | Bacteria | 5744 |
| 17 | rootH1_10013674 | 3300003323 | Bacteria | 50224 |
| 18 | rootH1_10057546 | 3300003323 | Bacteria | 9710 |
| 19 | JGI25160J50197_1000193 | 3300003354 | Bacteria | 51332 |
| 20 | Ga0055536_1013499 | 3300003781 | Bacteria | 2940 |
| 21 | Ga0055531_10000086 | 3300003794 | Bacteria | 101650 |
| 22 | Ga0065165_1000300 | 3300005262 | Bacteria | 83016 |
| 23 | Ga0065704_10079904 | 3300005289 | Bacteria | 4052 |
| 24 | Ga0070658_10000045 | 3300005327 | Bacteria | 130728 |
| 25 | Ga0070658_10025730 | 3300005327 | Bacteria | 4717 |
| 26 | Ga0070658_10069839 | 3300005327 | Bacteria | 2874 |
| 27 | Ga0070676_10001129 | 3300005328 | Bacteria | 13343 |
| 28 | Ga0070676_10005357 | 3300005328 | Bacteria | 6833 |
| 29 | Ga0070683_100005440 | 3300005329 | Bacteria | 10640 |
| 30 | Ga0070683_100018014 | 3300005329 | Bacteria | 6246 |
| 31 | Ga0068869_100035642 | 3300005334 | Bacteria | 3528 |
| 32 | Ga0068869_100063425 | 3300005334 | Bacteria | 2715 |
| 33 | Ga0070666_10021829 | 3300005335 | Bacteria | 4151 |
| 34 | Ga0070680_100104053 | 3300005336 | Bacteria | 2359 |
| 35 | Ga0070682_100060875 | 3300005337 | Bacteria | 2388 |
| 36 | Ga0068868_100008476 | 3300005338 | Bacteria | 7363 |
| 37 | Ga0068868_100015133 | 3300005338 | Bacteria | 5700 |
| 38 | Ga0070660_100039222 | 3300005339 | Bacteria | 3599 |
| 39 | Ga0070661_100006184 | 3300005344 | Bacteria | 8254 |
| 40 | Ga0070661_100046724 | 3300005344 | Bacteria | 3168 |
| 41 | Ga0070675_100010508 | 3300005354 | Bacteria | 7231 |
| 42 | Ga0070675_100026785 | 3300005354 | Unclassified | 4627 |
| 43 | Ga0070675_100084372 | 3300005354 | Bacteria | 2653 |
| 44 | Ga0070671_100092391 | 3300005355 | Bacteria | 2535 |
| 45 | Ga0070673_100008482 | 3300005364 | Bacteria | 6833 |
| 46 | Ga0070673_100025007 | 3300005364 | Bacteria | 4388 |
| 47 | Ga0070673_100045369 | 3300005364 | Unclassified | 3408 |
| 48 | Ga0070659_100003761 | 3300005366 | Bacteria | 10825 |
| 49 | Ga0070659_100078238 | 3300005366 | Bacteria | 2638 |
| 50 | Ga0070667_100024803 | 3300005367 | Unclassified | 4982 |
| 51 | Ga0070667_100205539 | 3300005367 | Bacteria | 1748 |
| 52 | Ga0070701_10050784 | 3300005438 | Bacteria | 2149 |
| 53 | Ga0070663_100026893 | 3300005455 | Bacteria | 3901 |
| 54 | Ga0070678_100010353 | 3300005456 | Bacteria | 5692 |
| 55 | Ga0070662_100001284 | 3300005457 | Bacteria | 15448 |
| 56 | Ga0070662_100006345 | 3300005457 | Bacteria | 7618 |
| 57 | Ga0070662_100010849 | 3300005457 | Bacteria | 6000 |
| 58 | Ga0070681_10101732 | 3300005458 | Bacteria | 2819 |
| 59 | Ga0070679_100024245 | 3300005530 | Bacteria | 5945 |
| 60 | Ga0070679_100105106 | 3300005530 | Bacteria | 2810 |
| 61 | Ga0070684_100091329 | 3300005535 | Bacteria | 2709 |
| 62 | Ga0068853_100023056 | 3300005539 | Bacteria | 5207 |
| 63 | Ga0068853_100023849 | 3300005539 | Bacteria | 5127 |
| 64 | Ga0068853_100160804 | 3300005539 | Bacteria | 2026 |
| 65 | Ga0070672_100113079 | 3300005543 | Bacteria | 2215 |
| 66 | Ga0070686_100102963 | 3300005544 | Bacteria | 1932 |
| 67 | Ga0070665_100000034 | 3300005548 | Bacteria | 324289 |
| 68 | Ga0070665_100038536 | 3300005548 | Bacteria | 4805 |
| 69 | Ga0068855_100000041 | 3300005563 | Bacteria | 151653 |
| 70 | Ga0068855_100000218 | 3300005563 | Bacteria | 73075 |
| 71 | Ga0068855_100006089 | 3300005563 | Bacteria | 14711 |
| 72 | Ga0068855_100033061 | 3300005563 | Bacteria | 6175 |
| 73 | Ga0068855_100048171 | 3300005563 | Bacteria | 5031 |
| 74 | Ga0068855_100135856 | 3300005563 | Unclassified | 2806 |
| 75 | Ga0070664_100045674 | 3300005564 | Bacteria | 3699 |
| 76 | Ga0070664_100049388 | 3300005564 | Bacteria | 3558 |
| 77 | Ga0068857_100031728 | 3300005577 | Bacteria | 4670 |
| 78 | Ga0068857_100250240 | 3300005577 | Bacteria | 1624 |
| 79 | Ga0068854_100076929 | 3300005578 | Bacteria | 2454 |
| 80 | Ga0068856_100000825 | 3300005614 | Bacteria | 33467 |
| 81 | Ga0068856_100004590 | 3300005614 | Bacteria | 13736 |
| 82 | Ga0068856_100026246 | 3300005614 | Bacteria | 5680 |
| 83 | Ga0068856_100176795 | 3300005614 | Bacteria | 2147 |
