F413180

General Info

Members Datasets Scaffolds Average Seq Length
337 226 674 146

Family's Representative Sequence

Representative Sequence 3300041491|Ga0451833_0300046|Ga0451833_0300046_89_613
Length 174
Sequence MLSWLGKKMIARNMARASAGDIAPTLKMDAEDVRFRFPGDSSWGGEIRGKRELEKWLRRFADTGLQISPDEVVLKGFPWKQTICIRGTDHLDTPEGERVYENRYVIWGHIRWGLLRDYEVYEDTQKSKALDEYLAARSDPYERLTALVGNTAGGQVDDASAVMVMVHQIRQVVA

Samples

Sample ID Description Type Environment
1 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
129 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
130 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
134 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
148 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
149 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
150 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
163 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
164 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
165 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
170 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
171 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
172 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
175 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
189 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
190 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 11.87
Rhizosphere 85.46
Stem 0
Stem Tuber 0
Unclassified 8.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451833_0300046 3300041491 Bacteria 681
2 LJNas_1028072 3300000546 Bacteria 603
3 JGI24748J21848_1004831 3300002074 Bacteria 1552
4 JGI24744J21845_10021457 3300002077 Bacteria 1270
5 JGI24034J26672_10000072 3300002239 Bacteria 25672
6 JGI25406J46586_10109147 3300003203 Unclassified 820
7 Ga0070658_10424084 3300005327 Bacteria 1144
8 Ga0070683_100018331 3300005329 Bacteria 6197
9 Ga0070690_100682484 3300005330 Bacteria 787
10 Ga0068869_100231015 3300005334 Bacteria 1470
11 Ga0070682_100175009 3300005337 Bacteria 1494
12 Ga0070682_100686889 3300005337 Unclassified 819
13 Ga0068868_100041450 3300005338 Bacteria 3587
14 Ga0070689_100032489 3300005340 Bacteria 3970
15 Ga0070691_10000003 3300005341 Bacteria 86538
16 Ga0070661_100040357 3300005344 Bacteria 3405
17 Ga0070668_100037466 3300005347 Bacteria 3703
18 Ga0070675_100095849 3300005354 Bacteria 2492
19 Ga0070671_100075990 3300005355 Bacteria 2806
20 Ga0070674_100000021 3300005356 Bacteria 87134
21 Ga0070674_100000075 3300005356 Bacteria 45822
22 Ga0070673_100053915 3300005364 Bacteria 3161
23 Ga0070688_100112992 3300005365 Bacteria 1809
24 Ga0070667_100356459 3300005367 Bacteria 1325
25 Ga0070714_100049650 3300005435 Bacteria 3572
26 Ga0070714_100195468 3300005435 Bacteria 1848
27 Ga0070714_100606837 3300005435 Unclassified 1051
28 Ga0070713_100065208 3300005436 Bacteria 3058
29 Ga0070713_102328883 3300005436 Bacteria 518
30 Ga0070710_10100267 3300005437 Unclassified 1723
31 Ga0070711_100060328 3300005439 Bacteria 2637
32 Ga0070705_100050291 3300005440 Bacteria 2424
33 Ga0070700_100018446 3300005441 Bacteria 4011
34 Ga0070700_100298839 3300005441 Bacteria 1174
35 Ga0070694_100181753 3300005444 Bacteria 1556
36 Ga0070694_100999797 3300005444 Unclassified 694
37 Ga0070663_100136722 3300005455 Bacteria 1867
38 Ga0070678_100094289 3300005456 Bacteria 2304
39 Ga0070662_100028924 3300005457 Bacteria 3862
