F413113

General Info

Members Datasets Scaffolds Average Seq Length
337 193 674 457

Family's Representative Sequence

Representative Sequence 3300025949|Ga0207667_10025309|Ga0207667_100253094
Length 523
Sequence LVGCLKLMNDVLVGASKACKDTSAIIEQTKVTALILLRQKILLHIILLLSCQKYTSMFKASFKYFLAGCFLSLSFIRSNAQQKVLTMKDAEQVALSNYASIKAKASQLNASKAYLTESKAEYLPDLNFSAQQDYGTVNSQFGPSYGYKGLGVSSSGPALAKQNWNAGFGALYLANVNWDIFAFGRAVEKVKVQQTAVNRDETDLEQEQFQHQVRVAATYLNLLAAQQLAKAQQDNLDRTIELQRVVVARVKNGLNAGVDSSQANAEVSNARIALTNAQQTVLDQSNQLAQYMGLPHQTFTLDSIFVKKAPNNANARPAVGANDHPILKYFRNRIGVSDEEAKYLNTFSYPTFTLFGVYQGKGSGFGSAYVLDQSAYTSGYGSGVDPTRFNYLLGIGVTWDFTGIFRVRNLVKAQKFTSEQYRDEYELVSQQLHDQASLAETRIASALKNYNEVPVEVKAASDAYLQKLTLYKNGLANIVDLTQALYTLNRAEVDKDIVYNNVWQAVLYKAAATGDFGIFINNF