| 84 | Ga0068852_100003772 | 3300005616 | Bacteria | 10623 |
| 85 | Ga0068852_100104307 | 3300005616 | Bacteria | 2566 |
| 86 | Ga0068864_100021970 | 3300005618 | Bacteria | 5348 |
| 87 | Ga0068861_100073141 | 3300005719 | Unclassified | 2662 |
| 88 | Ga0068851_10003927 | 3300005834 | Bacteria | 6657 |
| 89 | Ga0068863_100018435 | 3300005841 | Bacteria | 6679 |
| 90 | Ga0068860_100004100 | 3300005843 | Bacteria | 14926 |
| 91 | Ga0068860_100014462 | 3300005843 | Bacteria | 7726 |
| 92 | Ga0075366_10000878 | 3300006195 | Bacteria | 14522 |
| 93 | Ga0075366_10017861 | 3300006195 | Bacteria | 4091 |
| 94 | Ga0097621_100000182 | 3300006237 | Bacteria | 39957 |
| 95 | Ga0097621_100009325 | 3300006237 | Bacteria | 7123 |
| 96 | Ga0097621_100061914 | 3300006237 | Bacteria | 3070 |
| 97 | Ga0068871_100000691 | 3300006358 | Bacteria | 22974 |
| 98 | Ga0068871_100059616 | 3300006358 | Bacteria | 3110 |
| 99 | Ga0068871_100137376 | 3300006358 | Unclassified | 2077 |
| 100 | Ga0068865_100000178 | 3300006881 | Bacteria | 35174 |
| 101 | Ga0105244_10000001 | 3300009036 | Bacteria | 1034899 |
| 102 | Ga0105240_10000200 | 3300009093 | Bacteria | 121941 |
| 103 | Ga0105240_10005974 | 3300009093 | Bacteria | 18011 |
| 104 | Ga0105240_10014119 | 3300009093 | Bacteria | 10914 |
| 105 | Ga0105240_10060288 | 3300009093 | Bacteria | 4730 |
| 106 | Ga0105240_10066661 | 3300009093 | Bacteria | 4465 |
| 107 | Ga0105240_10068233 | 3300009093 | Bacteria | 4405 |
| 108 | Ga0111539_10077933 | 3300009094 | Bacteria | 3900 |
| 109 | Ga0105243_10000601 | 3300009148 | Bacteria | 35879 |
| 110 | Ga0105243_10009222 | 3300009148 | Bacteria | 7534 |
| 111 | Ga0105241_10003288 | 3300009174 | Bacteria | 12026 |
| 112 | Ga0105241_10006228 | 3300009174 | Bacteria | 8796 |
| 113 | Ga0105241_10017036 | 3300009174 | Bacteria | 5334 |
| 114 | Ga0105242_10051564 | 3300009176 | Bacteria | 3353 |
| 115 | Ga0105237_10000215 | 3300009545 | Bacteria | 81284 |
| 116 | Ga0105237_10002815 | 3300009545 | Bacteria | 21136 |
| 117 | Ga0105237_10003254 | 3300009545 | Bacteria | 19418 |
| 118 | Ga0105237_10061785 | 3300009545 | Unclassified | 3745 |
| 119 | Ga0105238_10015555 | 3300009551 | Bacteria | 7703 |
| 120 | Ga0105249_10003171 | 3300009553 | Bacteria | 14228 |
| 121 | Ga0105249_10171513 | 3300009553 | Unclassified | 2104 |
| 122 | Ga0105239_10000012 | 3300010375 | Bacteria | 332279 |
| 123 | Ga0105239_10001646 | 3300010375 | Bacteria | 29459 |
| 124 | Ga0105239_10002513 | 3300010375 | Bacteria | 23322 |
| 125 | Ga0105239_10061400 | 3300010375 | Bacteria | 4125 |
| 126 | Ga0105239_10064542 | 3300010375 | Bacteria | 4019 |
| 127 | Ga0105239_10081562 | 3300010375 | Bacteria | 3560 |
| 128 | Ga0105239_10416966 | 3300010375 | Bacteria | 1521 |
| 129 | Ga0105246_10083978 | 3300011119 | Bacteria | 2277 |
| 130 | Ga0157373_10000260 | 3300013100 | Bacteria | 43054 |
| 131 | Ga0157373_10001845 | 3300013100 | Bacteria | 16096 |
| 132 | Ga0157373_10007057 | 3300013100 | Bacteria | 8372 |
| 133 | Ga0157371_10000849 | 3300013102 | Bacteria | 34894 |
| 134 | Ga0157371_10003768 | 3300013102 | Bacteria | 13568 |
| 135 | Ga0157371_10005677 | 3300013102 | Bacteria | 10467 |
| 136 | Ga0157371_10029570 | 3300013102 | Bacteria | 3960 |
| 137 | Ga0157371_10057375 | 3300013102 | Bacteria | 2761 |
| 138 | Ga0157370_10022836 | 3300013104 | Bacteria | 6220 |
| 139 | Ga0157370_10125325 | 3300013104 | Bacteria | 2398 |
| 140 | Ga0157369_10000664 | 3300013105 | Bacteria | 44521 |
| 141 | Ga0157369_10011805 | 3300013105 | Bacteria | 9920 |
| 142 | Ga0157369_10052918 | 3300013105 | Bacteria | 4390 |
| 143 | Ga0157374_10001274 | 3300013296 | Bacteria | 21469 |
| 144 | Ga0157374_10004317 | 3300013296 | Bacteria | 11956 |
| 145 | Ga0157374_10008342 | 3300013296 | Bacteria | 8844 |
| 146 | Ga0157374_10013623 | 3300013296 | Bacteria | 7102 |
| 147 | Ga0157378_10048985 | 3300013297 | Bacteria | 3758 |
| 148 | Ga0157378_10085322 | 3300013297 | Bacteria | 2860 |
| 149 | Ga0163162_10000116 | 3300013306 | Bacteria | 70911 |