40 Ga0068867_100035861 3300005459 Bacteria 3599
41 Ga0070685_10208500 3300005466 Bacteria 1274
42 Ga0070684_100013797 3300005535 Bacteria 6523
43 Ga0070684_100111403 3300005535 Bacteria 2454
44 Ga0070686_100023585 3300005544 Bacteria 3679
45 Ga0070695_100203172 3300005545 Bacteria 1417
46 Ga0070695_100347416 3300005545 Bacteria 1110
47 Ga0070693_100091085 3300005547 Bacteria 1838
48 Ga0070693_101289894 3300005547 Bacteria 564
49 Ga0070665_100050754 3300005548 Bacteria 4163
50 Ga0070665_101151214 3300005548 Bacteria 787
51 Ga0070704_100032903 3300005549 Bacteria 3502
52 Ga0068855_100294328 3300005563 Bacteria 1799
53 Ga0068855_100732930 3300005563 Unclassified 1055
54 Ga0070664_100039147 3300005564 Bacteria 3993
55 Ga0070664_100838884 3300005564 Bacteria 860
56 Ga0068857_100169314 3300005577 Bacteria 1985
57 Ga0068856_100081106 3300005614 Bacteria 3218
58 Ga0068856_100102468 3300005614 Bacteria 2856
59 Ga0068856_100909005 3300005614 Bacteria 899
60 Ga0068852_100037402 3300005616 Bacteria 4069
61 Ga0068852_100667368 3300005616 Bacteria 1048
62 Ga0068859_100207928 3300005617 Bacteria 2043
63 Ga0068864_100036766 3300005618 Bacteria 4176
64 Ga0068866_10000007 3300005718 Bacteria 121729
65 Ga0068866_10000469 3300005718 Bacteria 18473
66 Ga0068866_10037280 3300005718 Bacteria 2387
67 Ga0068866_10224568 3300005718 Unclassified 1135
68 Ga0068861_100118415 3300005719 Bacteria 2133
69 Ga0068863_100001610 3300005841 Bacteria 22316
70 Ga0068863_100021205 3300005841 Bacteria 6202
71 Ga0068858_100000329 3300005842 Bacteria 50177
72 Ga0068860_100003031 3300005843 Bacteria 17343
73 Ga0068860_101868824 3300005843 Bacteria 622
74 Ga0081455_10359908 3300005937 Bacteria 1023
75 Ga0081539_10003837 3300005985 Bacteria 17649
76 Ga0070715_10000003 3300006163 Bacteria 345282
77 Ga0070716_100087836 3300006173 Bacteria 1874
78 Ga0070712_100003453 3300006175 Bacteria 9726
79 Ga0075430_100771777 3300006846 Bacteria 792
80 Ga0075431_100302888 3300006847 Bacteria 1614
81 Ga0075433_10018893 3300006852 Bacteria 5737
82 Ga0075433_11645102 3300006852 Bacteria 553
83 Ga0068865_100607314 3300006881 Bacteria 925
84 Ga0075436_101195402 3300006914 Bacteria 574
85 Ga0097620_100207919 3300006931 Bacteria 2043
86 Ga0075435_100100423 3300007076 Unclassified 2397
87 Ga0111539_10117137 3300009094 Bacteria 3123
88 Ga0105245_10007717 3300009098 Bacteria 9422
89 Ga0105245_11187618 3300009098 Bacteria 811
90 Ga0105247_10000275 3300009101 Bacteria 47915
91 Ga0105247_10199380 3300009101 Bacteria 1344
92 Ga0114129_10120351 3300009147 Bacteria 3615
93 Ga0114129_10698015 3300009147 Bacteria 1304
94 Ga0105243_10045478 3300009148 Bacteria 3450
95 Ga0105243_10182966 3300009148 Bacteria 1824
96 Ga0105242_10000109 3300009176 Bacteria 59443
97 Ga0105242_10006926 3300009176 Bacteria 8746
98 Ga0105242_10025228 3300009176 Bacteria 4702
99 Ga0105248_10433094 3300009177 Bacteria 1481
100 Ga0105238_10000016 3300009551 Bacteria 236218
101 Ga0105249_10276286 3300009553 Bacteria 1676
102 Ga0105239_10043885 3300010375 Bacteria 4903
103 Ga0105239_11113600 3300010375 Bacteria 909
104 Ga0105246_10017323 3300011119 Bacteria 4577
105 Ga0157370_10020561 3300013104 Bacteria 6590
106 Ga0163162_10122398 3300013306 Bacteria 2706
107 Ga0157372_10017307 3300013307 Bacteria 7739
108 Ga0157375_10000126 3300013308 Bacteria 75410
109 Ga0157375_10012323 3300013308 Bacteria 7582
110 Ga0157375_10015812 3300013308 Bacteria 6762
