F413165
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 212 | 674 | 239 |
Family's Representative Sequence
| Representative Sequence | 3300036712|Ga0316584_0201499|Ga0316584_0201499_169_990 |
| Length | 273 |
| Sequence | MAPLWALNLSRFSDILPPRQESETGADLMSDGSARQPAPAYKRVLLKISGEALMGDQGYGLHPPTVQRIAEEVKSVRDLGVEICMVIGGGNIFRGLAGSAQGMERTTADYMGMLATVMNALALQSALEGMGVFTRVITAIRMDEVAEPYIRRRAVRHLEKGRVCIFAAGTGNPYFTTDTAATLRANEMACEVIFKGTKVDGVYDKDPKTHPDATRYDEVTYDDCLQKNLKVMDASAIALARDNDLPIIVFSLDEPGGFRGILAGQGTYTIVHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 18 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 32 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 33 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 36 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 37 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 41 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 61 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 63 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 64 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 103 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 104 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 105 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 106 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 107 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 108 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 109 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 110 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 111 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 112 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 113 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 114 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 115 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 116 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 117 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 118 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 119 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 120 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 121 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 122 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 123 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 124 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 125 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 126 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 127 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 131 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 132 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 133 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 134 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 146 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 147 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 148 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 149 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 150 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 151 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 152 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 153 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 154 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 155 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 156 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 157 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 158 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 159 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 165 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 168 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 171 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 172 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 186 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 187 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 194 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 195 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 196 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 199 | 2511231221 | Azospirillum lipoferum 4B | Isolate | Rhizosphere |
| 200 | 2713897090 | Paracoccus sphaerophysae HAMBI 3106 | Isolate | Nodule |
| 201 | 2834578030 | Paracoccus thiocyanatus SST | Isolate | Unclassified |
| 202 | 2840878972 | Albibacillus kandeliae J95 | Isolate | Rhizosphere |
| 203 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 204 | 2854681122 | Luteovulum sphaeroides SCJ | Isolate | Unclassified |
| 205 | 2855020534 | Paracoccus endophyticus SYSUP0003 | Isolate | Stem Tuber |
| 206 | 2898795034 | Rhodobacter sp. SGA-6-6 | Isolate | Rhizosphere |
| 207 | 2899259804 | Paracoccus aeridis JC501 | Isolate | Rhizosphere |
| 208 | 2899275550 | Paracoccus hibiscisoli CCTCC AB2016182 | Isolate | Rhizosphere |