Samples

Sample ID Description Type Environment
1 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
84 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
85 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
90 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
161 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
173 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
177 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
178 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
179 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
180 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
181 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
182 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
183 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
184 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
185 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
186 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
187 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
188 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
189 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
190 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
191 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
192 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
193 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 0
Rhizoplane 0.89
Rhizosphere 86.05
Stem 0
Stem Tuber 0
Unclassified 5.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207667_10025309 3300025949 Bacteria 6498
2 JGI24740J21852_10008396 3300001979 Bacteria 4116
3 JGI24739J22299_10000332 3300001989 Bacteria 16033
4 JGI24739J22299_10034519 3300001989 Bacteria 1723
5 JGI24737J22298_10000014 3300001990 Bacteria 50004
6 JGI24735J21928_10000008 3300002067 Bacteria 319819
7 JGI25162J39368_1001777 3300002737 Bacteria 10221
8 JGI25157J39369_1003494 3300002741 Bacteria 3185
9 JGI25165J46597_1000461 3300003214 Bacteria 40249
10 rootH1_10000753 3300003316 Bacteria 32397
11 rootH1_10103452 3300003316 Bacteria 3793
12 rootH2_10001801 3300003320 Bacteria 92828
13 rootH2_10174654 3300003320 Unclassified 3299
14 rootH2_10188151 3300003320 Bacteria 4909
15 rootL2_10047864 3300003322 Bacteria 7003
16 rootL2_10095098 3300003322 Bacteria 5744
17 rootH1_10013674 3300003323 Bacteria 50224
18 rootH1_10057546 3300003323 Bacteria 9710
19 JGI25160J50197_1000193 3300003354 Bacteria 51332
20 Ga0055536_1013499 3300003781 Bacteria 2940
21 Ga0055531_10000086 3300003794 Bacteria 101650
22 Ga0065165_1000300 3300005262 Bacteria 83016
23 Ga0065704_10079904 3300005289 Bacteria 4052
24 Ga0070658_10000045 3300005327 Bacteria 130728
25 Ga0070658_10025730 3300005327 Bacteria 4717
26 Ga0070658_10069839 3300005327 Bacteria 2874
27 Ga0070676_10001129 3300005328 Bacteria 13343
28 Ga0070676_10005357 3300005328 Bacteria 6833
29 Ga0070683_100005440 3300005329 Bacteria 10640
30 Ga0070683_100018014 3300005329 Bacteria 6246
31 Ga0068869_100035642 3300005334 Bacteria 3528
32 Ga0068869_100063425 3300005334 Bacteria 2715
33 Ga0070666_10021829 3300005335 Bacteria 4151
34 Ga0070680_100104053 3300005336 Bacteria 2359
35 Ga0070682_100060875 3300005337 Bacteria 2388
36 Ga0068868_100008476 3300005338 Bacteria 7363
37 Ga0068868_100015133 3300005338 Bacteria 5700
38 Ga0070660_100039222 3300005339 Bacteria 3599
39 Ga0070661_100006184 3300005344 Bacteria 8254
40 Ga0070661_100046724 3300005344 Bacteria 3168
41 Ga0070675_100010508 3300005354 Bacteria 7231
42 Ga0070675_100026785 3300005354 Unclassified 4627
43 Ga0070675_100084372 3300005354 Bacteria 2653
44 Ga0070671_100092391 3300005355 Bacteria 2535
45 Ga0070673_100008482 3300005364 Bacteria 6833
46 Ga0070673_100025007 3300005364 Bacteria 4388
47 Ga0070673_100045369 3300005364 Unclassified 3408
48 Ga0070659_100003761 3300005366 Bacteria 10825
49 Ga0070659_100078238 3300005366 Bacteria 2638
50 Ga0070667_100024803 3300005367 Unclassified 4982
51 Ga0070667_100205539 3300005367 Bacteria 1748
52 Ga0070701_10050784 3300005438 Bacteria 2149
53 Ga0070663_100026893 3300005455 Bacteria 3901
54 Ga0070678_100010353 3300005456 Bacteria 5692
55 Ga0070662_100001284 3300005457 Bacteria 15448
56 Ga0070662_100006345 3300005457 Bacteria 7618
57 Ga0070662_100010849 3300005457 Bacteria 6000