111 Ga0157375_10252582 3300013308 Bacteria 1924
112 Ga0163163_10051219 3300014325 Bacteria 4071
113 Ga0157380_10279612 3300014326 Bacteria 1526
114 Ga0157377_10014431 3300014745 Bacteria 4020
115 Ga0157379_10322038 3300014968 Bacteria 1412
116 Ga0157376_10583996 3300014969 Bacteria 1110
117 Ga0163161_10000013 3300017792 Bacteria 258747
118 Ga0163161_10139565 3300017792 Bacteria 1834
119 Ga0207692_10105345 3300025898 Unclassified 1555
120 Ga0207642_10000008 3300025899 Bacteria 132651
121 Ga0207642_10000181 3300025899 Bacteria 18196
122 Ga0207642_10046972 3300025899 Bacteria 1927
123 Ga0207688_10027077 3300025901 Bacteria 3153
124 Ga0207685_10000003 3300025905 Bacteria 344527
125 Ga0207699_10213787 3300025906 Bacteria 1313
126 Ga0207643_10552925 3300025908 Unclassified 739
127 Ga0207671_10126432 3300025914 Bacteria 1959
128 Ga0207693_10052410 3300025915 Bacteria 3200
129 Ga0207663_10046208 3300025916 Bacteria 2682
130 Ga0207694_10000012 3300025924 Bacteria 411218
131 Ga0207659_10062614 3300025926 Bacteria 2686
132 Ga0207687_10028321 3300025927 Bacteria 3764
133 Ga0207700_10497477 3300025928 Unclassified 1079
134 Ga0207700_11623534 3300025928 Bacteria 572
135 Ga0207664_10182591 3300025929 Bacteria 1802
136 Ga0207664_10339480 3300025929 Bacteria 1328
137 Ga0207664_10615437 3300025929 Unclassified 976
138 Ga0207644_10080366 3300025931 Bacteria 2408
139 Ga0207690_10275532 3300025932 Bacteria 1309
140 Ga0207706_10009222 3300025933 Bacteria 9066
141 Ga0207686_10000212 3300025934 Bacteria 44261
142 Ga0207686_10004392 3300025934 Bacteria 7562
143 Ga0207709_10018925 3300025935 Bacteria 3863
144 Ga0207709_10101087 3300025935 Bacteria 1906
145 Ga0207669_10000032 3300025937 Bacteria 82757
146 Ga0207669_10000091 3300025937 Bacteria 45833
147 Ga0207669_10887849 3300025937 Bacteria 744
148 Ga0207704_10325358 3300025938 Bacteria 1188
149 Ga0207665_10110029 3300025939 Bacteria 1935
150 Ga0207665_10238317 3300025939 Bacteria 1339
151 Ga0207711_10339887 3300025941 Bacteria 1389
152 Ga0207689_10728926 3300025942 Unclassified 836
153 Ga0207679_10044566 3300025945 Bacteria 3201
154 Ga0207667_10409718 3300025949 Bacteria 1380
155 Ga0207651_10011382 3300025960 Bacteria 4980
156 Ga0207712_10195037 3300025961 Bacteria 1601
157 Ga0207712_10538136 3300025961 Bacteria 1003
158 Ga0207640_10168629 3300025981 Bacteria 1629
159 Ga0207658_10314679 3300025986 Bacteria 1353
160 Ga0207677_10115083 3300026023 Bacteria 2011
161 Ga0207703_10000122 3300026035 Bacteria 92656
162 Ga0207639_10176415 3300026041 Bacteria 1814
163 Ga0207678_10121902 3300026067 Bacteria 2225
164 Ga0207708_10004279 3300026075 Bacteria 10512
165 Ga0207708_10625913 3300026075 Unclassified 914
166 Ga0207702_10058674 3300026078 Bacteria 3276
167 Ga0207702_10091054 3300026078 Bacteria 2670
168 Ga0207641_10004106 3300026088 Bacteria 12687
169 Ga0207641_10178912 3300026088 Bacteria 1941
170 Ga0207648_10008333 3300026089 Bacteria 10057
171 Ga0207675_100115977 3300026118 Bacteria 2531
172 Ga0207675_100382243 3300026118 Bacteria 1385
173 Ga0207683_10137921 3300026121 Bacteria 2196
174 Ga0268266_10048004 3300028379 Bacteria 3659
175 Ga0268264_10004592 3300028381 Bacteria 11736
176 Ga0268264_10888994 3300028381 Bacteria 894
177 Ga0265337_1000123 3300028556 Bacteria 39654
178 Ga0265326_10000111 3300028558 Bacteria 41592
179 Ga0265322_10000005 3300028654 Bacteria 246112