| 150 | Ga0163162_10000499 | 3300013306 | Bacteria | 36534 |
| 151 | Ga0163162_10003248 | 3300013306 | Bacteria | 15541 |
| 152 | Ga0163162_10006872 | 3300013306 | Bacteria | 11042 |
| 153 | Ga0163162_10023642 | 3300013306 | Bacteria | 6068 |
| 154 | Ga0163162_10028947 | 3300013306 | Bacteria | 5482 |
| 155 | Ga0157372_10000109 | 3300013307 | Bacteria | 86749 |
| 156 | Ga0157372_10001011 | 3300013307 | Bacteria | 30755 |
| 157 | Ga0157372_10001747 | 3300013307 | Bacteria | 23560 |
| 158 | Ga0157372_10042794 | 3300013307 | Bacteria | 5012 |
| 159 | Ga0157372_10061287 | 3300013307 | Bacteria | 4212 |
| 160 | Ga0157372_10093301 | 3300013307 | Unclassified | 3426 |
| 161 | Ga0157372_10250185 | 3300013307 | Bacteria | 2057 |
| 162 | Ga0157375_10016014 | 3300013308 | Bacteria | 6725 |
| 163 | Ga0157375_10034178 | 3300013308 | Bacteria | 4841 |
| 164 | Ga0157375_10114027 | 3300013308 | Bacteria | 2804 |
| 165 | Ga0163163_10016131 | 3300014325 | Bacteria | 6931 |
| 166 | Ga0157379_10002497 | 3300014968 | Bacteria | 15398 |
| 167 | Ga0157376_10012444 | 3300014969 | Bacteria | 6317 |
| 168 | Ga0157376_10017123 | 3300014969 | Bacteria | 5521 |
| 169 | Ga0157376_10023959 | 3300014969 | Bacteria | 4787 |
| 170 | Ga0157376_10024736 | 3300014969 | Bacteria | 4720 |
| 171 | Ga0157376_10051454 | 3300014969 | Bacteria | 3422 |
| 172 | Ga0163161_10029250 | 3300017792 | Bacteria | 3917 |
| 173 | Ga0207427_100138 | 3300025231 | Bacteria | 86499 |
| 174 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 175 | Ga0209437_100169 | 3300025233 | Bacteria | 142584 |
| 176 | Ga0209026_1000239 | 3300025250 | Bacteria | 71740 |
| 177 | Ga0209026_1001368 | 3300025250 | Bacteria | 10885 |
| 178 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 179 | Ga0209455_1001823 | 3300025272 | Bacteria | 8945 |
| 180 | Ga0209676_1000425 | 3300025292 | Bacteria | 74151 |
| 181 | Ga0207426_1000026 | 3300025302 | Bacteria | 515228 |
| 182 | Ga0209257_1000023 | 3300025304 | Bacteria | 753019 |
| 183 | Ga0207655_1000013 | 3300025728 | Bacteria | 637510 |
| 184 | Ga0207680_10008231 | 3300025903 | Bacteria | 5113 |
| 185 | Ga0207647_10000211 | 3300025904 | Bacteria | 47375 |
| 186 | Ga0207647_10000238 | 3300025904 | Bacteria | 45001 |
| 187 | Ga0207645_10002131 | 3300025907 | Bacteria | 15827 |
| 188 | Ga0207645_10003062 | 3300025907 | Bacteria | 12835 |
| 189 | Ga0207645_10033096 | 3300025907 | Bacteria | 3323 |
| 190 | Ga0207705_10000080 | 3300025909 | Bacteria | 119562 |
| 191 | Ga0207654_10004952 | 3300025911 | Bacteria | 6739 |
| 192 | Ga0207654_10012640 | 3300025911 | Bacteria | 4329 |
| 193 | Ga0207654_10017146 | 3300025911 | Bacteria | 3782 |
| 194 | Ga0207654_10045997 | 3300025911 | Bacteria | 2487 |
| 195 | Ga0207707_10007190 | 3300025912 | Bacteria | 9692 |
| 196 | Ga0207695_10000055 | 3300025913 | Bacteria | 382776 |
| 197 | Ga0207695_10018562 | 3300025913 | Bacteria | 8035 |
| 198 | Ga0207695_10054818 | 3300025913 | Bacteria | 4160 |
| 199 | Ga0207671_10000615 | 3300025914 | Bacteria | 46998 |
| 200 | Ga0207671_10002008 | 3300025914 | Bacteria | 22375 |
| 201 | Ga0207671_10002464 | 3300025914 | Bacteria | 19775 |
| 202 | Ga0207671_10028919 | 3300025914 | Bacteria | 4140 |
| 203 | Ga0207671_10105760 | 3300025914 | Unclassified | 2136 |
| 204 | Ga0207662_10032023 | 3300025918 | Bacteria | 3057 |
| 205 | Ga0207657_10004306 | 3300025919 | Bacteria | 15087 |
| 206 | Ga0207694_10021470 | 3300025924 | Bacteria | 4892 |
| 207 | Ga0207659_10009026 | 3300025926 | Bacteria | 6216 |
| 208 | Ga0207659_10015709 | 3300025926 | Bacteria | 4914 |
| 209 | Ga0207690_10009397 | 3300025932 | Bacteria | 5807 |
| 210 | Ga0207690_10060467 | 3300025932 | Bacteria | 2571 |
| 211 | Ga0207706_10000679 | 3300025933 | Bacteria | 35737 |
| 212 | Ga0207706_10002436 | 3300025933 | Bacteria | 18157 |
| 213 | Ga0207706_10015681 | 3300025933 | Bacteria | 6850 |
| 214 | Ga0207686_10048996 | 3300025934 | Bacteria | 2620 |
| 215 | Ga0207709_10000489 | 3300025935 | Bacteria | 35962 |
| 216 | Ga0207704_10000114 | 3300025938 | Bacteria | 44748 |