58 Ga0070681_10101732 3300005458 Bacteria 2819
59 Ga0070679_100024245 3300005530 Bacteria 5945
60 Ga0070679_100105106 3300005530 Bacteria 2810
61 Ga0070684_100091329 3300005535 Bacteria 2709
62 Ga0068853_100023056 3300005539 Bacteria 5207
63 Ga0068853_100023849 3300005539 Bacteria 5127
64 Ga0068853_100160804 3300005539 Bacteria 2026
65 Ga0070672_100113079 3300005543 Bacteria 2215
66 Ga0070686_100102963 3300005544 Bacteria 1932
67 Ga0070665_100000034 3300005548 Bacteria 324289
68 Ga0070665_100038536 3300005548 Bacteria 4805
69 Ga0068855_100000041 3300005563 Bacteria 151653
70 Ga0068855_100000218 3300005563 Bacteria 73075
71 Ga0068855_100006089 3300005563 Bacteria 14711
72 Ga0068855_100033061 3300005563 Bacteria 6175
73 Ga0068855_100048171 3300005563 Bacteria 5031
74 Ga0068855_100135856 3300005563 Unclassified 2806
75 Ga0070664_100045674 3300005564 Bacteria 3699
76 Ga0070664_100049388 3300005564 Bacteria 3558
77 Ga0068857_100031728 3300005577 Bacteria 4670
78 Ga0068857_100250240 3300005577 Bacteria 1624
79 Ga0068854_100076929 3300005578 Bacteria 2454
80 Ga0068856_100000825 3300005614 Bacteria 33467
81 Ga0068856_100004590 3300005614 Bacteria 13736
82 Ga0068856_100026246 3300005614 Bacteria 5680
83 Ga0068856_100176795 3300005614 Bacteria 2147
84 Ga0068852_100003772 3300005616 Bacteria 10623
85 Ga0068852_100104307 3300005616 Bacteria 2566
86 Ga0068864_100021970 3300005618 Bacteria 5348
87 Ga0068861_100073141 3300005719 Unclassified 2662
88 Ga0068851_10003927 3300005834 Bacteria 6657
89 Ga0068863_100018435 3300005841 Bacteria 6679
90 Ga0068860_100004100 3300005843 Bacteria 14926
91 Ga0068860_100014462 3300005843 Bacteria 7726
92 Ga0075366_10000878 3300006195 Bacteria 14522
93 Ga0075366_10017861 3300006195 Bacteria 4091
94 Ga0097621_100000182 3300006237 Bacteria 39957
95 Ga0097621_100009325 3300006237 Bacteria 7123
96 Ga0097621_100061914 3300006237 Bacteria 3070
97 Ga0068871_100000691 3300006358 Bacteria 22974
98 Ga0068871_100059616 3300006358 Bacteria 3110
99 Ga0068871_100137376 3300006358 Unclassified 2077
100 Ga0068865_100000178 3300006881 Bacteria 35174
101 Ga0105244_10000001 3300009036 Bacteria 1034899
102 Ga0105240_10000200 3300009093 Bacteria 121941
103 Ga0105240_10005974 3300009093 Bacteria 18011
104 Ga0105240_10014119 3300009093 Bacteria 10914
105 Ga0105240_10060288 3300009093 Bacteria 4730
106 Ga0105240_10066661 3300009093 Bacteria 4465
107 Ga0105240_10068233 3300009093 Bacteria 4405
108 Ga0111539_10077933 3300009094 Bacteria 3900
109 Ga0105243_10000601 3300009148 Bacteria 35879
110 Ga0105243_10009222 3300009148 Bacteria 7534
111 Ga0105241_10003288 3300009174 Bacteria 12026
112 Ga0105241_10006228 3300009174 Bacteria 8796
113 Ga0105241_10017036 3300009174 Bacteria 5334
114 Ga0105242_10051564 3300009176 Bacteria 3353
115 Ga0105237_10000215 3300009545 Bacteria 81284
116 Ga0105237_10002815 3300009545 Bacteria 21136
117 Ga0105237_10003254 3300009545 Bacteria 19418
118 Ga0105237_10061785 3300009545 Unclassified 3745
119 Ga0105238_10015555 3300009551 Bacteria 7703
120 Ga0105249_10003171 3300009553 Bacteria 14228
121 Ga0105249_10171513 3300009553 Unclassified 2104
122 Ga0105239_10000012 3300010375 Bacteria 332279
123 Ga0105239_10001646 3300010375 Bacteria 29459
124 Ga0105239_10002513 3300010375 Bacteria 23322
125 Ga0105239_10061400 3300010375 Bacteria 4125
126 Ga0105239_10064542 3300010375 Bacteria 4019
127 Ga0105239_10081562 3300010375 Bacteria 3560
128 Ga0105239_10416966 3300010375 Bacteria 1521
129 Ga0105246_10083978 3300011119 Bacteria 2277
130 Ga0157373_10000260 3300013100 Bacteria 43054
131 Ga0157373_10001845 3300013100 Bacteria 16096
132 Ga0157373_10007057 3300013100 Bacteria 8372
133 Ga0157371_10000849 3300013102 Bacteria 34894
134 Ga0157371_10003768 3300013102 Bacteria 13568
135 Ga0157371_10005677 3300013102 Bacteria 10467
136 Ga0157371_10029570 3300013102 Bacteria 3960
137 Ga0157371_10057375 3300013102 Bacteria 2761
138 Ga0157370_10022836 3300013104 Bacteria 6220
139 Ga0157370_10125325 3300013104 Bacteria 2398
140 Ga0157369_10000664 3300013105 Bacteria 44521
141 Ga0157369_10011805 3300013105 Bacteria 9920
142 Ga0157369_10052918 3300013105 Bacteria 4390
143 Ga0157374_10001274 3300013296 Bacteria 21469