180 Ga0265336_10005488 3300028666 Bacteria 4674
181 Ga0265338_10244914 3300028800 Bacteria 1326
182 Ga0265324_10001504 3300029957 Bacteria 13183
183 Ga0265320_10000293 3300031240 Bacteria 40653
184 Ga0265329_10008722 3300031242 Bacteria 3827
185 Ga0265331_10001064 3300031250 Bacteria 21387
186 Ga0265327_10000040 3300031251 Bacteria 291052
187 Ga0265316_10037923 3300031344 Bacteria 3886
188 Ga0265314_10000983 3300031711 Bacteria 33551
189 Ga0373956_0237116 3300035119 Bacteria 867
190 Ga0373937_0032638 3300036401 Bacteria 4723
191 Ga0373937_0091498 3300036401 Bacteria 2819
192 Ga0373925_0696094 3300037068 Bacteria 838
193 Ga0395898_0235596 3300037466 Bacteria 1746
194 Ga0436364_0456615 3300037853 Bacteria 3272
195 Ga0395901_0511682 3300038443 Bacteria 1221
196 Ga0436362_1159079 3300039453 Bacteria 3113
197 Ga0451800_0880557 3300041459 Unclassified 885
198 Ga0451835_0709387 3300041492 Bacteria 525
199 Ga0451847_0058565 3300041503 Unclassified 805
200 Ga0451853_0655662 3300041512 Unclassified 654
201 Ga0451853_2493003 3300041512 Bacteria 619
202 Ga0466966_0020605 3300044684 Bacteria 4333
203 Ga0466961_0295775 3300044693 Bacteria 989
204 Ga0466963_0069499 3300044694 Bacteria 2367
205 Ga0466971_0143395 3300044719 Archaea 1113
206 Ga0466971_0192419 3300044719 Bacteria 961
207 Ga0466957_0112018 3300044842 Bacteria 1731
208 Ga0466957_0122430 3300044842 Bacteria 1659
209 Ga0466957_0602207 3300044842 Bacteria 769
210 Ga0466959_0049759 3300045049 Bacteria 3078
211 Ga0466958_0004355 3300045836 Bacteria 7468
212 Ga0466958_0026443 3300045836 Bacteria 3429
213 Ga0495592_0000424 3300046454 Bacteria 32002
214 Ga0495592_0451956 3300046454 Bacteria 805
215 Ga0495603_0023061 3300046455 Bacteria 3768
216 Ga0495629_0017785 3300046459 Bacteria 5095
217 Ga0495638_0009281 3300046460 Bacteria 6914
218 Ga0495641_0088488 3300046461 Bacteria 1385
219 Ga0495651_0075210 3300046462 Bacteria 2561
220 Ga0495653_0006069 3300046463 Bacteria 9900
221 Ga0495653_0021809 3300046463 Bacteria 5185
222 Ga0495653_0027674 3300046463 Bacteria 4538
223 Ga0495653_0214542 3300046463 Bacteria 1298
224 Ga0495653_0437985 3300046463 Bacteria 824
225 Ga0495662_0000178 3300046476 Bacteria 25519
226 Ga0495662_0009169 3300046476 Bacteria 4855
227 Ga0495608_0003416 3300046511 Bacteria 11374
228 Ga0495618_0000037 3300046514 Bacteria 99735
229 Ga0495628_0011893 3300046516 Bacteria 7340
230 Ga0495628_0014655 3300046516 Bacteria 6566
231 Ga0495628_0569278 3300046516 Bacteria 812
232 Ga0495630_0000586 3300046517 Bacteria 26542
233 Ga0495630_0234724 3300046517 Bacteria 1401
234 Ga0495652_0000009 3300046529 Bacteria 311000
235 Ga0495586_0008630 3300046535 Bacteria 5425
236 Ga0495587_0006510 3300046536 Bacteria 7611
237 Ga0495587_0091741 3300046536 Bacteria 1754
238 Ga0495668_0060415 3300046616 Bacteria 2091
239 Ga0495634_0000021 3300046642 Bacteria 120521
240 Ga0495634_0572279 3300046642 Bacteria 657
241 Ga0495625_0004612 3300046660 Bacteria 12954
242 Ga0495635_0453871 3300046663 Bacteria 847
243 Ga0495657_0000040 3300046675 Bacteria 115899
244 Ga0495657_0003546 3300046675 Bacteria 12724
245 Ga0495669_0006178 3300046684 Bacteria 4997
246 Ga0495613_0000190 3300046689 Bacteria 60696
247 Ga0495613_0101824 3300046689 Bacteria 2074
248 Ga0495600_0001515 3300046809 Bacteria 12898
249 Ga0495600_0472644 3300046809 Unclassified 773
250 Ga0495604_0408562 3300047317 Bacteria 893
