F413165

General Info

Members Datasets Scaffolds Average Seq Length
337 212 674 239

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0201499|Ga0316584_0201499_169_990
Length 273
Sequence MAPLWALNLSRFSDILPPRQESETGADLMSDGSARQPAPAYKRVLLKISGEALMGDQGYGLHPPTVQRIAEEVKSVRDLGVEICMVIGGGNIFRGLAGSAQGMERTTADYMGMLATVMNALALQSALEGMGVFTRVITAIRMDEVAEPYIRRRAVRHLEKGRVCIFAAGTGNPYFTTDTAATLRANEMACEVIFKGTKVDGVYDKDPKTHPDATRYDEVTYDDCLQKNLKVMDASAIALARDNDLPIIVFSLDEPGGFRGILAGQGTYTIVHG

Samples

Sample ID Description Type Environment
1 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
63 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
64 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
103 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
117 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
120 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
121 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
138 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
139 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
140 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
148 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
149 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
150 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
151 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
159 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
186 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
187 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
188 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
189 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
190 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
191 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
194 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
195 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
196 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
199 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
200 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
201 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
202 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
203 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
204 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
205 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
206 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
207 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
208 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
209 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
210 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
211 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
212 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0
Isolates 4.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0.3
Rhizoplane 8.61
Rhizosphere 82.79
Stem 0
Stem Tuber 0.3
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316584_0201499 3300036712 Bacteria 1468
2 rootH2_10031158 3300003320 Bacteria 2006
3 Ga0065715_10322017 3300005293 Bacteria 1000
4 Ga0070658_10031187 3300005327 Bacteria 4280
5 Ga0070666_10001325 3300005335 Bacteria 15007
6 Ga0070680_100037343 3300005336 Bacteria 3924
7 Ga0070660_100002162 3300005339 Bacteria 13542
8 Ga0070691_10000026 3300005341 Bacteria 40701
9 Ga0070691_10000423 3300005341 Bacteria 15521
10 Ga0070668_100044842 3300005347 Bacteria 3393
11 Ga0070668_100114119 3300005347 Bacteria 2153
12 Ga0070669_100047794 3300005353 Bacteria 3122
13 Ga0070671_100054385 3300005355 Bacteria 3329
14 Ga0070673_100011955 3300005364 Bacteria 5943