| 217 | Ga0207704_10017668 | 3300025938 | Unclassified | 3704 |
| 218 | Ga0207691_10000091 | 3300025940 | Bacteria | 77556 |
| 219 | Ga0207691_10018568 | 3300025940 | Bacteria | 6590 |
| 220 | Ga0207691_10178963 | 3300025940 | Bacteria | 1853 |
| 221 | Ga0207689_10056591 | 3300025942 | Bacteria | 3228 |
| 222 | Ga0207661_10032805 | 3300025944 | Bacteria | 4027 |
| 223 | Ga0207661_10046197 | 3300025944 | Bacteria | 3452 |
| 224 | Ga0207679_10070621 | 3300025945 | Bacteria | 2632 |
| 225 | Ga0207679_10155089 | 3300025945 | Bacteria | 1869 |
| 226 | Ga0207667_10000263 | 3300025949 | Bacteria | 73089 |
| 227 | Ga0207667_10000597 | 3300025949 | Bacteria | 46839 |
| 228 | Ga0207667_10041986 | 3300025949 | Bacteria | 4864 |
| 229 | Ga0207667_10084112 | 3300025949 | Bacteria | 3294 |
| 230 | Ga0207651_10000169 | 3300025960 | Bacteria | 28288 |
| 231 | Ga0207712_10027185 | 3300025961 | Unclassified | 3819 |
| 232 | Ga0207668_10004015 | 3300025972 | Bacteria | 8667 |
| 233 | Ga0207640_10043620 | 3300025981 | Bacteria | 2868 |
| 234 | Ga0207640_10061307 | 3300025981 | Bacteria | 2491 |
| 235 | Ga0207677_10003279 | 3300026023 | Bacteria | 8554 |
| 236 | Ga0207677_10032621 | 3300026023 | Bacteria | 3351 |
| 237 | Ga0207639_10015351 | 3300026041 | Bacteria | 5403 |
| 238 | Ga0207639_10016179 | 3300026041 | Bacteria | 5271 |
| 239 | Ga0207639_10068633 | 3300026041 | Bacteria | 2763 |
| 240 | Ga0207639_10077268 | 3300026041 | Bacteria | 2624 |
| 241 | Ga0207678_10080382 | 3300026067 | Bacteria | 2791 |
| 242 | Ga0207702_10000455 | 3300026078 | Bacteria | 46164 |
| 243 | Ga0207702_10048786 | 3300026078 | Bacteria | 3571 |
| 244 | Ga0207702_10196392 | 3300026078 | Bacteria | 1868 |
| 245 | Ga0207648_10001957 | 3300026089 | Bacteria | 22508 |
| 246 | Ga0207648_10002063 | 3300026089 | Bacteria | 21897 |
| 247 | Ga0207676_10012677 | 3300026095 | Bacteria | 6047 |
| 248 | Ga0207674_10018304 | 3300026116 | Bacteria | 7617 |
| 249 | Ga0207674_10069409 | 3300026116 | Bacteria | 3544 |
| 250 | Ga0207675_100046548 | 3300026118 | Unclassified | 4053 |
| 251 | Ga0207683_10019408 | 3300026121 | Bacteria | 5805 |
| 252 | Ga0207698_10011100 | 3300026142 | Bacteria | 5824 |
| 253 | Ga0268266_10000111 | 3300028379 | Bacteria | 169743 |
| 254 | Ga0268266_10007088 | 3300028379 | Bacteria | 10179 |
| 255 | Ga0268264_10003285 | 3300028381 | Bacteria | 13982 |
| 256 | Ga0307517_10008058 | 3300028786 | Bacteria | 15193 |
| 257 | Ga0265338_10023826 | 3300028800 | Bacteria | 6277 |
| 258 | Ga0307511_10000046 | 3300030521 | Bacteria | 100284 |
| 259 | Ga0265327_10016602 | 3300031251 | Bacteria | 4665 |
| 260 | Ga0307405_10019357 | 3300031731 | Bacteria | 3779 |
| 261 | Ga0307414_10030809 | 3300032004 | Bacteria | 3509 |
| 262 | Ga0307510_10085963 | 3300033180 | Bacteria | 3019 |
| 263 | Ga0395899_0000087 | 3300037312 | Bacteria | 157502 |
| 264 | Ga0395899_0002270 | 3300037312 | Bacteria | 15714 |
| 265 | Ga0395900_0000095 | 3300037418 | Bacteria | 164383 |
| 266 | Ga0395900_0000370 | 3300037418 | Bacteria | 64745 |
| 267 | Ga0395900_0053548 | 3300037418 | Bacteria | 4154 |
| 268 | Ga0395898_0006665 | 3300037466 | Bacteria | 12316 |
| 269 | Ga0395905_0000266 | 3300037471 | Bacteria | 78131 |
| 270 | Ga0395905_0000529 | 3300037471 | Bacteria | 52320 |
| 271 | Ga0395901_0000580 | 3300038443 | Bacteria | 42442 |
| 272 | Ga0395901_0003245 | 3300038443 | Bacteria | 16363 |
| 273 | Ga0466966_0008678 | 3300044684 | Bacteria | 6726 |
| 274 | Ga0495629_0023975 | 3300046459 | Bacteria | 4346 |
| 275 | Ga0495650_0000127 | 3300046471 | Bacteria | 177276 |
| 276 | Ga0495580_0020277 | 3300046472 | Bacteria | 4924 |
| 277 | Ga0495585_0000294 | 3300046492 | Bacteria | 50289 |
| 278 | Ga0495585_0002236 | 3300046492 | Bacteria | 14025 |
| 279 | Ga0495583_0018605 | 3300046506 | Bacteria | 3653 |
| 280 | Ga0495606_0000035 | 3300046507 | Bacteria | 243820 |
| 281 | Ga0495606_0008476 | 3300046507 | Bacteria | 8920 |
| 282 | Ga0495606_0027082 | 3300046507 | Bacteria | 4071 |