144 Ga0157374_10004317 3300013296 Bacteria 11956
145 Ga0157374_10008342 3300013296 Bacteria 8844
146 Ga0157374_10013623 3300013296 Bacteria 7102
147 Ga0157378_10048985 3300013297 Bacteria 3758
148 Ga0157378_10085322 3300013297 Bacteria 2860
149 Ga0163162_10000116 3300013306 Bacteria 70911
150 Ga0163162_10000499 3300013306 Bacteria 36534
151 Ga0163162_10003248 3300013306 Bacteria 15541
152 Ga0163162_10006872 3300013306 Bacteria 11042
153 Ga0163162_10023642 3300013306 Bacteria 6068
154 Ga0163162_10028947 3300013306 Bacteria 5482
155 Ga0157372_10000109 3300013307 Bacteria 86749
156 Ga0157372_10001011 3300013307 Bacteria 30755
157 Ga0157372_10001747 3300013307 Bacteria 23560
158 Ga0157372_10042794 3300013307 Bacteria 5012
159 Ga0157372_10061287 3300013307 Bacteria 4212
160 Ga0157372_10093301 3300013307 Unclassified 3426
161 Ga0157372_10250185 3300013307 Bacteria 2057
162 Ga0157375_10016014 3300013308 Bacteria 6725
163 Ga0157375_10034178 3300013308 Bacteria 4841
164 Ga0157375_10114027 3300013308 Bacteria 2804
165 Ga0163163_10016131 3300014325 Bacteria 6931
166 Ga0157379_10002497 3300014968 Bacteria 15398
167 Ga0157376_10012444 3300014969 Bacteria 6317
168 Ga0157376_10017123 3300014969 Bacteria 5521
169 Ga0157376_10023959 3300014969 Bacteria 4787
170 Ga0157376_10024736 3300014969 Bacteria 4720
171 Ga0157376_10051454 3300014969 Bacteria 3422
172 Ga0163161_10029250 3300017792 Bacteria 3917
173 Ga0207427_100138 3300025231 Bacteria 86499
174 Ga0209437_100010 3300025233 Bacteria 838447
175 Ga0209437_100169 3300025233 Bacteria 142584
176 Ga0209026_1000239 3300025250 Bacteria 71740
177 Ga0209026_1001368 3300025250 Bacteria 10885
178 Ga0209233_1000017 3300025261 Bacteria 898076
179 Ga0209455_1001823 3300025272 Bacteria 8945
180 Ga0209676_1000425 3300025292 Bacteria 74151
181 Ga0207426_1000026 3300025302 Bacteria 515228
182 Ga0209257_1000023 3300025304 Bacteria 753019
183 Ga0207655_1000013 3300025728 Bacteria 637510
184 Ga0207680_10008231 3300025903 Bacteria 5113
185 Ga0207647_10000211 3300025904 Bacteria 47375
186 Ga0207647_10000238 3300025904 Bacteria 45001
187 Ga0207645_10002131 3300025907 Bacteria 15827
188 Ga0207645_10003062 3300025907 Bacteria 12835
189 Ga0207645_10033096 3300025907 Bacteria 3323
190 Ga0207705_10000080 3300025909 Bacteria 119562
191 Ga0207654_10004952 3300025911 Bacteria 6739
192 Ga0207654_10012640 3300025911 Bacteria 4329
193 Ga0207654_10017146 3300025911 Bacteria 3782
194 Ga0207654_10045997 3300025911 Bacteria 2487
195 Ga0207707_10007190 3300025912 Bacteria 9692
196 Ga0207695_10000055 3300025913 Bacteria 382776
197 Ga0207695_10018562 3300025913 Bacteria 8035
198 Ga0207695_10054818 3300025913 Bacteria 4160
199 Ga0207671_10000615 3300025914 Bacteria 46998
200 Ga0207671_10002008 3300025914 Bacteria 22375
201 Ga0207671_10002464 3300025914 Bacteria 19775
202 Ga0207671_10028919 3300025914 Bacteria 4140
203 Ga0207671_10105760 3300025914 Unclassified 2136
204 Ga0207662_10032023 3300025918 Bacteria 3057
205 Ga0207657_10004306 3300025919 Bacteria 15087
206 Ga0207694_10021470 3300025924 Bacteria 4892
207 Ga0207659_10009026 3300025926 Bacteria 6216
208 Ga0207659_10015709 3300025926 Bacteria 4914
209 Ga0207690_10009397 3300025932 Bacteria 5807
210 Ga0207690_10060467 3300025932 Bacteria 2571
211 Ga0207706_10000679 3300025933 Bacteria 35737
212 Ga0207706_10002436 3300025933 Bacteria 18157
213 Ga0207706_10015681 3300025933 Bacteria 6850
214 Ga0207686_10048996 3300025934 Bacteria 2620
215 Ga0207709_10000489 3300025935 Bacteria 35962
216 Ga0207704_10000114 3300025938 Bacteria 44748
217 Ga0207704_10017668 3300025938 Unclassified 3704
218 Ga0207691_10000091 3300025940 Bacteria 77556
219 Ga0207691_10018568 3300025940 Bacteria 6590
220 Ga0207691_10178963 3300025940 Bacteria 1853
221 Ga0207689_10056591 3300025942 Bacteria 3228
222 Ga0207661_10032805 3300025944 Bacteria 4027
223 Ga0207661_10046197 3300025944 Bacteria 3452
224 Ga0207679_10070621 3300025945 Bacteria 2632
225 Ga0207679_10155089 3300025945 Bacteria 1869
226 Ga0207667_10000263 3300025949 Bacteria 73089
227 Ga0207667_10000597 3300025949 Bacteria 46839
228 Ga0207667_10041986 3300025949 Bacteria 4864
229 Ga0207667_10084112 3300025949 Bacteria 3294
230 Ga0207651_10000169 3300025960 Bacteria 28288