15 Ga0070673_100245870 3300005364 Bacteria 1557
16 Ga0070659_100007064 3300005366 Bacteria 8135
17 Ga0070659_100023241 3300005366 Bacteria 4742
18 Ga0070667_100002362 3300005367 Bacteria 16528
19 Ga0070709_10001084 3300005434 Bacteria 15078
20 Ga0070714_100460415 3300005435 Bacteria 1209
21 Ga0070713_100000008 3300005436 Bacteria 160153
22 Ga0070713_100153774 3300005436 Bacteria 2049
23 Ga0070713_100158763 3300005436 Bacteria 2017
24 Ga0070713_100253727 3300005436 Bacteria 1605
25 Ga0070711_100169027 3300005439 Bacteria 1665
26 Ga0070681_10028353 3300005458 Bacteria 5628
27 Ga0070706_100149466 3300005467 Bacteria 2181
28 Ga0070679_100056119 3300005530 Bacteria 3924
29 Ga0070679_100137978 3300005530 Bacteria 2419
30 Ga0068853_100025374 3300005539 Bacteria 4972
31 Ga0068853_100049546 3300005539 Bacteria 3610
32 Ga0068853_100319017 3300005539 Bacteria 1440
33 Ga0070693_100060956 3300005547 Bacteria 2192
34 Ga0070665_100025094 3300005548 Bacteria 6007
35 Ga0070704_100457354 3300005549 Bacteria 1100
36 Ga0068855_100029133 3300005563 Bacteria 6603
37 Ga0068855_100040684 3300005563 Bacteria 5515
38 Ga0068855_100104119 3300005563 Bacteria 3264
39 Ga0070664_100097190 3300005564 Bacteria 2557
40 Ga0070664_100465231 3300005564 Bacteria 1162
41 Ga0068857_100000572 3300005577 Bacteria 26923
42 Ga0068854_100083557 3300005578 Bacteria 2361
43 Ga0068856_100000362 3300005614 Bacteria 49802
44 Ga0068852_100012265 3300005616 Bacteria 6498
45 Ga0068852_100806657 3300005616 Bacteria 953
46 Ga0068859_100035948 3300005617 Bacteria 4970
47 Ga0068864_100006382 3300005618 Bacteria 9664
48 Ga0068851_10132476 3300005834 Bacteria 1349
49 Ga0068860_101028390 3300005843 Bacteria 842
50 Ga0068862_100016230 3300005844 Bacteria 6197
51 Ga0068862_100519506 3300005844 Bacteria 1133
52 Ga0070712_100000435 3300006175 Bacteria 23865
53 Ga0075428_100021520 3300006844 Bacteria 7137
54 Ga0075428_100400555 3300006844 Bacteria 1471
55 Ga0075430_100109724 3300006846 Bacteria 2301
56 Ga0075434_100019465 3300006871 Bacteria 6571
57 Ga0075434_100167468 3300006871 Bacteria 2217
58 Ga0075436_100000099 3300006914 Bacteria 51125
59 Ga0075436_100002921 3300006914 Bacteria 11716
60 Ga0075436_100031551 3300006914 Bacteria 3649
61 Ga0097620_100035948 3300006931 Bacteria 4970
62 Ga0075435_100008130 3300007076 Bacteria 7512
63 Ga0075435_100363738 3300007076 Bacteria 1241
64 Ga0105240_10008089 3300009093 Bacteria 15108
65 Ga0111539_10021677 3300009094 Bacteria 7903
66 Ga0114129_11005629 3300009147 Bacteria 1050
67 Ga0105241_10059972 3300009174 Bacteria 2926
68 Ga0105241_10369786 3300009174 Bacteria 1250
69 Ga0105242_10184712 3300009176 Bacteria 1842
70 Ga0105248_10421972 3300009177 Bacteria 1502
71 Ga0105237_10012207 3300009545 Bacteria 9057
72 Ga0105238_10001957 3300009551 Bacteria 20734
73 Ga0105238_10019848 3300009551 Bacteria 6841
74 Ga0105238_10067214 3300009551 Bacteria 3585
75 Ga0105239_10002396 3300010375 Bacteria 23907
76 Ga0157373_10000393 3300013100 Bacteria 35085
77 Ga0157370_10006364 3300013104 Bacteria 13035
78 Ga0157370_10162847 3300013104 Bacteria 2075
79 Ga0157369_10004678 3300013105 Bacteria 16088
80 Ga0157369_10156713 3300013105 Bacteria 2405
81 Ga0163162_10633970 3300013306 Bacteria 1193
82 Ga0157372_10004098 3300013307 Bacteria 15629
83 Ga0157375_10091029 3300013308 Bacteria 3111
84 Ga0163163_10123537 3300014325 Bacteria 2624
85 Ga0163163_10171125 3300014325 Bacteria 2219
86 Ga0163163_10785523 3300014325 Bacteria 1015
87 Ga0182008_10100528 3300014497 Bacteria 1429
