F413184

General Info

Members Datasets Scaffolds Average Seq Length
337 249 306 258

Family's Representative Sequence

Representative Sequence 3300042131|Ga0450894_016674|Ga0450894_016674_54_956
Length 300
Sequence MALISAARFLWIISTASSFTRKKAITLVSRFLKISRNYEMLRPRIIPCLLIQDGGLVKTVRFKDSKYVGDPINAVKIFNEKEADELIVLDIDATVTDREPNYKQIAILAAECRMPLCYGGGIRTVGQAQKIIASGVEKVAISSAALGNPQLVTQIANEIGRQSVVVVLDHKKRLLSKQHDVWTHNGKVNTKRNVLDVAKEMEALGAGEIVINSIDNDGRMKGYDLELSLQLRKAVNTPVTILGGAGSLDDMRAVISSCGVVGVAAGSFFVFKGPYRAVLISYPDITQKEKFIFSALHPTH

Samples

Sample ID Description Type Environment
1 2511231024 Pseudomonas sp. GM84 Isolate Nodule
2 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
3 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
4 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
5 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
6 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
7 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
8 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
9 2643221591 Devosia sp. Root685 Isolate Unclassified
10 2643221699 Brevundimonas sp. Root1423 Isolate Unclassified
11 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
12 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
13 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
14 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
15 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
16 2765235841 Pseudomonas putida AA7 Isolate Unclassified
17 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
18 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
19 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
20 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
21 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
22 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
23 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
24 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
25 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
26 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
27 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
28 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
29 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
30 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
31 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
32 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
33 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
35 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
38 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
39 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
40 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
43 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
44 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
55 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
135 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
155 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
158 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
159 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
160 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
161 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
171 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
172 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
176 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
177 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
178 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
179 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
180 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
189 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
199 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
200 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
201 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
202 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
205 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
206 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
217 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
218 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
219 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
220 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
221 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
222 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
223 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
224 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
225 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
229 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
230 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
235 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
236 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
237 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
240 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
241 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
242 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
243 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
246 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
247 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
248 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.5
Metatranscriptomes 0
Isolates 9.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.06