| 209 | 2919679072 | Pseudotabrizicola sp. 4114 | Isolate | Unclassified |
| 210 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 211 | 3000405567 | Rhodobacteraceae bacterium LNNU 3342 | Isolate | Rhizosphere |
| 212 | 8057132660 | Paracoccus rhizosphaerae LMG 21293 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.85 |
| Metatranscriptomes | 0 |
| Isolates | 4.15 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.19 |
| Nodule | 0.3 |
| Rhizoplane | 8.61 |
| Rhizosphere | 82.79 |
| Stem | 0 |
| Stem Tuber | 0.3 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316584_0201499 | 3300036712 | Bacteria | 1468 |
| 2 | rootH2_10031158 | 3300003320 | Bacteria | 2006 |
| 3 | Ga0065715_10322017 | 3300005293 | Bacteria | 1000 |
| 4 | Ga0070658_10031187 | 3300005327 | Bacteria | 4280 |
| 5 | Ga0070666_10001325 | 3300005335 | Bacteria | 15007 |
| 6 | Ga0070680_100037343 | 3300005336 | Bacteria | 3924 |
| 7 | Ga0070660_100002162 | 3300005339 | Bacteria | 13542 |
| 8 | Ga0070691_10000026 | 3300005341 | Bacteria | 40701 |
| 9 | Ga0070691_10000423 | 3300005341 | Bacteria | 15521 |
| 10 | Ga0070668_100044842 | 3300005347 | Bacteria | 3393 |
| 11 | Ga0070668_100114119 | 3300005347 | Bacteria | 2153 |
| 12 | Ga0070669_100047794 | 3300005353 | Bacteria | 3122 |
| 13 | Ga0070671_100054385 | 3300005355 | Bacteria | 3329 |
| 14 | Ga0070673_100011955 | 3300005364 | Bacteria | 5943 |
| 15 | Ga0070673_100245870 | 3300005364 | Bacteria | 1557 |
| 16 | Ga0070659_100007064 | 3300005366 | Bacteria | 8135 |
| 17 | Ga0070659_100023241 | 3300005366 | Bacteria | 4742 |
| 18 | Ga0070667_100002362 | 3300005367 | Bacteria | 16528 |
| 19 | Ga0070709_10001084 | 3300005434 | Bacteria | 15078 |
| 20 | Ga0070714_100460415 | 3300005435 | Bacteria | 1209 |
| 21 | Ga0070713_100000008 | 3300005436 | Bacteria | 160153 |
| 22 | Ga0070713_100153774 | 3300005436 | Bacteria | 2049 |
| 23 | Ga0070713_100158763 | 3300005436 | Bacteria | 2017 |
| 24 | Ga0070713_100253727 | 3300005436 | Bacteria | 1605 |
| 25 | Ga0070711_100169027 | 3300005439 | Bacteria | 1665 |
| 26 | Ga0070681_10028353 | 3300005458 | Bacteria | 5628 |
| 27 | Ga0070706_100149466 | 3300005467 | Bacteria | 2181 |
| 28 | Ga0070679_100056119 | 3300005530 | Bacteria | 3924 |
| 29 | Ga0070679_100137978 | 3300005530 | Bacteria | 2419 |
| 30 | Ga0068853_100025374 | 3300005539 | Bacteria | 4972 |
| 31 | Ga0068853_100049546 | 3300005539 | Bacteria | 3610 |
| 32 | Ga0068853_100319017 | 3300005539 | Bacteria | 1440 |
| 33 | Ga0070693_100060956 | 3300005547 | Bacteria | 2192 |
| 34 | Ga0070665_100025094 | 3300005548 | Bacteria | 6007 |
| 35 | Ga0070704_100457354 | 3300005549 | Bacteria | 1100 |
| 36 | Ga0068855_100029133 | 3300005563 | Bacteria | 6603 |
| 37 | Ga0068855_100040684 | 3300005563 | Bacteria | 5515 |
| 38 | Ga0068855_100104119 | 3300005563 | Bacteria | 3264 |
| 39 | Ga0070664_100097190 | 3300005564 | Bacteria | 2557 |
| 40 | Ga0070664_100465231 | 3300005564 | Bacteria | 1162 |
| 41 | Ga0068857_100000572 | 3300005577 | Bacteria | 26923 |
| 42 | Ga0068854_100083557 | 3300005578 | Bacteria | 2361 |
| 43 | Ga0068856_100000362 | 3300005614 | Bacteria | 49802 |
| 44 | Ga0068852_100012265 | 3300005616 | Bacteria | 6498 |
| 45 | Ga0068852_100806657 | 3300005616 | Bacteria | 953 |
| 46 | Ga0068859_100035948 | 3300005617 | Bacteria | 4970 |
| 47 | Ga0068864_100006382 | 3300005618 | Bacteria | 9664 |
| 48 | Ga0068851_10132476 | 3300005834 | Bacteria | 1349 |
| 49 | Ga0068860_101028390 | 3300005843 | Bacteria | 842 |
| 50 | Ga0068862_100016230 | 3300005844 | Bacteria | 6197 |
| 51 | Ga0068862_100519506 | 3300005844 | Bacteria | 1133 |
| 52 | Ga0070712_100000435 | 3300006175 | Bacteria | 23865 |
| 53 | Ga0075428_100021520 | 3300006844 | Bacteria | 7137 |
| 54 | Ga0075428_100400555 | 3300006844 | Bacteria | 1471 |
| 55 | Ga0075430_100109724 | 3300006846 | Bacteria | 2301 |
| 56 | Ga0075434_100019465 | 3300006871 | Bacteria | 6571 |
| 57 | Ga0075434_100167468 | 3300006871 | Bacteria | 2217 |
| 58 | Ga0075436_100000099 | 3300006914 | Bacteria | 51125 |
| 59 | Ga0075436_100002921 | 3300006914 | Bacteria | 11716 |
| 60 | Ga0075436_100031551 | 3300006914 | Bacteria | 3649 |
| 61 | Ga0097620_100035948 | 3300006931 | Bacteria | 4970 |
| 62 | Ga0075435_100008130 | 3300007076 | Bacteria | 7512 |
| 63 | Ga0075435_100363738 | 3300007076 | Bacteria | 1241 |
| 64 | Ga0105240_10008089 | 3300009093 | Bacteria | 15108 |
| 65 | Ga0111539_10021677 | 3300009094 | Bacteria | 7903 |
| 66 | Ga0114129_11005629 | 3300009147 | Bacteria | 1050 |
| 67 | Ga0105241_10059972 | 3300009174 | Bacteria | 2926 |
| 68 | Ga0105241_10369786 | 3300009174 | Bacteria | 1250 |
| 69 | Ga0105242_10184712 | 3300009176 | Bacteria | 1842 |
| 70 | Ga0105248_10421972 | 3300009177 | Bacteria | 1502 |