88 Ga0157379_10000809 3300014968 Bacteria 25373
89 Ga0157379_10002785 3300014968 Bacteria 14743
90 Ga0157379_10002800 3300014968 Bacteria 14691
91 Ga0157379_10018004 3300014968 Bacteria 6226
92 Ga0213871_10074692 3300021441 Bacteria 963
93 Ga0224572_1002291 3300024225 Bacteria 3062
94 Ga0207680_10001877 3300025903 Bacteria 9861
95 Ga0207699_10000140 3300025906 Bacteria 48523
96 Ga0207705_10000130 3300025909 Bacteria 82082
97 Ga0207705_10377371 3300025909 Bacteria 1095
98 Ga0207654_10054236 3300025911 Bacteria 2316
99 Ga0207707_10000839 3300025912 Bacteria 30215
100 Ga0207707_10083396 3300025912 Bacteria 2791
101 Ga0207695_10135029 3300025913 Bacteria 2421
102 Ga0207671_10344807 3300025914 Bacteria 1180
103 Ga0207693_10001130 3300025915 Bacteria 23920
104 Ga0207663_10127686 3300025916 Bacteria 1752
105 Ga0207660_10000793 3300025917 Bacteria 20929
106 Ga0207662_10373495 3300025918 Bacteria 962
107 Ga0207657_10000203 3300025919 Bacteria 61390
108 Ga0207652_10001704 3300025921 Bacteria 19206
109 Ga0207652_10016226 3300025921 Bacteria 6077
110 Ga0207694_10043175 3300025924 Bacteria 3480
111 Ga0207694_10053944 3300025924 Bacteria 3118
112 Ga0207650_10017209 3300025925 Bacteria 5059
113 Ga0207700_10000011 3300025928 Bacteria 266323
114 Ga0207700_10242562 3300025928 Bacteria 1536
115 Ga0207644_10088630 3300025931 Bacteria 2302
116 Ga0207644_10150502 3300025931 Bacteria 1800
117 Ga0207690_10101512 3300025932 Bacteria 2055
118 Ga0207690_10221361 3300025932 Bacteria 1448
119 Ga0207665_10139433 3300025939 Bacteria 1727
120 Ga0207691_10240147 3300025940 Bacteria 1567
121 Ga0207711_10097080 3300025941 Bacteria 2601
122 Ga0207679_10191772 3300025945 Bacteria 1700
123 Ga0207679_10395292 3300025945 Bacteria 1215
124 Ga0207667_10006070 3300025949 Bacteria 14691
125 Ga0207667_10018856 3300025949 Bacteria 7722
126 Ga0207651_10040496 3300025960 Bacteria 3083
127 Ga0207668_10001036 3300025972 Bacteria 16597
128 Ga0207668_10089107 3300025972 Bacteria 2261
129 Ga0207640_10039961 3300025981 Bacteria 2973
130 Ga0207658_10050844 3300025986 Bacteria 3051
131 Ga0207703_10039522 3300026035 Bacteria 3771
132 Ga0207703_10166629 3300026035 Bacteria 1934
133 Ga0207639_10055272 3300026041 Bacteria 3038
134 Ga0207639_10073439 3300026041 Bacteria 2681
135 Ga0207639_10329039 3300026041 Bacteria 1359
136 Ga0207678_10149069 3300026067 Bacteria 1997
137 Ga0207702_10000162 3300026078 Bacteria 79378
138 Ga0207702_10000968 3300026078 Bacteria 29412
139 Ga0207702_10510650 3300026078 Bacteria 1172
140 Ga0207641_10078289 3300026088 Bacteria 2863
141 Ga0207676_10052094 3300026095 Bacteria 3198
142 Ga0207674_10001803 3300026116 Bacteria 27309
143 Ga0207698_10066852 3300026142 Bacteria 2832
144 Ga0207698_10337387 3300026142 Bacteria 1418
145 Ga0268266_10099801 3300028379 Bacteria 2556
146 Ga0268265_10217418 3300028380 Bacteria 1669
147 Ga0268265_10426048 3300028380 Bacteria 1233
148 Ga0268264_10049049 3300028381 Bacteria 3512
149 Ga0268264_10930268 3300028381 Bacteria 874
150 Ga0307517_10000497 3300028786 Bacteria 67390
151 Ga0265338_10052693 3300028800 Bacteria 3647
152 Ga0265338_10150070 3300028800 Bacteria 1812
153 Ga0265338_10340586 3300028800 Bacteria 1081
154 Ga0265332_10077307 3300031238 Bacteria 1414
155 Ga0265320_10000561 3300031240 Bacteria 28649
156 Ga0265325_10000677 3300031241 Bacteria 24870
157 Ga0265325_10002084 3300031241 Bacteria 13686
158 Ga0265339_10007789 3300031249 Bacteria 6884
159 Ga0265339_10019156 3300031249 Bacteria 4020
160 Ga0265316_10311361 3300031344 Bacteria 1145
161 Ga0265316_10546135 3300031344 Bacteria 825