251 Ga0495674_0000010 3300047319 Bacteria 285794
252 Ga0495674_0335181 3300047319 Unclassified 1230
253 Ga0495676_0000860 3300047321 Bacteria 25376
254 Ga0495676_0002889 3300047321 Bacteria 15495
255 Ga0495680_0008091 3300047322 Bacteria 9587
256 Ga0495680_0008542 3300047322 Bacteria 9301
257 Ga0495680_0595461 3300047322 Bacteria 740
258 Ga0495675_0000051 3300047444 Bacteria 80375
259 Ga0495675_0445312 3300047444 Bacteria 750
260 Ga0495684_0100321 3300047471 Bacteria 2189
261 Ga0495686_0029983 3300047472 Bacteria 3535
262 Ga0495686_0289757 3300047472 Unclassified 907
263 Ga0496100_0000001 3300048903 Bacteria 530179
264 Ga0496100_0000024 3300048903 Bacteria 116138
265 Ga0496101_0000028 3300048904 Bacteria 198664
266 Ga0496101_0000072 3300048904 Bacteria 116138
267 Ga0496101_0019253 3300048904 Bacteria 4658
268 Ga0496102_0056519 3300048905 Bacteria 3580
269 Ga0496102_0354668 3300048905 Unclassified 1381
270 Ga0496102_0936236 3300048905 Bacteria 788
271 Ga0496104_0000214 3300048907 Bacteria 51141
272 Ga0496104_0035858 3300048907 Bacteria 4633
273 Ga0496104_1294125 3300048907 Bacteria 632
274 Ga0496105_0000876 3300048908 Bacteria 20602
275 Ga0496105_0013509 3300048908 Bacteria 6485
276 Ga0496105_0935041 3300048908 Bacteria 652
277 Ga0496106_0000040 3300048909 Bacteria 108754
278 Ga0496106_0000055 3300048909 Bacteria 91570
279 Ga0496106_0013105 3300048909 Bacteria 6118
280 Ga0496107_0000002 3300048910 Bacteria 320871
281 Ga0496107_0000025 3300048910 Bacteria 116138
282 Ga0496108_0000178 3300048911 Bacteria 58913
283 Ga0496108_0041269 3300048911 Bacteria 3851
284 Ga0496109_0001026 3300048912 Bacteria 23100
285 Ga0496109_0010089 3300048912 Bacteria 8060
286 Ga0496109_0038438 3300048912 Bacteria 4326
287 Ga0496109_0482497 3300048912 Unclassified 1170
288 Ga0496109_0606391 3300048912 Bacteria 1031
289 Ga0496109_1291036 3300048912 Bacteria 666
290 Ga0496110_0038770 3300048913 Bacteria 4147
291 Ga0496110_0645197 3300048913 Bacteria 958
292 Ga0496111_0009258 3300048914 Bacteria 6565
293 Ga0496111_0049188 3300048914 Bacteria 3039
294 Ga0496112_0984767 3300048915 Unclassified 763
295 Ga0496113_0091370 3300048916 Bacteria 2346
296 Ga0496113_0108141 3300048916 Bacteria 2161
297 Ga0496113_0241945 3300048916 Bacteria 1440
298 Ga0496114_0000003 3300048917 Bacteria 630981
299 Ga0496115_0000031 3300048918 Bacteria 138258
300 Ga0496115_0016776 3300048918 Bacteria 5581
301 Ga0496115_0341591 3300048918 Bacteria 1222
302 Ga0496118_0287556 3300048921 Unclassified 911
303 Ga0501039_0227462 3300049575 Unclassified 1466
304 Ga0501042_0062044 3300049578 Bacteria 2670
305 Ga0501042_0441641 3300049578 Bacteria 943
306 Ga0501048_0593916 3300049582 Bacteria 795
307 Ga0501070_0177541 3300049586 Unclassified 1753
308 Ga0501072_0037399 3300049588 Bacteria 3807
309 Ga0501075_0232460 3300049591 Unclassified 1406
310 Ga0501076_0853676 3300049592 Unclassified 751
311 Ga0501080_0423273 3300049742 Bacteria 1196
312 Ga0501081_0017973 3300049743 Bacteria 4690
313 nmdc:mga05p37_414860_c1 3300050507 Bacteria 1568
314 nmdc:mga09592_748719_c1 3300050508 Bacteria 829
315 nmdc:mga06r32_1113883_c1 3300050510 Bacteria 738
316 nmdc:mga06r32_176064_c1 3300050510 Bacteria 2124
317 nmdc:mga06r32_264767_c1 3300050510 Bacteria 1706
318 nmdc:mga0n895_115687_c1 3300050512 Bacteria 2700
319 nmdc:mga0rr50_386394_c1 3300050513 Bacteria 1181
320 nmdc:mga0rr50_417815_c1 3300050513 Bacteria 1134