| 71 | Ga0105237_10012207 | 3300009545 | Bacteria | 9057 |
| 72 | Ga0105238_10001957 | 3300009551 | Bacteria | 20734 |
| 73 | Ga0105238_10019848 | 3300009551 | Bacteria | 6841 |
| 74 | Ga0105238_10067214 | 3300009551 | Bacteria | 3585 |
| 75 | Ga0105239_10002396 | 3300010375 | Bacteria | 23907 |
| 76 | Ga0157373_10000393 | 3300013100 | Bacteria | 35085 |
| 77 | Ga0157370_10006364 | 3300013104 | Bacteria | 13035 |
| 78 | Ga0157370_10162847 | 3300013104 | Bacteria | 2075 |
| 79 | Ga0157369_10004678 | 3300013105 | Bacteria | 16088 |
| 80 | Ga0157369_10156713 | 3300013105 | Bacteria | 2405 |
| 81 | Ga0163162_10633970 | 3300013306 | Bacteria | 1193 |
| 82 | Ga0157372_10004098 | 3300013307 | Bacteria | 15629 |
| 83 | Ga0157375_10091029 | 3300013308 | Bacteria | 3111 |
| 84 | Ga0163163_10123537 | 3300014325 | Bacteria | 2624 |
| 85 | Ga0163163_10171125 | 3300014325 | Bacteria | 2219 |
| 86 | Ga0163163_10785523 | 3300014325 | Bacteria | 1015 |
| 87 | Ga0182008_10100528 | 3300014497 | Bacteria | 1429 |
| 88 | Ga0157379_10000809 | 3300014968 | Bacteria | 25373 |
| 89 | Ga0157379_10002785 | 3300014968 | Bacteria | 14743 |
| 90 | Ga0157379_10002800 | 3300014968 | Bacteria | 14691 |
| 91 | Ga0157379_10018004 | 3300014968 | Bacteria | 6226 |
| 92 | Ga0213871_10074692 | 3300021441 | Bacteria | 963 |
| 93 | Ga0224572_1002291 | 3300024225 | Bacteria | 3062 |
| 94 | Ga0207680_10001877 | 3300025903 | Bacteria | 9861 |
| 95 | Ga0207699_10000140 | 3300025906 | Bacteria | 48523 |
| 96 | Ga0207705_10000130 | 3300025909 | Bacteria | 82082 |
| 97 | Ga0207705_10377371 | 3300025909 | Bacteria | 1095 |
| 98 | Ga0207654_10054236 | 3300025911 | Bacteria | 2316 |
| 99 | Ga0207707_10000839 | 3300025912 | Bacteria | 30215 |
| 100 | Ga0207707_10083396 | 3300025912 | Bacteria | 2791 |
| 101 | Ga0207695_10135029 | 3300025913 | Bacteria | 2421 |
| 102 | Ga0207671_10344807 | 3300025914 | Bacteria | 1180 |
| 103 | Ga0207693_10001130 | 3300025915 | Bacteria | 23920 |
| 104 | Ga0207663_10127686 | 3300025916 | Bacteria | 1752 |
| 105 | Ga0207660_10000793 | 3300025917 | Bacteria | 20929 |
| 106 | Ga0207662_10373495 | 3300025918 | Bacteria | 962 |
| 107 | Ga0207657_10000203 | 3300025919 | Bacteria | 61390 |
| 108 | Ga0207652_10001704 | 3300025921 | Bacteria | 19206 |
| 109 | Ga0207652_10016226 | 3300025921 | Bacteria | 6077 |
| 110 | Ga0207694_10043175 | 3300025924 | Bacteria | 3480 |
| 111 | Ga0207694_10053944 | 3300025924 | Bacteria | 3118 |
| 112 | Ga0207650_10017209 | 3300025925 | Bacteria | 5059 |
| 113 | Ga0207700_10000011 | 3300025928 | Bacteria | 266323 |
| 114 | Ga0207700_10242562 | 3300025928 | Bacteria | 1536 |
| 115 | Ga0207644_10088630 | 3300025931 | Bacteria | 2302 |
| 116 | Ga0207644_10150502 | 3300025931 | Bacteria | 1800 |
| 117 | Ga0207690_10101512 | 3300025932 | Bacteria | 2055 |
| 118 | Ga0207690_10221361 | 3300025932 | Bacteria | 1448 |
| 119 | Ga0207665_10139433 | 3300025939 | Bacteria | 1727 |
| 120 | Ga0207691_10240147 | 3300025940 | Bacteria | 1567 |
| 121 | Ga0207711_10097080 | 3300025941 | Bacteria | 2601 |
| 122 | Ga0207679_10191772 | 3300025945 | Bacteria | 1700 |
| 123 | Ga0207679_10395292 | 3300025945 | Bacteria | 1215 |
| 124 | Ga0207667_10006070 | 3300025949 | Bacteria | 14691 |
| 125 | Ga0207667_10018856 | 3300025949 | Bacteria | 7722 |
| 126 | Ga0207651_10040496 | 3300025960 | Bacteria | 3083 |
| 127 | Ga0207668_10001036 | 3300025972 | Bacteria | 16597 |
| 128 | Ga0207668_10089107 | 3300025972 | Bacteria | 2261 |
| 129 | Ga0207640_10039961 | 3300025981 | Bacteria | 2973 |
| 130 | Ga0207658_10050844 | 3300025986 | Bacteria | 3051 |
| 131 | Ga0207703_10039522 | 3300026035 | Bacteria | 3771 |
| 132 | Ga0207703_10166629 | 3300026035 | Bacteria | 1934 |
| 133 | Ga0207639_10055272 | 3300026041 | Bacteria | 3038 |
| 134 | Ga0207639_10073439 | 3300026041 | Bacteria | 2681 |
| 135 | Ga0207639_10329039 | 3300026041 | Bacteria | 1359 |
| 136 | Ga0207678_10149069 | 3300026067 | Bacteria | 1997 |
| 137 | Ga0207702_10000162 | 3300026078 | Bacteria | 79378 |
| 138 | Ga0207702_10000968 | 3300026078 | Bacteria | 29412 |
| 139 | Ga0207702_10510650 | 3300026078 | Bacteria | 1172 |
| 140 | Ga0207641_10078289 | 3300026088 | Bacteria | 2863 |
| 141 | Ga0207676_10052094 | 3300026095 | Bacteria | 3198 |
| 142 | Ga0207674_10001803 | 3300026116 | Bacteria | 27309 |
| 143 | Ga0207698_10066852 | 3300026142 | Bacteria | 2832 |
| 144 | Ga0207698_10337387 | 3300026142 | Bacteria | 1418 |
| 145 | Ga0268266_10099801 | 3300028379 | Bacteria | 2556 |
| 146 | Ga0268265_10217418 | 3300028380 | Bacteria | 1669 |
| 147 | Ga0268265_10426048 | 3300028380 | Bacteria | 1233 |
| 148 | Ga0268264_10049049 | 3300028381 | Bacteria | 3512 |
| 149 | Ga0268264_10930268 | 3300028381 | Bacteria | 874 |
| 150 | Ga0307517_10000497 | 3300028786 | Bacteria | 67390 |