| 283 | Ga0495616_0004557 | 3300046513 | Bacteria | 8724 |
| 284 | Ga0495631_0013075 | 3300046518 | Bacteria | 4036 |
| 285 | Ga0495637_0019678 | 3300046520 | Bacteria | 3118 |
| 286 | Ga0495652_0151147 | 3300046529 | Bacteria | 1814 |
| 287 | Ga0495633_0000032 | 3300046558 | Bacteria | 193765 |
| 288 | Ga0495633_0012369 | 3300046558 | Bacteria | 4543 |
| 289 | Ga0495668_0000207 | 3300046616 | Bacteria | 85136 |
| 290 | Ga0495634_0064335 | 3300046642 | Bacteria | 2432 |
| 291 | Ga0495625_0000048 | 3300046660 | Bacteria | 198976 |
| 292 | Ga0495625_0001477 | 3300046660 | Bacteria | 28431 |
| 293 | Ga0495625_0002493 | 3300046660 | Bacteria | 19845 |
| 294 | Ga0495661_0000599 | 3300046665 | Bacteria | 37018 |
| 295 | Ga0495661_0017527 | 3300046665 | Bacteria | 4727 |
| 296 | Ga0495661_0034699 | 3300046665 | Unclassified | 3172 |
| 297 | Ga0495658_0006352 | 3300046683 | Bacteria | 5804 |
| 298 | Ga0495649_0000377 | 3300046694 | Bacteria | 38650 |
| 299 | Ga0495600_0049289 | 3300046809 | Bacteria | 2748 |
| 300 | Ga0495660_0030217 | 3300046810 | Bacteria | 3053 |
| 301 | Ga0495687_000264 | 3300047443 | Bacteria | 70552 |
| 302 | Ga0495673_0013653 | 3300047469 | Bacteria | 4254 |
| 303 | Ga0495686_0001369 | 3300047472 | Bacteria | 27183 |
| 304 | Ga0495686_0001954 | 3300047472 | Bacteria | 20511 |
| 305 | Ga0495686_0003225 | 3300047472 | Bacteria | 14341 |
| 306 | Ga0495686_0112711 | 3300047472 | Bacteria | 1629 |
| 307 | Ga0495602_0146768 | 3300048088 | Unclassified | 1860 |
| 308 | Ga0496114_0001847 | 3300048917 | Bacteria | 16038 |
| 309 | Ga0496115_0013841 | 3300048918 | Bacteria | 6109 |
| 310 | Ga0496122_0000073 | 3300048925 | Bacteria | 222403 |
| 311 | Ga0496123_0030870 | 3300048926 | Bacteria | 3914 |
| 312 | Ga0495678_005922 | 3300049459 | Bacteria | 6611 |
| 313 | Ga0501037_0099536 | 3300049573 | Bacteria | 2100 |
| 314 | nmdc:mga0k408_1090_c1 | 3300050493 | Bacteria | 14889 |
| 315 | nmdc:mga0k408_1518_c1 | 3300050493 | Bacteria | 12535 |
| 316 | Ga0500608_003781 | 3300053122 | Bacteria | 5744 |
| 317 | Ga0500614_001735 | 3300053123 | Bacteria | 5083 |
| 318 | Ga0500618_000539 | 3300053125 | Bacteria | 23530 |
| 319 | Ga0500642_0028075 | 3300053130 | Unclassified | 2317 |
| 320 | Ga0500622_0002738 | 3300053156 | Bacteria | 12442 |
| 321 | 2522551034 | 2522125168 | Bacteria | 7376607 |
| 322 | 2585142965 | 2582581278 | Bacteria | 5296881 |
| 323 | 2587680193 | 2585428045 | Bacteria | 5203023 |
| 324 | 2587745988 | 2585428060 | Bacteria | 5304711 |
| 325 | 2588444252 | 2588253712 | Bacteria | 5403181 |
| 326 | 2590601404 | 2588254255 | Bacteria | 5014294 |
| 327 | 2590614018 | 2588254257 | Bacteria | 5436094 |
| 328 | 2599480185 | 2599185184 | Bacteria | 6430550 |
| 329 | 2753674547 | 2751185877 | Bacteria | 4921427 |
| 330 | 2765574075 | 2765235839 | Bacteria | 5314748 |
| 331 | 2889295407 | 2889290771 | Bacteria | 5530962 |
| 332 | 2919403952 | 2919399522 | Bacteria | 5164947 |
| 333 | 2919438425 | 2919437846 | Bacteria | 6199444 |
| 334 | 2919694665 | 2919692658 | Bacteria | 5943958 |
| 335 | 2928083628 | 2928078545 | Bacteria | 6534839 |
| 336 | 2928151111 | 2928147474 | Bacteria | 6512076 |
| 337 | 2932084409 | 2932082852 | Bacteria | 6563563 |
| 338 | Ga0207667_10025309 | |||
| 339 | JGI24740J21852_10008396 | |||
| 340 | JGI24739J22299_10000332 | |||
| 341 | JGI24739J22299_10034519 | |||
| 342 | JGI24737J22298_10000014 | |||
| 343 | JGI24735J21928_10000008 | |||
| 344 | JGI25162J39368_1001777 | |||
| 345 | JGI25157J39369_1003494 | |||
| 346 | JGI25165J46597_1000461 | |||
| 347 | rootH1_10000753 | |||
| 348 | rootH1_10103452 | |||
| 349 | rootH2_10001801 | |||
| 350 | rootH2_10174654 | |||
| 351 | rootH2_10188151 | |||
| 352 | rootL2_10047864 | |||
| 353 | rootL2_10095098 | |||
| 354 | rootH1_10013674 | |||
| 355 | rootH1_10057546 | |||
| 356 | JGI25160J50197_1000193 | |||
| 357 | Ga0055536_1013499 | |||
| 358 | Ga0055531_10000086 | |||
| 359 | Ga0065165_1000300 | |||
| 360 | Ga0065704_10079904 | |||
| 361 | Ga0070658_10000045 | |||
| 362 | Ga0070658_10025730 | |||