162 Ga0307513_10000448 3300031456 Bacteria 59427
163 Ga0307513_10002007 3300031456 Bacteria 28699
164 Ga0307513_10004437 3300031456 Bacteria 18736
165 Ga0265313_10026643 3300031595 Bacteria 3041
166 Ga0265313_10045567 3300031595 Bacteria 2134
167 Ga0265314_10001066 3300031711 Bacteria 31856
168 Ga0265314_10003381 3300031711 Bacteria 15464
169 Ga0265314_10004545 3300031711 Bacteria 12813
170 Ga0265314_10024285 3300031711 Bacteria 4598
171 Ga0265314_10049532 3300031711 Bacteria 2940
172 Ga0265342_10049352 3300031712 Bacteria 2518
173 Ga0316576_10025424 3300031727 Bacteria 4145
174 Ga0316578_10101909 3300031728 Bacteria 1721
175 Ga0307516_10000004 3300031730 Bacteria 367451
176 Ga0316583_10040129 3300032133 Bacteria 1658
177 Ga0373944_0150004 3300035089 Bacteria 821
178 Ga0373923_0023853 3300035111 Bacteria 2411
179 Ga0373923_0045555 3300035111 Bacteria 1822
180 Ga0373932_0013397 3300035112 Bacteria 2039
181 Ga0373932_0076927 3300035112 Bacteria 1047
182 Ga0373945_0017742 3300035116 Bacteria 2414
183 Ga0373943_0287204 3300035170 Bacteria 931
184 Ga0373931_0061144 3300035691 Bacteria 2030
185 Ga0373935_0237851 3300035692 Bacteria 1270
186 Ga0373927_0000526 3300035695 Bacteria 29046
187 Ga0373927_0205119 3300035695 Bacteria 1294
188 Ga0373933_0182067 3300035724 Bacteria 1340
189 Ga0373947_0027212 3300035725 Bacteria 3346
190 Ga0373937_0006766 3300036401 Bacteria 9897
191 Ga0373937_0013567 3300036401 Bacteria 7178
192 Ga0373937_0077347 3300036401 Bacteria 3075
193 Ga0373937_0172675 3300036401 Bacteria 2028
194 Ga0373925_0000061 3300037068 Bacteria 117783
195 Ga0373925_0023782 3300037068 Bacteria 4469
196 Ga0373925_0059238 3300037068 Bacteria 2872
197 Ga0395905_0265249 3300037471 Bacteria 1603
198 Ga0400483_082259 3300039062 Bacteria 1122
199 Ga0400483_135916 3300039062 Bacteria 2087
200 Ga0400483_154659 3300039062 Bacteria 2976
201 Ga0400483_205214 3300039062 Bacteria 1434
202 Ga0400483_217969 3300039062 Bacteria 1371
203 Ga0400483_260120 3300039062 Bacteria 1279
204 Ga0400483_279640 3300039062 Bacteria 1501
205 Ga0400483_288211 3300039062 Bacteria 3663
206 Ga0436365_0500054 3300039437 Bacteria 2183
207 Ga0436365_1542298 3300039437 Bacteria 914
208 Ga0436360_0580037 3300039438 Bacteria 1754
209 Ga0451576_0000661 3300045051 Bacteria 71055
210 Ga0495580_0202297 3300046472 Bacteria 1368
211 Ga0495582_0033289 3300046473 Bacteria 2833
212 Ga0495628_0190838 3300046516 Bacteria 1547
213 Ga0495665_0027367 3300046531 Bacteria 3060
214 Ga0495586_0103827 3300046535 Bacteria 1579
215 Ga0495625_0288127 3300046660 Bacteria 1054
216 Ga0495657_0225706 3300046675 Bacteria 1134
217 Ga0495674_0067306 3300047319 Bacteria 3104
218 Ga0495672_0005999 3300047320 Bacteria 9513
219 Ga0495684_0203937 3300047471 Bacteria 1457
220 Ga0496100_0151099 3300048903 Bacteria 1656
221 Ga0496101_0010317 3300048904 Bacteria 6169
222 Ga0496101_0705858 3300048904 Bacteria 796
223 Ga0496102_0002224 3300048905 Bacteria 16640
224 Ga0496102_0133896 3300048905 Bacteria 2321
225 Ga0496102_0308641 3300048905 Bacteria 1491
226 Ga0496102_0414154 3300048905 Bacteria 1266
227 Ga0496103_0026234 3300048906 Bacteria 3528
228 Ga0496104_0052920 3300048907 Bacteria 3835
229 Ga0496104_0056495 3300048907 Bacteria 3712
230 Ga0496104_0067990 3300048907 Bacteria 3385
231 Ga0496105_0022876 3300048908 Bacteria 5066
232 Ga0496106_0004642 3300048909 Bacteria 10189
233 Ga0496107_0002984 3300048910 Bacteria 11209
234 Ga0496107_0184626 3300048910 Bacteria 1549
235 Ga0496108_0011953 3300048911 Bacteria 7062