321 nmdc:mga0a205_27717_c1 3300050515 Bacteria 5410
322 nmdc:mga0a205_45198_c1 3300050515 Bacteria 4246
323 Ga0495601_0000022 3300053077 Bacteria 148418
324 Ga0495601_0051464 3300053077 Unclassified 2599
325 Ga0495601_0393711 3300053077 Unclassified 899
326 Ga0495612_0019928 3300053078 Bacteria 2687
327 Ga0495655_0000005 3300053083 Bacteria 257472
328 Ga0495595_0000009 3300053084 Bacteria 193039
329 Ga0495595_0000213 3300053084 Bacteria 23371
330 Ga0495619_0000001 3300053085 Bacteria 586054
331 Ga0495619_0000057 3300053085 Bacteria 93948
332 Ga0495619_0000119 3300053085 Bacteria 58302
333 Ga0495619_0030999 3300053085 Bacteria 3463
334 Ga0495619_0323485 3300053085 Bacteria 1067
335 Ga0500641_0001110 3300053096 Bacteria 9563
336 Ga0500628_000013 3300053129 Bacteria 106419
337 Ga0466962_0007152 3300061719 Bacteria 5347
338 Ga0451833_0300046
339 LJNas_1028072
340 JGI24748J21848_1004831
341 JGI24744J21845_10021457
342 JGI24034J26672_10000072
343 JGI25406J46586_10109147
344 Ga0070658_10424084
345 Ga0070683_100018331
346 Ga0070690_100682484
347 Ga0068869_100231015
348 Ga0070682_100175009
349 Ga0070682_100686889
350 Ga0068868_100041450
351 Ga0070689_100032489
352 Ga0070691_10000003
353 Ga0070661_100040357
354 Ga0070668_100037466
355 Ga0070675_100095849
356 Ga0070671_100075990
357 Ga0070674_100000021
358 Ga0070674_100000075
359 Ga0070673_100053915
360 Ga0070688_100112992
361 Ga0070667_100356459
362 Ga0070714_100049650
363 Ga0070714_100195468
364 Ga0070714_100606837
365 Ga0070713_100065208
366 Ga0070713_102328883
367 Ga0070710_10100267
368 Ga0070711_100060328
369 Ga0070705_100050291
370 Ga0070700_100018446
371 Ga0070700_100298839
372 Ga0070694_100181753
373 Ga0070694_100999797
374 Ga0070663_100136722
375 Ga0070678_100094289
376 Ga0070662_100028924
377 Ga0068867_100035861
378 Ga0070685_10208500
379 Ga0070684_100013797
380 Ga0070684_100111403
381 Ga0070686_100023585
382 Ga0070695_100203172
383 Ga0070695_100347416
384 Ga0070693_100091085
385 Ga0070693_101289894
386 Ga0070665_100050754
387 Ga0070665_101151214
388 Ga0070704_100032903
389 Ga0068855_100294328
390 Ga0068855_100732930
391 Ga0070664_100039147
392 Ga0070664_100838884
393 Ga0068857_100169314
394 Ga0068856_100081106
395 Ga0068856_100102468
396 Ga0068856_100909005
397 Ga0068852_100037402
398 Ga0068852_100667368
399 Ga0068859_100207928
400 Ga0068864_100036766
401 Ga0068866_10000007
402 Ga0068866_10000469
403 Ga0068866_10037280
404 Ga0068866_10224568
405 Ga0068861_100118415
406 Ga0068863_100001610
407 Ga0068863_100021205
408 Ga0068858_100000329
409 Ga0068860_100003031
410 Ga0068860_101868824
411 Ga0081455_10359908
412 Ga0081539_10003837
413 Ga0070715_10000003
414 Ga0070716_100087836
415 Ga0070712_100003453
416 Ga0075430_100771777
417 Ga0075431_100302888
418 Ga0075433_10018893
419 Ga0075433_11645102
420 Ga0068865_100607314
421 Ga0075436_101195402
422 Ga0097620_100207919
423 Ga0075435_100100423
424 Ga0111539_10117137
425 Ga0105245_10007717
426 Ga0105245_11187618
427 Ga0105247_10000275
428 Ga0105247_10199380
429 Ga0114129_10120351
430 Ga0114129_10698015
431 Ga0105243_10045478
432 Ga0105243_10182966
433 Ga0105242_10000109
434 Ga0105242_10006926
435 Ga0105242_10025228
436 Ga0105248_10433094
437 Ga0105238_10000016
438 Ga0105249_10276286
439 Ga0105239_10043885
440 Ga0105239_11113600
441 Ga0105246_10017323
442 Ga0157370_10020561
443 Ga0163162_10122398