| 151 | Ga0265338_10052693 | 3300028800 | Bacteria | 3647 |
| 152 | Ga0265338_10150070 | 3300028800 | Bacteria | 1812 |
| 153 | Ga0265338_10340586 | 3300028800 | Bacteria | 1081 |
| 154 | Ga0265332_10077307 | 3300031238 | Bacteria | 1414 |
| 155 | Ga0265320_10000561 | 3300031240 | Bacteria | 28649 |
| 156 | Ga0265325_10000677 | 3300031241 | Bacteria | 24870 |
| 157 | Ga0265325_10002084 | 3300031241 | Bacteria | 13686 |
| 158 | Ga0265339_10007789 | 3300031249 | Bacteria | 6884 |
| 159 | Ga0265339_10019156 | 3300031249 | Bacteria | 4020 |
| 160 | Ga0265316_10311361 | 3300031344 | Bacteria | 1145 |
| 161 | Ga0265316_10546135 | 3300031344 | Bacteria | 825 |
| 162 | Ga0307513_10000448 | 3300031456 | Bacteria | 59427 |
| 163 | Ga0307513_10002007 | 3300031456 | Bacteria | 28699 |
| 164 | Ga0307513_10004437 | 3300031456 | Bacteria | 18736 |
| 165 | Ga0265313_10026643 | 3300031595 | Bacteria | 3041 |
| 166 | Ga0265313_10045567 | 3300031595 | Bacteria | 2134 |
| 167 | Ga0265314_10001066 | 3300031711 | Bacteria | 31856 |
| 168 | Ga0265314_10003381 | 3300031711 | Bacteria | 15464 |
| 169 | Ga0265314_10004545 | 3300031711 | Bacteria | 12813 |
| 170 | Ga0265314_10024285 | 3300031711 | Bacteria | 4598 |
| 171 | Ga0265314_10049532 | 3300031711 | Bacteria | 2940 |
| 172 | Ga0265342_10049352 | 3300031712 | Bacteria | 2518 |
| 173 | Ga0316576_10025424 | 3300031727 | Bacteria | 4145 |
| 174 | Ga0316578_10101909 | 3300031728 | Bacteria | 1721 |
| 175 | Ga0307516_10000004 | 3300031730 | Bacteria | 367451 |
| 176 | Ga0316583_10040129 | 3300032133 | Bacteria | 1658 |
| 177 | Ga0373944_0150004 | 3300035089 | Bacteria | 821 |
| 178 | Ga0373923_0023853 | 3300035111 | Bacteria | 2411 |
| 179 | Ga0373923_0045555 | 3300035111 | Bacteria | 1822 |
| 180 | Ga0373932_0013397 | 3300035112 | Bacteria | 2039 |
| 181 | Ga0373932_0076927 | 3300035112 | Bacteria | 1047 |
| 182 | Ga0373945_0017742 | 3300035116 | Bacteria | 2414 |
| 183 | Ga0373943_0287204 | 3300035170 | Bacteria | 931 |
| 184 | Ga0373931_0061144 | 3300035691 | Bacteria | 2030 |
| 185 | Ga0373935_0237851 | 3300035692 | Bacteria | 1270 |
| 186 | Ga0373927_0000526 | 3300035695 | Bacteria | 29046 |
| 187 | Ga0373927_0205119 | 3300035695 | Bacteria | 1294 |
| 188 | Ga0373933_0182067 | 3300035724 | Bacteria | 1340 |
| 189 | Ga0373947_0027212 | 3300035725 | Bacteria | 3346 |
| 190 | Ga0373937_0006766 | 3300036401 | Bacteria | 9897 |
| 191 | Ga0373937_0013567 | 3300036401 | Bacteria | 7178 |
| 192 | Ga0373937_0077347 | 3300036401 | Bacteria | 3075 |
| 193 | Ga0373937_0172675 | 3300036401 | Bacteria | 2028 |
| 194 | Ga0373925_0000061 | 3300037068 | Bacteria | 117783 |
| 195 | Ga0373925_0023782 | 3300037068 | Bacteria | 4469 |
| 196 | Ga0373925_0059238 | 3300037068 | Bacteria | 2872 |
| 197 | Ga0395905_0265249 | 3300037471 | Bacteria | 1603 |
| 198 | Ga0400483_082259 | 3300039062 | Bacteria | 1122 |
| 199 | Ga0400483_135916 | 3300039062 | Bacteria | 2087 |
| 200 | Ga0400483_154659 | 3300039062 | Bacteria | 2976 |
| 201 | Ga0400483_205214 | 3300039062 | Bacteria | 1434 |
| 202 | Ga0400483_217969 | 3300039062 | Bacteria | 1371 |
| 203 | Ga0400483_260120 | 3300039062 | Bacteria | 1279 |
| 204 | Ga0400483_279640 | 3300039062 | Bacteria | 1501 |
| 205 | Ga0400483_288211 | 3300039062 | Bacteria | 3663 |
| 206 | Ga0436365_0500054 | 3300039437 | Bacteria | 2183 |
| 207 | Ga0436365_1542298 | 3300039437 | Bacteria | 914 |
| 208 | Ga0436360_0580037 | 3300039438 | Bacteria | 1754 |
| 209 | Ga0451576_0000661 | 3300045051 | Bacteria | 71055 |
| 210 | Ga0495580_0202297 | 3300046472 | Bacteria | 1368 |
| 211 | Ga0495582_0033289 | 3300046473 | Bacteria | 2833 |
| 212 | Ga0495628_0190838 | 3300046516 | Bacteria | 1547 |
| 213 | Ga0495665_0027367 | 3300046531 | Bacteria | 3060 |
| 214 | Ga0495586_0103827 | 3300046535 | Bacteria | 1579 |
| 215 | Ga0495625_0288127 | 3300046660 | Bacteria | 1054 |
| 216 | Ga0495657_0225706 | 3300046675 | Bacteria | 1134 |
| 217 | Ga0495674_0067306 | 3300047319 | Bacteria | 3104 |
| 218 | Ga0495672_0005999 | 3300047320 | Bacteria | 9513 |
| 219 | Ga0495684_0203937 | 3300047471 | Bacteria | 1457 |
| 220 | Ga0496100_0151099 | 3300048903 | Bacteria | 1656 |
| 221 | Ga0496101_0010317 | 3300048904 | Bacteria | 6169 |
| 222 | Ga0496101_0705858 | 3300048904 | Bacteria | 796 |
| 223 | Ga0496102_0002224 | 3300048905 | Bacteria | 16640 |
| 224 | Ga0496102_0133896 | 3300048905 | Bacteria | 2321 |
| 225 | Ga0496102_0308641 | 3300048905 | Bacteria | 1491 |
| 226 | Ga0496102_0414154 | 3300048905 | Bacteria | 1266 |
| 227 | Ga0496103_0026234 | 3300048906 | Bacteria | 3528 |
| 228 | Ga0496104_0052920 | 3300048907 | Bacteria | 3835 |
| 229 | Ga0496104_0056495 | 3300048907 | Bacteria | 3712 |
| 230 | Ga0496104_0067990 | 3300048907 | Bacteria | 3385 |
| 231 | Ga0496105_0022876 | 3300048908 | Bacteria | 5066 |