236 Ga0496108_0027044 3300048911 Bacteria 4733
237 Ga0496109_0009852 3300048912 Bacteria 8156
238 Ga0496109_0029476 3300048912 Bacteria 4915
239 Ga0496109_0038758 3300048912 Bacteria 4310
240 Ga0496110_0028561 3300048913 Bacteria 4792
241 Ga0496110_0060884 3300048913 Bacteria 3330
242 Ga0496111_0016755 3300048914 Bacteria 5055
243 Ga0496111_0066302 3300048914 Bacteria 2621
244 Ga0496111_0304196 3300048914 Bacteria 1182
245 Ga0496112_0091807 3300048915 Bacteria 3005
246 Ga0496112_0188872 3300048915 Bacteria 2023
247 Ga0496113_0085995 3300048916 Bacteria 2416
248 Ga0496114_0217731 3300048917 Bacteria 1676
249 Ga0496122_0020937 3300048925 Bacteria 5878
250 Ga0496126_0000382 3300048929 Bacteria 91611
251 Ga0496126_0181034 3300048929 Bacteria 1790
252 Ga0501032_0002879 3300049569 Bacteria 13385
253 Ga0501032_0067117 3300049569 Bacteria 2397
254 Ga0501033_0022889 3300049570 Bacteria 4710
255 Ga0501033_0030287 3300049570 Bacteria 4067
256 Ga0501033_0032973 3300049570 Bacteria 3889
257 Ga0501034_0000012 3300049571 Bacteria 310504
258 Ga0501034_0007444 3300049571 Bacteria 11652
259 Ga0501037_0001908 3300049573 Bacteria 15140
260 Ga0501037_0019872 3300049573 Bacteria 4957
261 Ga0501038_0004396 3300049574 Bacteria 13117
262 Ga0501038_0290176 3300049574 Bacteria 1286
263 Ga0501038_0572484 3300049574 Bacteria 857
264 Ga0501039_0001573 3300049575 Bacteria 16801
265 Ga0501039_0273285 3300049575 Bacteria 1328
266 Ga0501042_0011142 3300049578 Bacteria 6058
267 Ga0501042_0484535 3300049578 Bacteria 898
268 Ga0501043_0044199 3300049579 Bacteria 3502
269 Ga0501043_0048058 3300049579 Bacteria 3354
270 Ga0501043_0103614 3300049579 Bacteria 2236
271 Ga0501046_0006278 3300049580 Bacteria 10541
272 Ga0501047_0007287 3300049581 Bacteria 10398
273 Ga0501047_0014477 3300049581 Bacteria 7501
274 Ga0501047_0169386 3300049581 Bacteria 2053
275 Ga0501048_0003926 3300049582 Bacteria 11295
276 Ga0501067_0003131 3300049583 Bacteria 9134
277 Ga0501069_0131083 3300049585 Bacteria 1435
278 Ga0501070_0000002 3300049586 Bacteria 347524
279 Ga0501070_0002559 3300049586 Bacteria 15917
280 Ga0501071_0226154 3300049587 Bacteria 1409
281 Ga0501073_0000802 3300049589 Bacteria 22364
282 Ga0501073_0016658 3300049589 Bacteria 5326
283 Ga0501074_0000138 3300049590 Bacteria 37896
284 Ga0501074_0040721 3300049590 Bacteria 3364
285 Ga0501075_0212639 3300049591 Bacteria 1475
286 Ga0501076_0293549 3300049592 Bacteria 1332
287 Ga0501079_0007294 3300049741 Bacteria 8348
288 Ga0501079_0047737 3300049741 Bacteria 3304
289 Ga0501080_0001693 3300049742 Bacteria 18802
290 Ga0501080_0008063 3300049742 Bacteria 9546
291 Ga0501080_0046399 3300049742 Bacteria 4045
292 Ga0501080_0117816 3300049742 Bacteria 2462
293 Ga0501083_0008522 3300049744 Bacteria 7238
294 Ga0501083_0013979 3300049744 Bacteria 5609
295 Ga0501035_0012091 3300049822 Bacteria 7980
296 Ga0501035_0017376 3300049822 Bacteria 6632
297 Ga0501035_0027849 3300049822 Bacteria 5163
298 Ga0501044_0016840 3300049823 Bacteria 7841
299 Ga0501044_0030091 3300049823 Bacteria 5722
300 Ga0501044_0034767 3300049823 Bacteria 5282
301 Ga0501044_0049845 3300049823 Bacteria 4322
302 Ga0501044_0186912 3300049823 Bacteria 2036
303 Ga0501045_0017987 3300049824 Bacteria 5019
304 Ga0501045_0309944 3300049824 Bacteria 1175
305 nmdc:mga00v17_239358_c1 3300050491 Bacteria 1176
306 nmdc:mga06r32_363305_c1 3300050510 Bacteria 1431
307 nmdc:mga08y16_75046_c1 3300050511 Bacteria 3525
308 nmdc:mga0n895_25084_c1 3300050512 Bacteria 5628
309 nmdc:mga0n895_300949_c1 3300050512 Bacteria 1626
310 nmdc:mga0rr50_10688_c1 3300050513 Bacteria 5842