| 363 | Ga0070658_10069839 | |||
| 364 | Ga0070676_10001129 | |||
| 365 | Ga0070676_10005357 | |||
| 366 | Ga0070683_100005440 | |||
| 367 | Ga0070683_100018014 | |||
| 368 | Ga0068869_100035642 | |||
| 369 | Ga0068869_100063425 | |||
| 370 | Ga0070666_10021829 | |||
| 371 | Ga0070680_100104053 | |||
| 372 | Ga0070682_100060875 | |||
| 373 | Ga0068868_100008476 | |||
| 374 | Ga0068868_100015133 | |||
| 375 | Ga0070660_100039222 | |||
| 376 | Ga0070661_100006184 | |||
| 377 | Ga0070661_100046724 | |||
| 378 | Ga0070675_100010508 | |||
| 379 | Ga0070675_100026785 | |||
| 380 | Ga0070675_100084372 | |||
| 381 | Ga0070671_100092391 | |||
| 382 | Ga0070673_100008482 | |||
| 383 | Ga0070673_100025007 | |||
| 384 | Ga0070673_100045369 | |||
| 385 | Ga0070659_100003761 | |||
| 386 | Ga0070659_100078238 | |||
| 387 | Ga0070667_100024803 | |||
| 388 | Ga0070667_100205539 | |||
| 389 | Ga0070701_10050784 | |||
| 390 | Ga0070663_100026893 | |||
| 391 | Ga0070678_100010353 | |||
| 392 | Ga0070662_100001284 | |||
| 393 | Ga0070662_100006345 | |||
| 394 | Ga0070662_100010849 | |||
| 395 | Ga0070681_10101732 | |||
| 396 | Ga0070679_100024245 | |||
| 397 | Ga0070679_100105106 | |||
| 398 | Ga0070684_100091329 | |||
| 399 | Ga0068853_100023056 | |||
| 400 | Ga0068853_100023849 | |||
| 401 | Ga0068853_100160804 | |||
| 402 | Ga0070672_100113079 | |||
| 403 | Ga0070686_100102963 | |||
| 404 | Ga0070665_100000034 | |||
| 405 | Ga0070665_100038536 | |||
| 406 | Ga0068855_100000041 | |||
| 407 | Ga0068855_100000218 | |||
| 408 | Ga0068855_100006089 | |||
| 409 | Ga0068855_100033061 | |||
| 410 | Ga0068855_100048171 | |||
| 411 | Ga0068855_100135856 | |||
| 412 | Ga0070664_100045674 | |||
| 413 | Ga0070664_100049388 | |||
| 414 | Ga0068857_100031728 | |||
| 415 | Ga0068857_100250240 | |||
| 416 | Ga0068854_100076929 | |||
| 417 | Ga0068856_100000825 | |||
| 418 | Ga0068856_100004590 | |||
| 419 | Ga0068856_100026246 | |||
| 420 | Ga0068856_100176795 | |||
| 421 | Ga0068852_100003772 | |||
| 422 | Ga0068852_100104307 | |||
| 423 | Ga0068864_100021970 | |||
| 424 | Ga0068861_100073141 | |||
| 425 | Ga0068851_10003927 | |||
| 426 | Ga0068863_100018435 | |||
| 427 | Ga0068860_100004100 | |||
| 428 | Ga0068860_100014462 | |||
| 429 | Ga0075366_10000878 | |||
| 430 | Ga0075366_10017861 | |||
| 431 | Ga0097621_100000182 | |||
| 432 | Ga0097621_100009325 | |||
| 433 | Ga0097621_100061914 | |||
| 434 | Ga0068871_100000691 | |||
| 435 | Ga0068871_100059616 | |||
| 436 | Ga0068871_100137376 | |||
| 437 | Ga0068865_100000178 | |||
| 438 | Ga0105244_10000001 | |||
| 439 | Ga0105240_10000200 | |||
| 440 | Ga0105240_10005974 | |||
| 441 | Ga0105240_10014119 | |||
| 442 | Ga0105240_10060288 | |||
| 443 | Ga0105240_10066661 | |||
| 444 | Ga0105240_10068233 | |||
| 445 | Ga0111539_10077933 | |||
| 446 | Ga0105243_10000601 | |||
| 447 | Ga0105243_10009222 | |||
| 448 | Ga0105241_10003288 | |||
| 449 | Ga0105241_10006228 | |||
| 450 | Ga0105241_10017036 | |||
| 451 | Ga0105242_10051564 | |||
| 452 | Ga0105237_10000215 | |||
| 453 | Ga0105237_10002815 | |||
| 454 | Ga0105237_10003254 | |||
| 455 | Ga0105237_10061785 | |||
| 456 | Ga0105238_10015555 | |||
| 457 | Ga0105249_10003171 | |||
| 458 | Ga0105249_10171513 | |||
| 459 | Ga0105239_10000012 | |||
| 460 | Ga0105239_10001646 | |||
| 461 | Ga0105239_10002513 | |||
| 462 | Ga0105239_10061400 | |||
| 463 | Ga0105239_10064542 | |||
| 464 | Ga0105239_10081562 | |||
| 465 | Ga0105239_10416966 | |||
| 466 | Ga0105246_10083978 | |||
| 467 | Ga0157373_10000260 | |||
| 468 | Ga0157373_10001845 | |||
| 469 | Ga0157373_10007057 | |||
| 470 | Ga0157371_10000849 | |||
| 471 | Ga0157371_10003768 | |||
| 472 | Ga0157371_10005677 | |||
| 473 | Ga0157371_10029570 | |||
| 474 | Ga0157371_10057375 | |||
| 475 | Ga0157370_10022836 | |||
| 476 | Ga0157370_10125325 | |||
| 477 | Ga0157369_10000664 | |||
| 478 | Ga0157369_10011805 | |||
| 479 | Ga0157369_10052918 | |||
| 480 | Ga0157374_10001274 | |||
| 481 | Ga0157374_10004317 | |||
| 482 | Ga0157374_10008342 | |||