| 232 | Ga0496106_0004642 | 3300048909 | Bacteria | 10189 |
| 233 | Ga0496107_0002984 | 3300048910 | Bacteria | 11209 |
| 234 | Ga0496107_0184626 | 3300048910 | Bacteria | 1549 |
| 235 | Ga0496108_0011953 | 3300048911 | Bacteria | 7062 |
| 236 | Ga0496108_0027044 | 3300048911 | Bacteria | 4733 |
| 237 | Ga0496109_0009852 | 3300048912 | Bacteria | 8156 |
| 238 | Ga0496109_0029476 | 3300048912 | Bacteria | 4915 |
| 239 | Ga0496109_0038758 | 3300048912 | Bacteria | 4310 |
| 240 | Ga0496110_0028561 | 3300048913 | Bacteria | 4792 |
| 241 | Ga0496110_0060884 | 3300048913 | Bacteria | 3330 |
| 242 | Ga0496111_0016755 | 3300048914 | Bacteria | 5055 |
| 243 | Ga0496111_0066302 | 3300048914 | Bacteria | 2621 |
| 244 | Ga0496111_0304196 | 3300048914 | Bacteria | 1182 |
| 245 | Ga0496112_0091807 | 3300048915 | Bacteria | 3005 |
| 246 | Ga0496112_0188872 | 3300048915 | Bacteria | 2023 |
| 247 | Ga0496113_0085995 | 3300048916 | Bacteria | 2416 |
| 248 | Ga0496114_0217731 | 3300048917 | Bacteria | 1676 |
| 249 | Ga0496122_0020937 | 3300048925 | Bacteria | 5878 |
| 250 | Ga0496126_0000382 | 3300048929 | Bacteria | 91611 |
| 251 | Ga0496126_0181034 | 3300048929 | Bacteria | 1790 |
| 252 | Ga0501032_0002879 | 3300049569 | Bacteria | 13385 |
| 253 | Ga0501032_0067117 | 3300049569 | Bacteria | 2397 |
| 254 | Ga0501033_0022889 | 3300049570 | Bacteria | 4710 |
| 255 | Ga0501033_0030287 | 3300049570 | Bacteria | 4067 |
| 256 | Ga0501033_0032973 | 3300049570 | Bacteria | 3889 |
| 257 | Ga0501034_0000012 | 3300049571 | Bacteria | 310504 |
| 258 | Ga0501034_0007444 | 3300049571 | Bacteria | 11652 |
| 259 | Ga0501037_0001908 | 3300049573 | Bacteria | 15140 |
| 260 | Ga0501037_0019872 | 3300049573 | Bacteria | 4957 |
| 261 | Ga0501038_0004396 | 3300049574 | Bacteria | 13117 |
| 262 | Ga0501038_0290176 | 3300049574 | Bacteria | 1286 |
| 263 | Ga0501038_0572484 | 3300049574 | Bacteria | 857 |
| 264 | Ga0501039_0001573 | 3300049575 | Bacteria | 16801 |
| 265 | Ga0501039_0273285 | 3300049575 | Bacteria | 1328 |
| 266 | Ga0501042_0011142 | 3300049578 | Bacteria | 6058 |
| 267 | Ga0501042_0484535 | 3300049578 | Bacteria | 898 |
| 268 | Ga0501043_0044199 | 3300049579 | Bacteria | 3502 |
| 269 | Ga0501043_0048058 | 3300049579 | Bacteria | 3354 |
| 270 | Ga0501043_0103614 | 3300049579 | Bacteria | 2236 |
| 271 | Ga0501046_0006278 | 3300049580 | Bacteria | 10541 |
| 272 | Ga0501047_0007287 | 3300049581 | Bacteria | 10398 |
| 273 | Ga0501047_0014477 | 3300049581 | Bacteria | 7501 |
| 274 | Ga0501047_0169386 | 3300049581 | Bacteria | 2053 |
| 275 | Ga0501048_0003926 | 3300049582 | Bacteria | 11295 |
| 276 | Ga0501067_0003131 | 3300049583 | Bacteria | 9134 |
| 277 | Ga0501069_0131083 | 3300049585 | Bacteria | 1435 |
| 278 | Ga0501070_0000002 | 3300049586 | Bacteria | 347524 |
| 279 | Ga0501070_0002559 | 3300049586 | Bacteria | 15917 |
| 280 | Ga0501071_0226154 | 3300049587 | Bacteria | 1409 |
| 281 | Ga0501073_0000802 | 3300049589 | Bacteria | 22364 |
| 282 | Ga0501073_0016658 | 3300049589 | Bacteria | 5326 |
| 283 | Ga0501074_0000138 | 3300049590 | Bacteria | 37896 |
| 284 | Ga0501074_0040721 | 3300049590 | Bacteria | 3364 |
| 285 | Ga0501075_0212639 | 3300049591 | Bacteria | 1475 |
| 286 | Ga0501076_0293549 | 3300049592 | Bacteria | 1332 |
| 287 | Ga0501079_0007294 | 3300049741 | Bacteria | 8348 |
| 288 | Ga0501079_0047737 | 3300049741 | Bacteria | 3304 |
| 289 | Ga0501080_0001693 | 3300049742 | Bacteria | 18802 |
| 290 | Ga0501080_0008063 | 3300049742 | Bacteria | 9546 |
| 291 | Ga0501080_0046399 | 3300049742 | Bacteria | 4045 |
| 292 | Ga0501080_0117816 | 3300049742 | Bacteria | 2462 |
| 293 | Ga0501083_0008522 | 3300049744 | Bacteria | 7238 |
| 294 | Ga0501083_0013979 | 3300049744 | Bacteria | 5609 |
| 295 | Ga0501035_0012091 | 3300049822 | Bacteria | 7980 |
| 296 | Ga0501035_0017376 | 3300049822 | Bacteria | 6632 |
| 297 | Ga0501035_0027849 | 3300049822 | Bacteria | 5163 |
| 298 | Ga0501044_0016840 | 3300049823 | Bacteria | 7841 |
| 299 | Ga0501044_0030091 | 3300049823 | Bacteria | 5722 |
| 300 | Ga0501044_0034767 | 3300049823 | Bacteria | 5282 |
| 301 | Ga0501044_0049845 | 3300049823 | Bacteria | 4322 |
| 302 | Ga0501044_0186912 | 3300049823 | Bacteria | 2036 |
| 303 | Ga0501045_0017987 | 3300049824 | Bacteria | 5019 |
| 304 | Ga0501045_0309944 | 3300049824 | Bacteria | 1175 |
| 305 | nmdc:mga00v17_239358_c1 | 3300050491 | Bacteria | 1176 |
| 306 | nmdc:mga06r32_363305_c1 | 3300050510 | Bacteria | 1431 |
| 307 | nmdc:mga08y16_75046_c1 | 3300050511 | Bacteria | 3525 |
| 308 | nmdc:mga0n895_25084_c1 | 3300050512 | Bacteria | 5628 |
| 309 | nmdc:mga0n895_300949_c1 | 3300050512 | Bacteria | 1626 |
| 310 | nmdc:mga0rr50_10688_c1 | 3300050513 | Bacteria | 5842 |
| 311 | nmdc:mga08x19_2099_c1 | 3300050514 | Bacteria | 12187 |