311 nmdc:mga08x19_2099_c1 3300050514 Bacteria 12187
312 nmdc:mga08x19_28809_c1 3300050514 Bacteria 3481
313 nmdc:mga08x19_394_c1 3300050514 Bacteria 30675
314 Ga0495619_0088205 3300053085 Bacteria 2098
315 Ga0495619_0315065 3300053085 Bacteria 1083
316 Ga0500618_020042 3300053125 Bacteria 1641
317 Ga0500636_0050744 3300053177 Bacteria 2440
318 Ga0500611_069736 3300053727 Bacteria 853
319 Ga0501084_0001765 3300054114 Bacteria 17203
320 Ga0501082_0009503 3300060353 Bacteria 8369
321 Ga0501082_0016763 3300060353 Bacteria 6309
322 Ga0501082_0051949 3300060353 Bacteria 3533
323 Ga0530510_0137751 3300061734 Bacteria 1797
324 2512032942 2511231221 Bacteria 6846400
325 2715499632 2713897090 Bacteria 3353799
326 2834580742 2834578030 Bacteria 3530182
327 2840879758 2840878972 Bacteria 5483153
328 2848298526 2848297114 Bacteria 3608511
329 2854683360 2854681122 Bacteria 4548679
330 2855023366 2855020534 Bacteria 3204685
331 2898798962 2898795034 Bacteria 4294459
332 2899260578 2899259804 Bacteria 3320927
333 2899276033 2899275550 Bacteria 3958688
334 2919681205 2919679072 Bacteria 4629602
335 3000018499 3000017691 Bacteria 3772574
336 3000408361 3000405567 Bacteria 3779330
337 8057134147 8057132660 Bacteria 4061191
338 Ga0316584_0201499
339 rootH2_10031158
340 Ga0065715_10322017
341 Ga0070658_10031187
342 Ga0070666_10001325
343 Ga0070680_100037343
344 Ga0070660_100002162
345 Ga0070691_10000026
346 Ga0070691_10000423
347 Ga0070668_100044842
348 Ga0070668_100114119
349 Ga0070669_100047794
350 Ga0070671_100054385
351 Ga0070673_100011955
352 Ga0070673_100245870
353 Ga0070659_100007064
354 Ga0070659_100023241
355 Ga0070667_100002362
356 Ga0070709_10001084
357 Ga0070714_100460415
358 Ga0070713_100000008
359 Ga0070713_100153774
360 Ga0070713_100158763
361 Ga0070713_100253727
362 Ga0070711_100169027
363 Ga0070681_10028353
364 Ga0070706_100149466
365 Ga0070679_100056119
366 Ga0070679_100137978
367 Ga0068853_100025374
368 Ga0068853_100049546
369 Ga0068853_100319017
370 Ga0070693_100060956
371 Ga0070665_100025094
372 Ga0070704_100457354
373 Ga0068855_100029133
374 Ga0068855_100040684
375 Ga0068855_100104119
376 Ga0070664_100097190
377 Ga0070664_100465231
378 Ga0068857_100000572
379 Ga0068854_100083557
380 Ga0068856_100000362
381 Ga0068852_100012265
382 Ga0068852_100806657
383 Ga0068859_100035948
384 Ga0068864_100006382
385 Ga0068851_10132476
386 Ga0068860_101028390
387 Ga0068862_100016230
388 Ga0068862_100519506
389 Ga0070712_100000435
390 Ga0075428_100021520
391 Ga0075428_100400555
392 Ga0075430_100109724
393 Ga0075434_100019465
394 Ga0075434_100167468
395 Ga0075436_100000099
396 Ga0075436_100002921
397 Ga0075436_100031551
398 Ga0097620_100035948
399 Ga0075435_100008130
400 Ga0075435_100363738
401 Ga0105240_10008089
402 Ga0111539_10021677
403 Ga0114129_11005629
404 Ga0105241_10059972
405 Ga0105241_10369786
406 Ga0105242_10184712
407 Ga0105248_10421972
408 Ga0105237_10012207
409 Ga0105238_10001957
410 Ga0105238_10019848
411 Ga0105238_10067214
412 Ga0105239_10002396
413 Ga0157373_10000393
414 Ga0157370_10006364
415 Ga0157370_10162847
416 Ga0157369_10004678
417 Ga0157369_10156713
418 Ga0163162_10633970
419 Ga0157372_10004098
420 Ga0157375_10091029
421 Ga0163163_10123537
422 Ga0163163_10171125
423 Ga0163163_10785523
424 Ga0182008_10100528
425 Ga0157379_10000809
426 Ga0157379_10002785
427 Ga0157379_10002800
428 Ga0157379_10018004
429 Ga0213871_10074692
430 Ga0224572_1002291
431 Ga0207680_10001877
432 Ga0207699_10000140
433 Ga0207705_10000130
434 Ga0207705_10377371