231 Ga0207712_10027185 3300025961 Unclassified 3819
232 Ga0207668_10004015 3300025972 Bacteria 8667
233 Ga0207640_10043620 3300025981 Bacteria 2868
234 Ga0207640_10061307 3300025981 Bacteria 2491
235 Ga0207677_10003279 3300026023 Bacteria 8554
236 Ga0207677_10032621 3300026023 Bacteria 3351
237 Ga0207639_10015351 3300026041 Bacteria 5403
238 Ga0207639_10016179 3300026041 Bacteria 5271
239 Ga0207639_10068633 3300026041 Bacteria 2763
240 Ga0207639_10077268 3300026041 Bacteria 2624
241 Ga0207678_10080382 3300026067 Bacteria 2791
242 Ga0207702_10000455 3300026078 Bacteria 46164
243 Ga0207702_10048786 3300026078 Bacteria 3571
244 Ga0207702_10196392 3300026078 Bacteria 1868
245 Ga0207648_10001957 3300026089 Bacteria 22508
246 Ga0207648_10002063 3300026089 Bacteria 21897
247 Ga0207676_10012677 3300026095 Bacteria 6047
248 Ga0207674_10018304 3300026116 Bacteria 7617
249 Ga0207674_10069409 3300026116 Bacteria 3544
250 Ga0207675_100046548 3300026118 Unclassified 4053
251 Ga0207683_10019408 3300026121 Bacteria 5805
252 Ga0207698_10011100 3300026142 Bacteria 5824
253 Ga0268266_10000111 3300028379 Bacteria 169743
254 Ga0268266_10007088 3300028379 Bacteria 10179
255 Ga0268264_10003285 3300028381 Bacteria 13982
256 Ga0307517_10008058 3300028786 Bacteria 15193
257 Ga0265338_10023826 3300028800 Bacteria 6277
258 Ga0307511_10000046 3300030521 Bacteria 100284
259 Ga0265327_10016602 3300031251 Bacteria 4665
260 Ga0307405_10019357 3300031731 Bacteria 3779
261 Ga0307414_10030809 3300032004 Bacteria 3509
262 Ga0307510_10085963 3300033180 Bacteria 3019
263 Ga0395899_0000087 3300037312 Bacteria 157502
264 Ga0395899_0002270 3300037312 Bacteria 15714
265 Ga0395900_0000095 3300037418 Bacteria 164383
266 Ga0395900_0000370 3300037418 Bacteria 64745
267 Ga0395900_0053548 3300037418 Bacteria 4154
268 Ga0395898_0006665 3300037466 Bacteria 12316
269 Ga0395905_0000266 3300037471 Bacteria 78131
270 Ga0395905_0000529 3300037471 Bacteria 52320
271 Ga0395901_0000580 3300038443 Bacteria 42442
272 Ga0395901_0003245 3300038443 Bacteria 16363
273 Ga0466966_0008678 3300044684 Bacteria 6726
274 Ga0495629_0023975 3300046459 Bacteria 4346
275 Ga0495650_0000127 3300046471 Bacteria 177276
276 Ga0495580_0020277 3300046472 Bacteria 4924
277 Ga0495585_0000294 3300046492 Bacteria 50289
278 Ga0495585_0002236 3300046492 Bacteria 14025
279 Ga0495583_0018605 3300046506 Bacteria 3653
280 Ga0495606_0000035 3300046507 Bacteria 243820
281 Ga0495606_0008476 3300046507 Bacteria 8920
282 Ga0495606_0027082 3300046507 Bacteria 4071
283 Ga0495616_0004557 3300046513 Bacteria 8724
284 Ga0495631_0013075 3300046518 Bacteria 4036
285 Ga0495637_0019678 3300046520 Bacteria 3118
286 Ga0495652_0151147 3300046529 Bacteria 1814
287 Ga0495633_0000032 3300046558 Bacteria 193765
288 Ga0495633_0012369 3300046558 Bacteria 4543
289 Ga0495668_0000207 3300046616 Bacteria 85136
290 Ga0495634_0064335 3300046642 Bacteria 2432
291 Ga0495625_0000048 3300046660 Bacteria 198976
292 Ga0495625_0001477 3300046660 Bacteria 28431
293 Ga0495625_0002493 3300046660 Bacteria 19845
294 Ga0495661_0000599 3300046665 Bacteria 37018
295 Ga0495661_0017527 3300046665 Bacteria 4727
296 Ga0495661_0034699 3300046665 Unclassified 3172
297 Ga0495658_0006352 3300046683 Bacteria 5804
298 Ga0495649_0000377 3300046694 Bacteria 38650
299 Ga0495600_0049289 3300046809 Bacteria 2748
300 Ga0495660_0030217 3300046810 Bacteria 3053
301 Ga0495687_000264 3300047443 Bacteria 70552
302 Ga0495673_0013653 3300047469 Bacteria 4254
303 Ga0495686_0001369 3300047472 Bacteria 27183
304 Ga0495686_0001954 3300047472 Bacteria 20511
305 Ga0495686_0003225 3300047472 Bacteria 14341
306 Ga0495686_0112711 3300047472 Bacteria 1629
307 Ga0495602_0146768 3300048088 Unclassified 1860
308 Ga0496114_0001847 3300048917 Bacteria 16038
309 Ga0496115_0013841 3300048918 Bacteria 6109
310 Ga0496122_0000073 3300048925 Bacteria 222403
311 Ga0496123_0030870 3300048926 Bacteria 3914
312 Ga0495678_005922 3300049459 Bacteria 6611
313 Ga0501037_0099536 3300049573 Bacteria 2100
314 nmdc:mga0k408_1090_c1 3300050493 Bacteria 14889
315 nmdc:mga0k408_1518_c1 3300050493 Bacteria 12535
316 Ga0500608_003781 3300053122 Bacteria 5744
317 Ga0500614_001735 3300053123 Bacteria 5083
318 Ga0500618_000539 3300053125 Bacteria 23530