444 Ga0157372_10017307
445 Ga0157375_10000126
446 Ga0157375_10012323
447 Ga0157375_10015812
448 Ga0157375_10252582
449 Ga0163163_10051219
450 Ga0157380_10279612
451 Ga0157377_10014431
452 Ga0157379_10322038
453 Ga0157376_10583996
454 Ga0163161_10000013
455 Ga0163161_10139565
456 Ga0207692_10105345
457 Ga0207642_10000008
458 Ga0207642_10000181
459 Ga0207642_10046972
460 Ga0207688_10027077
461 Ga0207685_10000003
462 Ga0207699_10213787
463 Ga0207643_10552925
464 Ga0207671_10126432
465 Ga0207693_10052410
466 Ga0207663_10046208
467 Ga0207694_10000012
468 Ga0207659_10062614
469 Ga0207687_10028321
470 Ga0207700_10497477
471 Ga0207700_11623534
472 Ga0207664_10182591
473 Ga0207664_10339480
474 Ga0207664_10615437
475 Ga0207644_10080366
476 Ga0207690_10275532
477 Ga0207706_10009222
478 Ga0207686_10000212
479 Ga0207686_10004392
480 Ga0207709_10018925
481 Ga0207709_10101087
482 Ga0207669_10000032
483 Ga0207669_10000091
484 Ga0207669_10887849
485 Ga0207704_10325358
486 Ga0207665_10110029
487 Ga0207665_10238317
488 Ga0207711_10339887
489 Ga0207689_10728926
490 Ga0207679_10044566
491 Ga0207667_10409718
492 Ga0207651_10011382
493 Ga0207712_10195037
494 Ga0207712_10538136
495 Ga0207640_10168629
496 Ga0207658_10314679
497 Ga0207677_10115083
498 Ga0207703_10000122
499 Ga0207639_10176415
500 Ga0207678_10121902
501 Ga0207708_10004279
502 Ga0207708_10625913
503 Ga0207702_10058674
504 Ga0207702_10091054
505 Ga0207641_10004106
506 Ga0207641_10178912
507 Ga0207648_10008333
508 Ga0207675_100115977
509 Ga0207675_100382243
510 Ga0207683_10137921
511 Ga0268266_10048004
512 Ga0268264_10004592
513 Ga0268264_10888994
514 Ga0265337_1000123
515 Ga0265326_10000111
516 Ga0265322_10000005
517 Ga0265336_10005488
518 Ga0265338_10244914
519 Ga0265324_10001504
520 Ga0265320_10000293
521 Ga0265329_10008722
522 Ga0265331_10001064
523 Ga0265327_10000040
524 Ga0265316_10037923
525 Ga0265314_10000983
526 Ga0373956_0237116
527 Ga0373937_0032638
528 Ga0373937_0091498
529 Ga0373925_0696094
530 Ga0395898_0235596
531 Ga0436364_0456615
532 Ga0395901_0511682
533 Ga0436362_1159079
534 Ga0451800_0880557
535 Ga0451835_0709387
536 Ga0451847_0058565
537 Ga0451853_0655662
538 Ga0451853_2493003
539 Ga0466966_0020605
540 Ga0466961_0295775
541 Ga0466963_0069499
542 Ga0466971_0143395
543 Ga0466971_0192419
544 Ga0466957_0112018
545 Ga0466957_0122430
546 Ga0466957_0602207
547 Ga0466959_0049759
548 Ga0466958_0004355
549 Ga0466958_0026443
550 Ga0495592_0000424
551 Ga0495592_0451956
552 Ga0495603_0023061
553 Ga0495629_0017785
554 Ga0495638_0009281
555 Ga0495641_0088488
556 Ga0495651_0075210
557 Ga0495653_0006069
558 Ga0495653_0021809
559 Ga0495653_0027674
560 Ga0495653_0214542
561 Ga0495653_0437985
562 Ga0495662_0000178
563 Ga0495662_0009169
564 Ga0495608_0003416
565 Ga0495618_0000037
566 Ga0495628_0011893
567 Ga0495628_0014655
568 Ga0495628_0569278
569 Ga0495630_0000586
570 Ga0495630_0234724
571 Ga0495652_0000009
572 Ga0495586_0008630
573 Ga0495587_0006510
574 Ga0495587_0091741
575 Ga0495668_0060415
576 Ga0495634_0000021
577 Ga0495634_0572279
578 Ga0495625_0004612
579 Ga0495635_0453871
580 Ga0495657_0000040
581 Ga0495657_0003546
582 Ga0495669_0006178
583 Ga0495613_0000190
584 Ga0495613_0101824
585 Ga0495600_0001515
586 Ga0495600_0472644
587 Ga0495604_0408562
588 Ga0495674_0000010
589 Ga0495674_0335181
590 Ga0495676_0000860
591 Ga0495676_0002889
592 Ga0495680_0008091
593 Ga0495680_0008542