435 Ga0207654_10054236
436 Ga0207707_10000839
437 Ga0207707_10083396
438 Ga0207695_10135029
439 Ga0207671_10344807
440 Ga0207693_10001130
441 Ga0207663_10127686
442 Ga0207660_10000793
443 Ga0207662_10373495
444 Ga0207657_10000203
445 Ga0207652_10001704
446 Ga0207652_10016226
447 Ga0207694_10043175
448 Ga0207694_10053944
449 Ga0207650_10017209
450 Ga0207700_10000011
451 Ga0207700_10242562
452 Ga0207644_10088630
453 Ga0207644_10150502
454 Ga0207690_10101512
455 Ga0207690_10221361
456 Ga0207665_10139433
457 Ga0207691_10240147
458 Ga0207711_10097080
459 Ga0207679_10191772
460 Ga0207679_10395292
461 Ga0207667_10006070
462 Ga0207667_10018856
463 Ga0207651_10040496
464 Ga0207668_10001036
465 Ga0207668_10089107
466 Ga0207640_10039961
467 Ga0207658_10050844
468 Ga0207703_10039522
469 Ga0207703_10166629
470 Ga0207639_10055272
471 Ga0207639_10073439
472 Ga0207639_10329039
473 Ga0207678_10149069
474 Ga0207702_10000162
475 Ga0207702_10000968
476 Ga0207702_10510650
477 Ga0207641_10078289
478 Ga0207676_10052094
479 Ga0207674_10001803
480 Ga0207698_10066852
481 Ga0207698_10337387
482 Ga0268266_10099801
483 Ga0268265_10217418
484 Ga0268265_10426048
485 Ga0268264_10049049
486 Ga0268264_10930268
487 Ga0307517_10000497
488 Ga0265338_10052693
489 Ga0265338_10150070
490 Ga0265338_10340586
491 Ga0265332_10077307
492 Ga0265320_10000561
493 Ga0265325_10000677
494 Ga0265325_10002084
495 Ga0265339_10007789
496 Ga0265339_10019156
497 Ga0265316_10311361
498 Ga0265316_10546135
499 Ga0307513_10000448
500 Ga0307513_10002007
501 Ga0307513_10004437
502 Ga0265313_10026643
503 Ga0265313_10045567
504 Ga0265314_10001066
505 Ga0265314_10003381
506 Ga0265314_10004545
507 Ga0265314_10024285
508 Ga0265314_10049532
509 Ga0265342_10049352
510 Ga0316576_10025424
511 Ga0316578_10101909
512 Ga0307516_10000004
513 Ga0316583_10040129
514 Ga0373944_0150004
515 Ga0373923_0023853
516 Ga0373923_0045555
517 Ga0373932_0013397
518 Ga0373932_0076927
519 Ga0373945_0017742
520 Ga0373943_0287204
521 Ga0373931_0061144
522 Ga0373935_0237851
523 Ga0373927_0000526
524 Ga0373927_0205119
525 Ga0373933_0182067
526 Ga0373947_0027212
527 Ga0373937_0006766
528 Ga0373937_0013567
529 Ga0373937_0077347
530 Ga0373937_0172675
531 Ga0373925_0000061
532 Ga0373925_0023782
533 Ga0373925_0059238
534 Ga0395905_0265249
535 Ga0400483_082259
536 Ga0400483_135916
537 Ga0400483_154659
538 Ga0400483_205214
539 Ga0400483_217969
540 Ga0400483_260120
541 Ga0400483_279640
542 Ga0400483_288211
543 Ga0436365_0500054
544 Ga0436365_1542298
545 Ga0436360_0580037
546 Ga0451576_0000661
547 Ga0495580_0202297
548 Ga0495582_0033289
549 Ga0495628_0190838
550 Ga0495665_0027367
551 Ga0495586_0103827
552 Ga0495625_0288127
553 Ga0495657_0225706
554 Ga0495674_0067306
555 Ga0495672_0005999
556 Ga0495684_0203937
557 Ga0496100_0151099
558 Ga0496101_0010317
559 Ga0496101_0705858
560 Ga0496102_0002224
561 Ga0496102_0133896
562 Ga0496102_0308641
563 Ga0496102_0414154
564 Ga0496103_0026234
565 Ga0496104_0052920
566 Ga0496104_0056495
567 Ga0496104_0067990
568 Ga0496105_0022876
569 Ga0496106_0004642
570 Ga0496107_0002984
571 Ga0496107_0184626
572 Ga0496108_0011953
573 Ga0496108_0027044
574 Ga0496109_0009852
575 Ga0496109_0029476
576 Ga0496109_0038758
577 Ga0496110_0028561
578 Ga0496110_0060884
579 Ga0496111_0016755
580 Ga0496111_0066302
581 Ga0496111_0304196
582 Ga0496112_0091807
583 Ga0496112_0188872
584 Ga0496113_0085995
585 Ga0496114_0217731
586 Ga0496122_0020937
587 Ga0496126_0000382
588 Ga0496126_0181034
589 Ga0501032_0002879
590 Ga0501032_0067117
591 Ga0501033_0022889