319 Ga0500642_0028075 3300053130 Unclassified 2317
320 Ga0500622_0002738 3300053156 Bacteria 12442
321 2522551034 2522125168 Bacteria 7376607
322 2585142965 2582581278 Bacteria 5296881
323 2587680193 2585428045 Bacteria 5203023
324 2587745988 2585428060 Bacteria 5304711
325 2588444252 2588253712 Bacteria 5403181
326 2590601404 2588254255 Bacteria 5014294
327 2590614018 2588254257 Bacteria 5436094
328 2599480185 2599185184 Bacteria 6430550
329 2753674547 2751185877 Bacteria 4921427
330 2765574075 2765235839 Bacteria 5314748
331 2889295407 2889290771 Bacteria 5530962
332 2919403952 2919399522 Bacteria 5164947
333 2919438425 2919437846 Bacteria 6199444
334 2919694665 2919692658 Bacteria 5943958
335 2928083628 2928078545 Bacteria 6534839
336 2928151111 2928147474 Bacteria 6512076
337 2932084409 2932082852 Bacteria 6563563
338 Ga0207667_10025309
339 JGI24740J21852_10008396
340 JGI24739J22299_10000332
341 JGI24739J22299_10034519
342 JGI24737J22298_10000014
343 JGI24735J21928_10000008
344 JGI25162J39368_1001777
345 JGI25157J39369_1003494
346 JGI25165J46597_1000461
347 rootH1_10000753
348 rootH1_10103452
349 rootH2_10001801
350 rootH2_10174654
351 rootH2_10188151
352 rootL2_10047864
353 rootL2_10095098
354 rootH1_10013674
355 rootH1_10057546
356 JGI25160J50197_1000193
357 Ga0055536_1013499
358 Ga0055531_10000086
359 Ga0065165_1000300
360 Ga0065704_10079904
361 Ga0070658_10000045
362 Ga0070658_10025730
363 Ga0070658_10069839
364 Ga0070676_10001129
365 Ga0070676_10005357
366 Ga0070683_100005440
367 Ga0070683_100018014
368 Ga0068869_100035642
369 Ga0068869_100063425
370 Ga0070666_10021829
371 Ga0070680_100104053
372 Ga0070682_100060875
373 Ga0068868_100008476
374 Ga0068868_100015133
375 Ga0070660_100039222
376 Ga0070661_100006184
377 Ga0070661_100046724
378 Ga0070675_100010508
379 Ga0070675_100026785
380 Ga0070675_100084372
381 Ga0070671_100092391
382 Ga0070673_100008482
383 Ga0070673_100025007
384 Ga0070673_100045369
385 Ga0070659_100003761
386 Ga0070659_100078238
387 Ga0070667_100024803
388 Ga0070667_100205539
389 Ga0070701_10050784
390 Ga0070663_100026893
391 Ga0070678_100010353
392 Ga0070662_100001284
393 Ga0070662_100006345
394 Ga0070662_100010849
395 Ga0070681_10101732
396 Ga0070679_100024245
397 Ga0070679_100105106
398 Ga0070684_100091329
399 Ga0068853_100023056
400 Ga0068853_100023849
401 Ga0068853_100160804
402 Ga0070672_100113079
403 Ga0070686_100102963
404 Ga0070665_100000034
405 Ga0070665_100038536
406 Ga0068855_100000041
407 Ga0068855_100000218
408 Ga0068855_100006089
409 Ga0068855_100033061
410 Ga0068855_100048171
411 Ga0068855_100135856
412 Ga0070664_100045674
413 Ga0070664_100049388
414 Ga0068857_100031728
415 Ga0068857_100250240
416 Ga0068854_100076929
417 Ga0068856_100000825
418 Ga0068856_100004590
419 Ga0068856_100026246
420 Ga0068856_100176795
421 Ga0068852_100003772
422 Ga0068852_100104307
423 Ga0068864_100021970
424 Ga0068861_100073141
425 Ga0068851_10003927
426 Ga0068863_100018435
427 Ga0068860_100004100
428 Ga0068860_100014462
429 Ga0075366_10000878
430 Ga0075366_10017861
431 Ga0097621_100000182
432 Ga0097621_100009325
433 Ga0097621_100061914
434 Ga0068871_100000691
435 Ga0068871_100059616
436 Ga0068871_100137376
437 Ga0068865_100000178
438 Ga0105244_10000001
439 Ga0105240_10000200
440 Ga0105240_10005974
441 Ga0105240_10014119
442 Ga0105240_10060288
443 Ga0105240_10066661
444 Ga0105240_10068233
445 Ga0111539_10077933
446 Ga0105243_10000601
447 Ga0105243_10009222
448 Ga0105241_10003288
449 Ga0105241_10006228
450 Ga0105241_10017036
451 Ga0105242_10051564
452 Ga0105237_10000215
453 Ga0105237_10002815
454 Ga0105237_10003254
455 Ga0105237_10061785
456 Ga0105238_10015555
457 Ga0105249_10003171
458 Ga0105249_10171513
459 Ga0105239_10000012
460 Ga0105239_10001646
461 Ga0105239_10002513
462 Ga0105239_10061400
463 Ga0105239_10064542
464 Ga0105239_10081562
465 Ga0105239_10416966
466 Ga0105246_10083978
467 Ga0157373_10000260
468 Ga0157373_10001845
469 Ga0157373_10007057
470 Ga0157371_10000849
471 Ga0157371_10003768
472 Ga0157371_10005677
473 Ga0157371_10029570
474 Ga0157371_10057375
475 Ga0157370_10022836
476 Ga0157370_10125325
477 Ga0157369_10000664
478 Ga0157369_10011805
479 Ga0157369_10052918
480 Ga0157374_10001274
481 Ga0157374_10004317
482 Ga0157374_10008342