594 Ga0495680_0595461
595 Ga0495675_0000051
596 Ga0495675_0445312
597 Ga0495684_0100321
598 Ga0495686_0029983
599 Ga0495686_0289757
600 Ga0496100_0000001
601 Ga0496100_0000024
602 Ga0496101_0000028
603 Ga0496101_0000072
604 Ga0496101_0019253
605 Ga0496102_0056519
606 Ga0496102_0354668
607 Ga0496102_0936236
608 Ga0496104_0000214
609 Ga0496104_0035858
610 Ga0496104_1294125
611 Ga0496105_0000876
612 Ga0496105_0013509
613 Ga0496105_0935041
614 Ga0496106_0000040
615 Ga0496106_0000055
616 Ga0496106_0013105
617 Ga0496107_0000002
618 Ga0496107_0000025
619 Ga0496108_0000178
620 Ga0496108_0041269
621 Ga0496109_0001026
622 Ga0496109_0010089
623 Ga0496109_0038438
624 Ga0496109_0482497
625 Ga0496109_0606391
626 Ga0496109_1291036
627 Ga0496110_0038770
628 Ga0496110_0645197
629 Ga0496111_0009258
630 Ga0496111_0049188
631 Ga0496112_0984767
632 Ga0496113_0091370
633 Ga0496113_0108141
634 Ga0496113_0241945
635 Ga0496114_0000003
636 Ga0496115_0000031
637 Ga0496115_0016776
638 Ga0496115_0341591
639 Ga0496118_0287556
640 Ga0501039_0227462
641 Ga0501042_0062044
642 Ga0501042_0441641
643 Ga0501048_0593916
644 Ga0501070_0177541
645 Ga0501072_0037399
646 Ga0501075_0232460
647 Ga0501076_0853676
648 Ga0501080_0423273
649 Ga0501081_0017973
650 nmdc:mga05p37_414860_c1
651 nmdc:mga09592_748719_c1
652 nmdc:mga06r32_1113883_c1
653 nmdc:mga06r32_176064_c1
654 nmdc:mga06r32_264767_c1
655 nmdc:mga0n895_115687_c1
656 nmdc:mga0rr50_386394_c1
657 nmdc:mga0rr50_417815_c1
658 nmdc:mga0a205_27717_c1
659 nmdc:mga0a205_45198_c1
660 Ga0495601_0000022
661 Ga0495601_0051464
662 Ga0495601_0393711
663 Ga0495612_0019928
664 Ga0495655_0000005
665 Ga0495595_0000009
666 Ga0495595_0000213
667 Ga0495619_0000001
668 Ga0495619_0000057
669 Ga0495619_0000119
670 Ga0495619_0030999
671 Ga0495619_0323485
672 Ga0500641_0001110
673 Ga0500628_000013
674 Ga0466962_0007152

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.831 6 126
3nbr-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase d38np39gd99n from pseudomonas testosteroni (tksi) with 4-androstene-3,17-dione bound 0.821 6 126
1tuh-assembly1.cif.gz_A-2 structure of bal32a from a soil-derived mobile gene cassette 0.8103 8 128
3ec9-assembly1.cif.gz_A crystal structure of a ntf2-like protein (bth_i0051) from burkholderia thailandensis e264 at 1.60 a resolution 0.7953 7 126
3ebt-assembly1.cif.gz_A-2 crystal structure of a ntf2-like protein of unknown function (bpss0132) from burkholderia pseudomallei k96243 at 1.30 a resolution 0.7931 8 125
ID Description Score Start End Superfamily
af_I1LCK9_37_142_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.8138 23 122 1.10.520.10
1tuhA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8103 8 128 3.10.450.50
af_I6XW93_5_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7977 8 131 3.10.450.50
6d34B00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7928 8 125 3.10.450.50
3fh1A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.7785 7 123 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A2W5XU91-F1-model_v4 SnoaL-like domain-containing protein 0.9966 1 137
AF-A0A838V0I2-F1-model_v4 SnoaL-like domain-containing protein 0.9733 1 140
AF-A0A1F8RRN4-F1-model_v4 SnoaL-like domain-containing protein 0.9715 1 138
AF-D3F1P6-F1-model_v4 SnoaL-like domain-containing protein 0.971 3 136
AF-A0A2W5XU91-F1-model_v4 SnoaL-like domain-containing protein 0.9684 1 137

Map