592 Ga0501033_0030287
593 Ga0501033_0032973
594 Ga0501034_0000012
595 Ga0501034_0007444
596 Ga0501037_0001908
597 Ga0501037_0019872
598 Ga0501038_0004396
599 Ga0501038_0290176
600 Ga0501038_0572484
601 Ga0501039_0001573
602 Ga0501039_0273285
603 Ga0501042_0011142
604 Ga0501042_0484535
605 Ga0501043_0044199
606 Ga0501043_0048058
607 Ga0501043_0103614
608 Ga0501046_0006278
609 Ga0501047_0007287
610 Ga0501047_0014477
611 Ga0501047_0169386
612 Ga0501048_0003926
613 Ga0501067_0003131
614 Ga0501069_0131083
615 Ga0501070_0000002
616 Ga0501070_0002559
617 Ga0501071_0226154
618 Ga0501073_0000802
619 Ga0501073_0016658
620 Ga0501074_0000138
621 Ga0501074_0040721
622 Ga0501075_0212639
623 Ga0501076_0293549
624 Ga0501079_0007294
625 Ga0501079_0047737
626 Ga0501080_0001693
627 Ga0501080_0008063
628 Ga0501080_0046399
629 Ga0501080_0117816
630 Ga0501083_0008522
631 Ga0501083_0013979
632 Ga0501035_0012091
633 Ga0501035_0017376
634 Ga0501035_0027849
635 Ga0501044_0016840
636 Ga0501044_0030091
637 Ga0501044_0034767
638 Ga0501044_0049845
639 Ga0501044_0186912
640 Ga0501045_0017987
641 Ga0501045_0309944
642 nmdc:mga00v17_239358_c1
643 nmdc:mga06r32_363305_c1
644 nmdc:mga08y16_75046_c1
645 nmdc:mga0n895_25084_c1
646 nmdc:mga0n895_300949_c1
647 nmdc:mga0rr50_10688_c1
648 nmdc:mga08x19_2099_c1
649 nmdc:mga08x19_28809_c1
650 nmdc:mga08x19_394_c1
651 Ga0495619_0088205
652 Ga0495619_0315065
653 Ga0500618_020042
654 Ga0500636_0050744
655 Ga0500611_069736
656 Ga0501084_0001765
657 Ga0501082_0009503
658 Ga0501082_0016763
659 Ga0501082_0051949
660 Ga0530510_0137751
661 2512032942
662 2715499632
663 2834580742
664 2840879758
665 2848298526
666 2854683360
667 2855023366
668 2898798962
669 2899260578
670 2899276033
671 2919681205
672 3000018499
673 3000408361
674 8057134147

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

42

251

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lpq-assembly3.cif.gz_C crystal structure of cryptococcus neoformans sterylglucosidase 1 with hit 9 0.8028 6 53
5j7z-assembly1.cif.gz_A crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm1 0.7975 6 51
5j14-assembly2.cif.gz_B crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm3 0.797 6 51
5ccu-assembly1.cif.gz_B crystal structure of endoglycoceramidase i from rhodococ-cus equi 0.7953 6 51
5ccu-assembly1.cif.gz_A crystal structure of endoglycoceramidase i from rhodococ-cus equi 0.794 6 51
ID Description Score Start End Superfamily
af_A0A1D6HC20_408_528_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.831 24 51 3.40.50.10190
af_F4JC91_1_132_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8068 8 53 3.40.50.410
af_Q55CF6_73_417_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8022 7 52 3.20.20.80
af_P13458_780_1036_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7883 7 53 3.40.50.300
af_P40566_62_298_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7796 7 53 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7X4CX93-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9957 153 239 GO:0005524
GO:0005829
GO:0006225
GO:0033862
AF-A0A4V1UIY5-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9884 147 241 GO:0005524
GO:0006225
GO:0033862
AF-A0A529K8N8-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9862 144 240 GO:0005524
GO:0005829
GO:0006225
GO:0033862
AF-A0A3D5RSN6-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9781 147 241 GO:0005524
GO:0006225
GO:0033862
AF-A0A7Y2GDC9-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.977 150 239 GO:0005524
GO:0006225
GO:0033862

Map