| 483 | Ga0157374_10013623 | |||
| 484 | Ga0157378_10048985 | |||
| 485 | Ga0157378_10085322 | |||
| 486 | Ga0163162_10000116 | |||
| 487 | Ga0163162_10000499 | |||
| 488 | Ga0163162_10003248 | |||
| 489 | Ga0163162_10006872 | |||
| 490 | Ga0163162_10023642 | |||
| 491 | Ga0163162_10028947 | |||
| 492 | Ga0157372_10000109 | |||
| 493 | Ga0157372_10001011 | |||
| 494 | Ga0157372_10001747 | |||
| 495 | Ga0157372_10042794 | |||
| 496 | Ga0157372_10061287 | |||
| 497 | Ga0157372_10093301 | |||
| 498 | Ga0157372_10250185 | |||
| 499 | Ga0157375_10016014 | |||
| 500 | Ga0157375_10034178 | |||
| 501 | Ga0157375_10114027 | |||
| 502 | Ga0163163_10016131 | |||
| 503 | Ga0157379_10002497 | |||
| 504 | Ga0157376_10012444 | |||
| 505 | Ga0157376_10017123 | |||
| 506 | Ga0157376_10023959 | |||
| 507 | Ga0157376_10024736 | |||
| 508 | Ga0157376_10051454 | |||
| 509 | Ga0163161_10029250 | |||
| 510 | Ga0207427_100138 | |||
| 511 | Ga0209437_100010 | |||
| 512 | Ga0209437_100169 | |||
| 513 | Ga0209026_1000239 | |||
| 514 | Ga0209026_1001368 | |||
| 515 | Ga0209233_1000017 | |||
| 516 | Ga0209455_1001823 | |||
| 517 | Ga0209676_1000425 | |||
| 518 | Ga0207426_1000026 | |||
| 519 | Ga0209257_1000023 | |||
| 520 | Ga0207655_1000013 | |||
| 521 | Ga0207680_10008231 | |||
| 522 | Ga0207647_10000211 | |||
| 523 | Ga0207647_10000238 | |||
| 524 | Ga0207645_10002131 | |||
| 525 | Ga0207645_10003062 | |||
| 526 | Ga0207645_10033096 | |||
| 527 | Ga0207705_10000080 | |||
| 528 | Ga0207654_10004952 | |||
| 529 | Ga0207654_10012640 | |||
| 530 | Ga0207654_10017146 | |||
| 531 | Ga0207654_10045997 | |||
| 532 | Ga0207707_10007190 | |||
| 533 | Ga0207695_10000055 | |||
| 534 | Ga0207695_10018562 | |||
| 535 | Ga0207695_10054818 | |||
| 536 | Ga0207671_10000615 | |||
| 537 | Ga0207671_10002008 | |||
| 538 | Ga0207671_10002464 | |||
| 539 | Ga0207671_10028919 | |||
| 540 | Ga0207671_10105760 | |||
| 541 | Ga0207662_10032023 | |||
| 542 | Ga0207657_10004306 | |||
| 543 | Ga0207694_10021470 | |||
| 544 | Ga0207659_10009026 | |||
| 545 | Ga0207659_10015709 | |||
| 546 | Ga0207690_10009397 | |||
| 547 | Ga0207690_10060467 | |||
| 548 | Ga0207706_10000679 | |||
| 549 | Ga0207706_10002436 | |||
| 550 | Ga0207706_10015681 | |||
| 551 | Ga0207686_10048996 | |||
| 552 | Ga0207709_10000489 | |||
| 553 | Ga0207704_10000114 | |||
| 554 | Ga0207704_10017668 | |||
| 555 | Ga0207691_10000091 | |||
| 556 | Ga0207691_10018568 | |||
| 557 | Ga0207691_10178963 | |||
| 558 | Ga0207689_10056591 | |||
| 559 | Ga0207661_10032805 | |||
| 560 | Ga0207661_10046197 | |||
| 561 | Ga0207679_10070621 | |||
| 562 | Ga0207679_10155089 | |||
| 563 | Ga0207667_10000263 | |||
| 564 | Ga0207667_10000597 | |||
| 565 | Ga0207667_10041986 | |||
| 566 | Ga0207667_10084112 | |||
| 567 | Ga0207651_10000169 | |||
| 568 | Ga0207712_10027185 | |||
| 569 | Ga0207668_10004015 | |||
| 570 | Ga0207640_10043620 | |||
| 571 | Ga0207640_10061307 | |||
| 572 | Ga0207677_10003279 | |||
| 573 | Ga0207677_10032621 | |||
| 574 | Ga0207639_10015351 | |||
| 575 | Ga0207639_10016179 | |||
| 576 | Ga0207639_10068633 | |||
| 577 | Ga0207639_10077268 | |||
| 578 | Ga0207678_10080382 | |||
| 579 | Ga0207702_10000455 | |||
| 580 | Ga0207702_10048786 | |||
| 581 | Ga0207702_10196392 | |||
| 582 | Ga0207648_10001957 | |||
| 583 | Ga0207648_10002063 | |||
| 584 | Ga0207676_10012677 | |||
| 585 | Ga0207674_10018304 | |||
| 586 | Ga0207674_10069409 | |||
| 587 | Ga0207675_100046548 | |||
| 588 | Ga0207683_10019408 | |||
| 589 | Ga0207698_10011100 | |||
| 590 | Ga0268266_10000111 | |||
| 591 | Ga0268266_10007088 | |||
| 592 | Ga0268264_10003285 | |||
| 593 | Ga0307517_10008058 | |||
| 594 | Ga0265338_10023826 | |||
| 595 | Ga0307511_10000046 | |||
| 596 | Ga0265327_10016602 | |||
| 597 | Ga0307405_10019357 | |||
| 598 | Ga0307414_10030809 | |||
| 599 | Ga0307510_10085963 | |||
| 600 | Ga0395899_0000087 | |||
| 601 | Ga0395899_0002270 | |||
| 602 | Ga0395900_0000095 | |||
| 603 | Ga0395900_0000370 | |||
| 604 | Ga0395900_0053548 | |||
| 605 | Ga0395898_0006665 | |||