| 312 | nmdc:mga08x19_28809_c1 | 3300050514 | Bacteria | 3481 |
| 313 | nmdc:mga08x19_394_c1 | 3300050514 | Bacteria | 30675 |
| 314 | Ga0495619_0088205 | 3300053085 | Bacteria | 2098 |
| 315 | Ga0495619_0315065 | 3300053085 | Bacteria | 1083 |
| 316 | Ga0500618_020042 | 3300053125 | Bacteria | 1641 |
| 317 | Ga0500636_0050744 | 3300053177 | Bacteria | 2440 |
| 318 | Ga0500611_069736 | 3300053727 | Bacteria | 853 |
| 319 | Ga0501084_0001765 | 3300054114 | Bacteria | 17203 |
| 320 | Ga0501082_0009503 | 3300060353 | Bacteria | 8369 |
| 321 | Ga0501082_0016763 | 3300060353 | Bacteria | 6309 |
| 322 | Ga0501082_0051949 | 3300060353 | Bacteria | 3533 |
| 323 | Ga0530510_0137751 | 3300061734 | Bacteria | 1797 |
| 324 | 2512032942 | 2511231221 | Bacteria | 6846400 |
| 325 | 2715499632 | 2713897090 | Bacteria | 3353799 |
| 326 | 2834580742 | 2834578030 | Bacteria | 3530182 |
| 327 | 2840879758 | 2840878972 | Bacteria | 5483153 |
| 328 | 2848298526 | 2848297114 | Bacteria | 3608511 |
| 329 | 2854683360 | 2854681122 | Bacteria | 4548679 |
| 330 | 2855023366 | 2855020534 | Bacteria | 3204685 |
| 331 | 2898798962 | 2898795034 | Bacteria | 4294459 |
| 332 | 2899260578 | 2899259804 | Bacteria | 3320927 |
| 333 | 2899276033 | 2899275550 | Bacteria | 3958688 |
| 334 | 2919681205 | 2919679072 | Bacteria | 4629602 |
| 335 | 3000018499 | 3000017691 | Bacteria | 3772574 |
| 336 | 3000408361 | 3000405567 | Bacteria | 3779330 |
| 337 | 8057134147 | 8057132660 | Bacteria | 4061191 |
| 338 | Ga0316584_0201499 | |||
| 339 | rootH2_10031158 | |||
| 340 | Ga0065715_10322017 | |||
| 341 | Ga0070658_10031187 | |||
| 342 | Ga0070666_10001325 | |||
| 343 | Ga0070680_100037343 | |||
| 344 | Ga0070660_100002162 | |||
| 345 | Ga0070691_10000026 | |||
| 346 | Ga0070691_10000423 | |||
| 347 | Ga0070668_100044842 | |||
| 348 | Ga0070668_100114119 | |||
| 349 | Ga0070669_100047794 | |||
| 350 | Ga0070671_100054385 | |||
| 351 | Ga0070673_100011955 | |||
| 352 | Ga0070673_100245870 | |||
| 353 | Ga0070659_100007064 | |||
| 354 | Ga0070659_100023241 | |||
| 355 | Ga0070667_100002362 | |||
| 356 | Ga0070709_10001084 | |||
| 357 | Ga0070714_100460415 | |||
| 358 | Ga0070713_100000008 | |||
| 359 | Ga0070713_100153774 | |||
| 360 | Ga0070713_100158763 | |||
| 361 | Ga0070713_100253727 | |||
| 362 | Ga0070711_100169027 | |||
| 363 | Ga0070681_10028353 | |||
| 364 | Ga0070706_100149466 | |||
| 365 | Ga0070679_100056119 | |||
| 366 | Ga0070679_100137978 | |||
| 367 | Ga0068853_100025374 | |||
| 368 | Ga0068853_100049546 | |||
| 369 | Ga0068853_100319017 | |||
| 370 | Ga0070693_100060956 | |||
| 371 | Ga0070665_100025094 | |||
| 372 | Ga0070704_100457354 | |||
| 373 | Ga0068855_100029133 | |||
| 374 | Ga0068855_100040684 | |||
| 375 | Ga0068855_100104119 | |||
| 376 | Ga0070664_100097190 | |||
| 377 | Ga0070664_100465231 | |||
| 378 | Ga0068857_100000572 | |||
| 379 | Ga0068854_100083557 | |||
| 380 | Ga0068856_100000362 | |||
| 381 | Ga0068852_100012265 | |||
| 382 | Ga0068852_100806657 | |||
| 383 | Ga0068859_100035948 | |||
| 384 | Ga0068864_100006382 | |||
| 385 | Ga0068851_10132476 | |||
| 386 | Ga0068860_101028390 | |||
| 387 | Ga0068862_100016230 | |||
| 388 | Ga0068862_100519506 | |||
| 389 | Ga0070712_100000435 | |||
| 390 | Ga0075428_100021520 | |||
| 391 | Ga0075428_100400555 | |||
| 392 | Ga0075430_100109724 | |||
| 393 | Ga0075434_100019465 | |||
| 394 | Ga0075434_100167468 | |||
| 395 | Ga0075436_100000099 | |||
| 396 | Ga0075436_100002921 | |||
| 397 | Ga0075436_100031551 | |||
| 398 | Ga0097620_100035948 | |||
| 399 | Ga0075435_100008130 | |||
| 400 | Ga0075435_100363738 | |||
| 401 | Ga0105240_10008089 | |||
| 402 | Ga0111539_10021677 | |||
| 403 | Ga0114129_11005629 | |||
| 404 | Ga0105241_10059972 | |||
| 405 | Ga0105241_10369786 | |||
| 406 | Ga0105242_10184712 | |||
| 407 | Ga0105248_10421972 | |||
| 408 | Ga0105237_10012207 | |||
| 409 | Ga0105238_10001957 | |||
| 410 | Ga0105238_10019848 | |||
| 411 | Ga0105238_10067214 | |||
| 412 | Ga0105239_10002396 | |||
| 413 | Ga0157373_10000393 | |||
| 414 | Ga0157370_10006364 | |||
| 415 | Ga0157370_10162847 | |||
| 416 | Ga0157369_10004678 | |||
| 417 | Ga0157369_10156713 | |||
| 418 | Ga0163162_10633970 | |||
| 419 | Ga0157372_10004098 | |||
| 420 | Ga0157375_10091029 | |||
| 421 | Ga0163163_10123537 | |||
| 422 | Ga0163163_10171125 | |||
| 423 | Ga0163163_10785523 | |||
| 424 | Ga0182008_10100528 | |||
| 425 | Ga0157379_10000809 | |||
| 426 | Ga0157379_10002785 | |||
| 427 | Ga0157379_10002800 | |||
| 428 | Ga0157379_10018004 | |||
| 429 | Ga0213871_10074692 | |||
| 430 | Ga0224572_1002291 | |||
| 431 | Ga0207680_10001877 | |||
| 432 | Ga0207699_10000140 | |||
| 433 | Ga0207705_10000130 | |||
| 434 | Ga0207705_10377371 | |||
| 435 | Ga0207654_10054236 | |||