483 Ga0157374_10013623
484 Ga0157378_10048985
485 Ga0157378_10085322
486 Ga0163162_10000116
487 Ga0163162_10000499
488 Ga0163162_10003248
489 Ga0163162_10006872
490 Ga0163162_10023642
491 Ga0163162_10028947
492 Ga0157372_10000109
493 Ga0157372_10001011
494 Ga0157372_10001747
495 Ga0157372_10042794
496 Ga0157372_10061287
497 Ga0157372_10093301
498 Ga0157372_10250185
499 Ga0157375_10016014
500 Ga0157375_10034178
501 Ga0157375_10114027
502 Ga0163163_10016131
503 Ga0157379_10002497
504 Ga0157376_10012444
505 Ga0157376_10017123
506 Ga0157376_10023959
507 Ga0157376_10024736
508 Ga0157376_10051454
509 Ga0163161_10029250
510 Ga0207427_100138
511 Ga0209437_100010
512 Ga0209437_100169
513 Ga0209026_1000239
514 Ga0209026_1001368
515 Ga0209233_1000017
516 Ga0209455_1001823
517 Ga0209676_1000425
518 Ga0207426_1000026
519 Ga0209257_1000023
520 Ga0207655_1000013
521 Ga0207680_10008231
522 Ga0207647_10000211
523 Ga0207647_10000238
524 Ga0207645_10002131
525 Ga0207645_10003062
526 Ga0207645_10033096
527 Ga0207705_10000080
528 Ga0207654_10004952
529 Ga0207654_10012640
530 Ga0207654_10017146
531 Ga0207654_10045997
532 Ga0207707_10007190
533 Ga0207695_10000055
534 Ga0207695_10018562
535 Ga0207695_10054818
536 Ga0207671_10000615
537 Ga0207671_10002008
538 Ga0207671_10002464
539 Ga0207671_10028919
540 Ga0207671_10105760
541 Ga0207662_10032023
542 Ga0207657_10004306
543 Ga0207694_10021470
544 Ga0207659_10009026
545 Ga0207659_10015709
546 Ga0207690_10009397
547 Ga0207690_10060467
548 Ga0207706_10000679
549 Ga0207706_10002436
550 Ga0207706_10015681
551 Ga0207686_10048996
552 Ga0207709_10000489
553 Ga0207704_10000114
554 Ga0207704_10017668
555 Ga0207691_10000091
556 Ga0207691_10018568
557 Ga0207691_10178963
558 Ga0207689_10056591
559 Ga0207661_10032805
560 Ga0207661_10046197
561 Ga0207679_10070621
562 Ga0207679_10155089
563 Ga0207667_10000263
564 Ga0207667_10000597
565 Ga0207667_10041986
566 Ga0207667_10084112
567 Ga0207651_10000169
568 Ga0207712_10027185
569 Ga0207668_10004015
570 Ga0207640_10043620
571 Ga0207640_10061307
572 Ga0207677_10003279
573 Ga0207677_10032621
574 Ga0207639_10015351
575 Ga0207639_10016179
576 Ga0207639_10068633
577 Ga0207639_10077268
578 Ga0207678_10080382
579 Ga0207702_10000455
580 Ga0207702_10048786
581 Ga0207702_10196392
582 Ga0207648_10001957
583 Ga0207648_10002063
584 Ga0207676_10012677
585 Ga0207674_10018304
586 Ga0207674_10069409
587 Ga0207675_100046548
588 Ga0207683_10019408
589 Ga0207698_10011100
590 Ga0268266_10000111
591 Ga0268266_10007088
592 Ga0268264_10003285
593 Ga0307517_10008058
594 Ga0265338_10023826
595 Ga0307511_10000046
596 Ga0265327_10016602
597 Ga0307405_10019357
598 Ga0307414_10030809
599 Ga0307510_10085963
600 Ga0395899_0000087
601 Ga0395899_0002270
602 Ga0395900_0000095
603 Ga0395900_0000370
604 Ga0395900_0053548
605 Ga0395898_0006665
606 Ga0395905_0000266
607 Ga0395905_0000529
608 Ga0395901_0000580
609 Ga0395901_0003245
610 Ga0466966_0008678
611 Ga0495629_0023975
612 Ga0495650_0000127
613 Ga0495580_0020277
614 Ga0495585_0000294
615 Ga0495585_0002236
616 Ga0495583_0018605
617 Ga0495606_0000035
618 Ga0495606_0008476
619 Ga0495606_0027082
620 Ga0495616_0004557
621 Ga0495631_0013075
622 Ga0495637_0019678
623 Ga0495652_0151147
624 Ga0495633_0000032
625 Ga0495633_0012369
626 Ga0495668_0000207
627 Ga0495634_0064335
628 Ga0495625_0000048
629 Ga0495625_0001477
630 Ga0495625_0002493
631 Ga0495661_0000599
632 Ga0495661_0017527
633 Ga0495661_0034699
634 Ga0495658_0006352
635 Ga0495649_0000377
636 Ga0495600_0049289
637 Ga0495660_0030217
638 Ga0495687_000264
639 Ga0495673_0013653
640 Ga0495686_0001369
641 Ga0495686_0001954
642 Ga0495686_0003225
643 Ga0495686_0112711
644 Ga0495602_0146768
645 Ga0496114_0001847
646 Ga0496115_0013841
647 Ga0496122_0000073
648 Ga0496123_0030870
649 Ga0495678_005922
650 Ga0501037_0099536
651 nmdc:mga0k408_1090_c1
652 nmdc:mga0k408_1518_c1
653 Ga0500608_003781
654 Ga0500614_001735
655 Ga0500618_000539
656 Ga0500642_0028075
657 Ga0500622_0002738
658 2522551034
659 2585142965
660 2587680193
661 2587745988
662 2588444252
663 2590601404
664 2590614018
665 2599480185
666 2753674547
667 2765574075
668 2889295407
669 2919403952
670 2919438425
671 2919694665
672 2928083628
673 2928151111
674 2932084409