| 606 | Ga0395905_0000266 | |||
| 607 | Ga0395905_0000529 | |||
| 608 | Ga0395901_0000580 | |||
| 609 | Ga0395901_0003245 | |||
| 610 | Ga0466966_0008678 | |||
| 611 | Ga0495629_0023975 | |||
| 612 | Ga0495650_0000127 | |||
| 613 | Ga0495580_0020277 | |||
| 614 | Ga0495585_0000294 | |||
| 615 | Ga0495585_0002236 | |||
| 616 | Ga0495583_0018605 | |||
| 617 | Ga0495606_0000035 | |||
| 618 | Ga0495606_0008476 | |||
| 619 | Ga0495606_0027082 | |||
| 620 | Ga0495616_0004557 | |||
| 621 | Ga0495631_0013075 | |||
| 622 | Ga0495637_0019678 | |||
| 623 | Ga0495652_0151147 | |||
| 624 | Ga0495633_0000032 | |||
| 625 | Ga0495633_0012369 | |||
| 626 | Ga0495668_0000207 | |||
| 627 | Ga0495634_0064335 | |||
| 628 | Ga0495625_0000048 | |||
| 629 | Ga0495625_0001477 | |||
| 630 | Ga0495625_0002493 | |||
| 631 | Ga0495661_0000599 | |||
| 632 | Ga0495661_0017527 | |||
| 633 | Ga0495661_0034699 | |||
| 634 | Ga0495658_0006352 | |||
| 635 | Ga0495649_0000377 | |||
| 636 | Ga0495600_0049289 | |||
| 637 | Ga0495660_0030217 | |||
| 638 | Ga0495687_000264 | |||
| 639 | Ga0495673_0013653 | |||
| 640 | Ga0495686_0001369 | |||
| 641 | Ga0495686_0001954 | |||
| 642 | Ga0495686_0003225 | |||
| 643 | Ga0495686_0112711 | |||
| 644 | Ga0495602_0146768 | |||
| 645 | Ga0496114_0001847 | |||
| 646 | Ga0496115_0013841 | |||
| 647 | Ga0496122_0000073 | |||
| 648 | Ga0496123_0030870 | |||
| 649 | Ga0495678_005922 | |||
| 650 | Ga0501037_0099536 | |||
| 651 | nmdc:mga0k408_1090_c1 | |||
| 652 | nmdc:mga0k408_1518_c1 | |||
| 653 | Ga0500608_003781 | |||
| 654 | Ga0500614_001735 | |||
| 655 | Ga0500618_000539 | |||
| 656 | Ga0500642_0028075 | |||
| 657 | Ga0500622_0002738 | |||
| 658 | 2522551034 | |||
| 659 | 2585142965 | |||
| 660 | 2587680193 | |||
| 661 | 2587745988 | |||
| 662 | 2588444252 | |||
| 663 | 2590601404 | |||
| 664 | 2590614018 | |||
| 665 | 2599480185 | |||
| 666 | 2753674547 | |||
| 667 | 2765574075 | |||
| 668 | 2889295407 | |||
| 669 | 2919403952 | |||
| 670 | 2919438425 | |||
| 671 | 2919694665 | |||
| 672 | 2928083628 | |||
| 673 | 2928151111 | |||
| 674 | 2932084409 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wp1-assembly2.cif.gz_B | crystal structure of the drug-discharge outer membrane protein, oprm | 0.8283 | 41 | 468 |
| 7akz-assembly1.cif.gz_A | deciphering the role of the channel constrictions in the opening mechanism of mexab-oprm efflux pump from pseudomonas aeruginosa | 0.7932 | 41 | 469 |
| 4mt0-assembly1.cif.gz_A | crystal structure of the open state of the neisseria gonorrhoeae mtre outer membrane channel | 0.7895 | 41 | 469 |
| 1yc9-assembly1.cif.gz_A | the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution | 0.7851 | 41 | 469 |
| 4k7r-assembly1.cif.gz_A | crystal structures of cusc review conformational changes accompanying folding and transmembrane channel formation | 0.7767 | 41 | 468 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P75830_95_182_6.10.140.1990 | Special;Helix non-globular;Helix Hairpins; | 0.9549 | 164 | 245 | 6.10.140.1990 |
| 1t5eB03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8987 | 179 | 234 | 1.10.287.470 |
| 1t5eA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8971 | 179 | 234 | 1.10.287.470 |
| 1t5eI03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8943 | 179 | 234 | 1.10.287.470 |
| 2v4dJ04 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin | 0.8887 | 179 | 234 | 1.10.287.470 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2H5X7U6-F1-model_v4 | Cobalt-zinc-cadmium resistance protein CzcC | 0.8527 | 35 | 467 |
GO:0015562
|
| AF-A0A533ZAG8-F1-model_v4 | TolC family protein | 0.8512 | 145 | 467 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A0E3BB41-F1-model_v4 | TolC family protein | 0.8467 | 163 | 467 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A2T2VL92-F1-model_v4 | Transporter | 0.8408 | 141 | 468 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |
| AF-A0A534RBB2-F1-model_v4 | TolC family protein | 0.8406 | 110 | 475 |
GO:0009279
GO:0015288 GO:0015562 GO:1990281 |