| 436 | Ga0207707_10000839 | |||
| 437 | Ga0207707_10083396 | |||
| 438 | Ga0207695_10135029 | |||
| 439 | Ga0207671_10344807 | |||
| 440 | Ga0207693_10001130 | |||
| 441 | Ga0207663_10127686 | |||
| 442 | Ga0207660_10000793 | |||
| 443 | Ga0207662_10373495 | |||
| 444 | Ga0207657_10000203 | |||
| 445 | Ga0207652_10001704 | |||
| 446 | Ga0207652_10016226 | |||
| 447 | Ga0207694_10043175 | |||
| 448 | Ga0207694_10053944 | |||
| 449 | Ga0207650_10017209 | |||
| 450 | Ga0207700_10000011 | |||
| 451 | Ga0207700_10242562 | |||
| 452 | Ga0207644_10088630 | |||
| 453 | Ga0207644_10150502 | |||
| 454 | Ga0207690_10101512 | |||
| 455 | Ga0207690_10221361 | |||
| 456 | Ga0207665_10139433 | |||
| 457 | Ga0207691_10240147 | |||
| 458 | Ga0207711_10097080 | |||
| 459 | Ga0207679_10191772 | |||
| 460 | Ga0207679_10395292 | |||
| 461 | Ga0207667_10006070 | |||
| 462 | Ga0207667_10018856 | |||
| 463 | Ga0207651_10040496 | |||
| 464 | Ga0207668_10001036 | |||
| 465 | Ga0207668_10089107 | |||
| 466 | Ga0207640_10039961 | |||
| 467 | Ga0207658_10050844 | |||
| 468 | Ga0207703_10039522 | |||
| 469 | Ga0207703_10166629 | |||
| 470 | Ga0207639_10055272 | |||
| 471 | Ga0207639_10073439 | |||
| 472 | Ga0207639_10329039 | |||
| 473 | Ga0207678_10149069 | |||
| 474 | Ga0207702_10000162 | |||
| 475 | Ga0207702_10000968 | |||
| 476 | Ga0207702_10510650 | |||
| 477 | Ga0207641_10078289 | |||
| 478 | Ga0207676_10052094 | |||
| 479 | Ga0207674_10001803 | |||
| 480 | Ga0207698_10066852 | |||
| 481 | Ga0207698_10337387 | |||
| 482 | Ga0268266_10099801 | |||
| 483 | Ga0268265_10217418 | |||
| 484 | Ga0268265_10426048 | |||
| 485 | Ga0268264_10049049 | |||
| 486 | Ga0268264_10930268 | |||
| 487 | Ga0307517_10000497 | |||
| 488 | Ga0265338_10052693 | |||
| 489 | Ga0265338_10150070 | |||
| 490 | Ga0265338_10340586 | |||
| 491 | Ga0265332_10077307 | |||
| 492 | Ga0265320_10000561 | |||
| 493 | Ga0265325_10000677 | |||
| 494 | Ga0265325_10002084 | |||
| 495 | Ga0265339_10007789 | |||
| 496 | Ga0265339_10019156 | |||
| 497 | Ga0265316_10311361 | |||
| 498 | Ga0265316_10546135 | |||
| 499 | Ga0307513_10000448 | |||
| 500 | Ga0307513_10002007 | |||
| 501 | Ga0307513_10004437 | |||
| 502 | Ga0265313_10026643 | |||
| 503 | Ga0265313_10045567 | |||
| 504 | Ga0265314_10001066 | |||
| 505 | Ga0265314_10003381 | |||
| 506 | Ga0265314_10004545 | |||
| 507 | Ga0265314_10024285 | |||
| 508 | Ga0265314_10049532 | |||
| 509 | Ga0265342_10049352 | |||
| 510 | Ga0316576_10025424 | |||
| 511 | Ga0316578_10101909 | |||
| 512 | Ga0307516_10000004 | |||
| 513 | Ga0316583_10040129 | |||
| 514 | Ga0373944_0150004 | |||
| 515 | Ga0373923_0023853 | |||
| 516 | Ga0373923_0045555 | |||
| 517 | Ga0373932_0013397 | |||
| 518 | Ga0373932_0076927 | |||
| 519 | Ga0373945_0017742 | |||
| 520 | Ga0373943_0287204 | |||
| 521 | Ga0373931_0061144 | |||
| 522 | Ga0373935_0237851 | |||
| 523 | Ga0373927_0000526 | |||
| 524 | Ga0373927_0205119 | |||
| 525 | Ga0373933_0182067 | |||
| 526 | Ga0373947_0027212 | |||
| 527 | Ga0373937_0006766 | |||
| 528 | Ga0373937_0013567 | |||
| 529 | Ga0373937_0077347 | |||
| 530 | Ga0373937_0172675 | |||
| 531 | Ga0373925_0000061 | |||
| 532 | Ga0373925_0023782 | |||
| 533 | Ga0373925_0059238 | |||
| 534 | Ga0395905_0265249 | |||
| 535 | Ga0400483_082259 | |||
| 536 | Ga0400483_135916 | |||
| 537 | Ga0400483_154659 | |||
| 538 | Ga0400483_205214 | |||
| 539 | Ga0400483_217969 | |||
| 540 | Ga0400483_260120 | |||
| 541 | Ga0400483_279640 | |||
| 542 | Ga0400483_288211 | |||
| 543 | Ga0436365_0500054 | |||
| 544 | Ga0436365_1542298 | |||
| 545 | Ga0436360_0580037 | |||
| 546 | Ga0451576_0000661 | |||
| 547 | Ga0495580_0202297 | |||
| 548 | Ga0495582_0033289 | |||
| 549 | Ga0495628_0190838 | |||
| 550 | Ga0495665_0027367 | |||
| 551 | Ga0495586_0103827 | |||
| 552 | Ga0495625_0288127 | |||
| 553 | Ga0495657_0225706 | |||
| 554 | Ga0495674_0067306 | |||
| 555 | Ga0495672_0005999 | |||
| 556 | Ga0495684_0203937 | |||
| 557 | Ga0496100_0151099 | |||
| 558 | Ga0496101_0010317 | |||
| 559 | Ga0496101_0705858 | |||
| 560 | Ga0496102_0002224 | |||
| 561 | Ga0496102_0133896 | |||
| 562 | Ga0496102_0308641 | |||
| 563 | Ga0496102_0414154 | |||
| 564 | Ga0496103_0026234 | |||
| 565 | Ga0496104_0052920 | |||
| 566 | Ga0496104_0056495 | |||
| 567 | Ga0496104_0067990 | |||
| 568 | Ga0496105_0022876 | |||
| 569 | Ga0496106_0004642 | |||
| 570 | Ga0496107_0002984 | |||
| 571 | Ga0496107_0184626 | |||
| 572 | Ga0496108_0011953 | |||
| 573 | Ga0496108_0027044 | |||
| 574 | Ga0496109_0009852 | |||
| 575 | Ga0496109_0029476 | |||
| 576 | Ga0496109_0038758 | |||
| 577 | Ga0496110_0028561 | |||
| 578 | Ga0496110_0060884 | |||
| 579 | Ga0496111_0016755 | |||
| 580 | Ga0496111_0066302 | |||
| 581 | Ga0496111_0304196 | |||
| 582 | Ga0496112_0091807 | |||
| 583 | Ga0496112_0188872 | |||