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02321

OEP

Outer membrane efflux protein

87

293

0.96

PF02321

OEP

Outer membrane efflux protein

317

514

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wp1-assembly2.cif.gz_B crystal structure of the drug-discharge outer membrane protein, oprm 0.8283 41 468
7akz-assembly1.cif.gz_A deciphering the role of the channel constrictions in the opening mechanism of mexab-oprm efflux pump from pseudomonas aeruginosa 0.7932 41 469
4mt0-assembly1.cif.gz_A crystal structure of the open state of the neisseria gonorrhoeae mtre outer membrane channel 0.7895 41 469
1yc9-assembly1.cif.gz_A the crystal structure of the outer membrane protein vcec from the bacterial pathogen vibrio cholerae at 1.8 resolution 0.7851 41 469
4k7r-assembly1.cif.gz_A crystal structures of cusc review conformational changes accompanying folding and transmembrane channel formation 0.7767 41 468
ID Description Score Start End Superfamily
af_P75830_95_182_6.10.140.1990 Special;Helix non-globular;Helix Hairpins; 0.9549 164 245 6.10.140.1990
1t5eB03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8987 179 234 1.10.287.470
1t5eA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8971 179 234 1.10.287.470
1t5eI03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8943 179 234 1.10.287.470
2v4dJ04 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.8887 179 234 1.10.287.470
ID Description Score Start End GO Terms
AF-A0A2H5X7U6-F1-model_v4 Cobalt-zinc-cadmium resistance protein CzcC 0.8527 35 467 GO:0015562
AF-A0A533ZAG8-F1-model_v4 TolC family protein 0.8512 145 467 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A0E3BB41-F1-model_v4 TolC family protein 0.8467 163 467 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A2T2VL92-F1-model_v4 Transporter 0.8408 141 468 GO:0009279
GO:0015288
GO:0015562
GO:1990281
AF-A0A534RBB2-F1-model_v4 TolC family protein 0.8406 110 475 GO:0009279
GO:0015288
GO:0015562
GO:1990281

Map