| 584 | Ga0496113_0085995 | |||
| 585 | Ga0496114_0217731 | |||
| 586 | Ga0496122_0020937 | |||
| 587 | Ga0496126_0000382 | |||
| 588 | Ga0496126_0181034 | |||
| 589 | Ga0501032_0002879 | |||
| 590 | Ga0501032_0067117 | |||
| 591 | Ga0501033_0022889 | |||
| 592 | Ga0501033_0030287 | |||
| 593 | Ga0501033_0032973 | |||
| 594 | Ga0501034_0000012 | |||
| 595 | Ga0501034_0007444 | |||
| 596 | Ga0501037_0001908 | |||
| 597 | Ga0501037_0019872 | |||
| 598 | Ga0501038_0004396 | |||
| 599 | Ga0501038_0290176 | |||
| 600 | Ga0501038_0572484 | |||
| 601 | Ga0501039_0001573 | |||
| 602 | Ga0501039_0273285 | |||
| 603 | Ga0501042_0011142 | |||
| 604 | Ga0501042_0484535 | |||
| 605 | Ga0501043_0044199 | |||
| 606 | Ga0501043_0048058 | |||
| 607 | Ga0501043_0103614 | |||
| 608 | Ga0501046_0006278 | |||
| 609 | Ga0501047_0007287 | |||
| 610 | Ga0501047_0014477 | |||
| 611 | Ga0501047_0169386 | |||
| 612 | Ga0501048_0003926 | |||
| 613 | Ga0501067_0003131 | |||
| 614 | Ga0501069_0131083 | |||
| 615 | Ga0501070_0000002 | |||
| 616 | Ga0501070_0002559 | |||
| 617 | Ga0501071_0226154 | |||
| 618 | Ga0501073_0000802 | |||
| 619 | Ga0501073_0016658 | |||
| 620 | Ga0501074_0000138 | |||
| 621 | Ga0501074_0040721 | |||
| 622 | Ga0501075_0212639 | |||
| 623 | Ga0501076_0293549 | |||
| 624 | Ga0501079_0007294 | |||
| 625 | Ga0501079_0047737 | |||
| 626 | Ga0501080_0001693 | |||
| 627 | Ga0501080_0008063 | |||
| 628 | Ga0501080_0046399 | |||
| 629 | Ga0501080_0117816 | |||
| 630 | Ga0501083_0008522 | |||
| 631 | Ga0501083_0013979 | |||
| 632 | Ga0501035_0012091 | |||
| 633 | Ga0501035_0017376 | |||
| 634 | Ga0501035_0027849 | |||
| 635 | Ga0501044_0016840 | |||
| 636 | Ga0501044_0030091 | |||
| 637 | Ga0501044_0034767 | |||
| 638 | Ga0501044_0049845 | |||
| 639 | Ga0501044_0186912 | |||
| 640 | Ga0501045_0017987 | |||
| 641 | Ga0501045_0309944 | |||
| 642 | nmdc:mga00v17_239358_c1 | |||
| 643 | nmdc:mga06r32_363305_c1 | |||
| 644 | nmdc:mga08y16_75046_c1 | |||
| 645 | nmdc:mga0n895_25084_c1 | |||
| 646 | nmdc:mga0n895_300949_c1 | |||
| 647 | nmdc:mga0rr50_10688_c1 | |||
| 648 | nmdc:mga08x19_2099_c1 | |||
| 649 | nmdc:mga08x19_28809_c1 | |||
| 650 | nmdc:mga08x19_394_c1 | |||
| 651 | Ga0495619_0088205 | |||
| 652 | Ga0495619_0315065 | |||
| 653 | Ga0500618_020042 | |||
| 654 | Ga0500636_0050744 | |||
| 655 | Ga0500611_069736 | |||
| 656 | Ga0501084_0001765 | |||
| 657 | Ga0501082_0009503 | |||
| 658 | Ga0501082_0016763 | |||
| 659 | Ga0501082_0051949 | |||
| 660 | Ga0530510_0137751 | |||
| 661 | 2512032942 | |||
| 662 | 2715499632 | |||
| 663 | 2834580742 | |||
| 664 | 2840879758 | |||
| 665 | 2848298526 | |||
| 666 | 2854683360 | |||
| 667 | 2855023366 | |||
| 668 | 2898798962 | |||
| 669 | 2899260578 | |||
| 670 | 2899276033 | |||
| 671 | 2919681205 | |||
| 672 | 3000018499 | |||
| 673 | 3000408361 | |||
| 674 | 8057134147 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7lpq-assembly3.cif.gz_C | crystal structure of cryptococcus neoformans sterylglucosidase 1 with hit 9 | 0.8028 | 6 | 53 |
| 5j7z-assembly1.cif.gz_A | crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm1 | 0.7975 | 6 | 51 |
| 5j14-assembly2.cif.gz_B | crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm3 | 0.797 | 6 | 51 |
| 5ccu-assembly1.cif.gz_B | crystal structure of endoglycoceramidase i from rhodococ-cus equi | 0.7953 | 6 | 51 |
| 5ccu-assembly1.cif.gz_A | crystal structure of endoglycoceramidase i from rhodococ-cus equi | 0.794 | 6 | 51 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6HC20_408_528_3.40.50.10190 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain | 0.831 | 24 | 51 | 3.40.50.10190 |
| af_F4JC91_1_132_3.40.50.410 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain | 0.8068 | 8 | 53 | 3.40.50.410 |
| af_Q55CF6_73_417_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.8022 | 7 | 52 | 3.20.20.80 |
| af_P13458_780_1036_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7883 | 7 | 53 | 3.40.50.300 |
| af_P40566_62_298_3.20.20.80 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases | 0.7796 | 7 | 53 | 3.20.20.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X4CX93-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9957 | 153 | 239 |
GO:0005524
GO:0005829 GO:0006225 GO:0033862 |
| AF-A0A4V1UIY5-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9884 | 147 | 241 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A529K8N8-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9862 | 144 | 240 |
GO:0005524
GO:0005829 GO:0006225 GO:0033862 |
| AF-A0A3D5RSN6-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.9781 | 147 | 241 |
GO:0005524
GO:0006225 GO:0033862 |
| AF-A0A7Y2GDC9-F1-model_v4 | UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) | 0.977 | 150 | 239 |
GO:0005524
GO:0006225 GO:0033862 |