Nodule 1.48
Rhizoplane 4.15
Rhizosphere 68.84
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000014 3300003203 Bacteria 93855
2 rootH2_10243076 3300003320 Bacteria 1484
3 rootL2_10203214 3300003322 Bacteria 2375
4 rootH1_10007743 3300003316 Bacteria 6031
5 rootH1_10007743 3300003323 Bacteria 19767
6 rootH1_10307812 3300003323 Bacteria 1083
7 Ga0055525_1000246 3300003759 Bacteria 54885
8 Ga0055536_1000387 3300003781 Bacteria 32286
9 Ga0055534_1013646 3300003784 Bacteria 1553
10 Ga0055530_10000089 3300003791 Bacteria 78801
11 Ga0055531_10022249 3300003794 Bacteria 2423
12 Ga0065704_10076392 3300005289 Bacteria 5139
13 Ga0065704_10154262 3300005289 Bacteria 1393
14 Ga0070658_10048436 3300005327 Bacteria 3441
15 Ga0070658_10553971 3300005327 Bacteria 995
16 Ga0070683_100010524 3300005329 Bacteria 7954
17 Ga0070683_100365340 3300005329 Bacteria 1374
18 Ga0070670_100016636 3300005331 Bacteria 6311
19 Ga0070666_10315589 3300005335 Unclassified 1114
20 Ga0070680_100677611 3300005336 Bacteria 887
21 Ga0070691_10027757 3300005341 Unclassified 2642
22 Ga0070661_100002180 3300005344 Bacteria 13483
23 Ga0070674_100025207 3300005356 Bacteria 3869
24 Ga0070674_100477338 3300005356 Bacteria 1034
25 Ga0070688_100119318 3300005365 Bacteria 1764
26 Ga0070659_100151017 3300005366 Bacteria 1895
27 Ga0070667_100210057 3300005367 Bacteria 1730
28 Ga0070714_100454658 3300005435 Bacteria 1217
29 Ga0070678_100676577 3300005456 Bacteria 928
30 Ga0068867_100109494 3300005459 Bacteria 2120
31 Ga0068867_100365947 3300005459 Bacteria 1207
32 Ga0070699_100001003 3300005518 Bacteria 26263
33 Ga0070699_100184448 3300005518 Unclassified 1852
34 Ga0070679_100001200 3300005530 Bacteria 22788
35 Ga0070684_100092980 3300005535 Bacteria 2684
36 Ga0068853_100159078 3300005539 Bacteria 2037
37 Ga0070695_100059959 3300005545 Bacteria 2465
38 Ga0070696_100039166 3300005546 Bacteria 3273
39 Ga0070704_100179863 3300005549 Bacteria 1690
40 Ga0068855_100056361 3300005563 Bacteria 4612
41 Ga0068857_100136203 3300005577 Bacteria 2217
42 Ga0068854_100606631 3300005578 Bacteria 935
43 Ga0068859_100031392 3300005617 Bacteria 5335
44 Ga0068859_100161681 3300005617 Bacteria 2318
45 Ga0068859_100262040 3300005617 Bacteria 1820
46 Ga0068859_100330710 3300005617 Bacteria 1618
47 Ga0068860_100153587 3300005843 Bacteria 2218
48 Ga0081540_1019319 3300005983 Bacteria 4147
49 Ga0081540_1104633 3300005983 Bacteria 1211
50 Ga0081539_10000001 3300005985 Bacteria 808331
51 Ga0081539_10000008 3300005985 Bacteria 525071
52 Ga0075364_10048036 3300006051 Bacteria 2780
53 Ga0075364_10066095 3300006051 Bacteria 2375
54 Ga0075362_10001043 3300006177 Bacteria 8543
55 Ga0075367_10004139 3300006178 Bacteria 7035
56 Ga0075367_10105360 3300006178 Bacteria 1727
57 Ga0075369_10035019 3300006186 Bacteria 2133
58 Ga0075366_10027621 3300006195 Bacteria 3330
59 Ga0075366_10067940 3300006195 Bacteria 2121
60 Ga0075370_10003466 3300006353 Bacteria 7515
61 Ga0075370_10010444 3300006353 Bacteria 4855
62 Ga0075370_10020129 3300006353 Bacteria 3643
63 Ga0068871_100183318 3300006358 Bacteria 1800
64 Ga0075430_100003833 3300006846 Bacteria 12661
65 Ga0075434_100066550 3300006871 Bacteria 3589
66 Ga0075429_100000282 3300006880 Bacteria 35849
67 Ga0097620_100031390 3300006931 Bacteria 5335
68 Ga0097620_100161689 3300006931 Bacteria 2318
69 Ga0097620_100262062 3300006931 Bacteria 1820
70 Ga0097620_100330720 3300006931 Bacteria 1618
71 Ga0105251_10000751 3300009011 Bacteria 29613
72 Ga0105250_10000586 3300009092 Bacteria 23882
73 Ga0105250_10189609 3300009092 Bacteria 865
74 Ga0105240_10196678 3300009093 Bacteria 2366
75 Ga0105240_10284265 3300009093 Bacteria 1899
76 Ga0111539_10016755 3300009094 Bacteria 9083
77 Ga0111539_10042908 3300009094 Bacteria 5427
78 Ga0105245_10009933 3300009098 Bacteria 8292
79 Ga0105245_10352631 3300009098 Bacteria 1458
80 Ga0105247_10312799 3300009101 Bacteria 1093
81 Ga0105243_10000971 3300009148 Bacteria 26695
82 Ga0105242_10157841 3300009176 Bacteria 1983
83 Ga0105237_10058845 3300009545 Bacteria 3846
84 Ga0105238_10457443 3300009551 Bacteria 1274
85 Ga0105249_10796706 3300009553 Bacteria 1009
86 Ga0105239_10037970 3300010375 Bacteria 5278
87 Ga0157371_10003057 3300013102 Bacteria 15523
88 Ga0157371_10004211 3300013102 Bacteria 12663
89 Ga0157371_10008952 3300013102 Bacteria 7920
90 Ga0157371_10010391 3300013102 Bacteria 7257
91 Ga0157370_10000637 3300013104 Bacteria 43772
92 Ga0157370_10002654 3300013104 Bacteria 21470
93 Ga0157370_10003839 3300013104 Bacteria 17518
94 Ga0157370_10277291 3300013104 Bacteria 1549
95 Ga0157370_10467577 3300013104 Bacteria 1159
96 Ga0157369_10000477 3300013105 Bacteria 53128
97 Ga0163162_10000585 3300013306 Bacteria 33759
98 Ga0163162_10258953 3300013306 Bacteria 1871
99 Ga0157372_10001711 3300013307 Bacteria 23811
100 Ga0157372_10111810 3300013307 Bacteria 3129
101 Ga0157372_11284938 3300013307 Bacteria 845
102 Ga0157375_10000220 3300013308 Bacteria 53557
103 Ga0157375_10017740 3300013308 Bacteria 6434
104 Ga0157375_10031078 3300013308 Bacteria 5041
105 Ga0157380_10003703 3300014326 Bacteria 10507
106 Ga0157380_10004132 3300014326 Bacteria 10031
107 Ga0157380_10029945 3300014326 Bacteria 4165
108 Ga0157380_10056191 3300014326 Bacteria 3129
109 Ga0157376_10124743 3300014969 Bacteria 2288
110 Ga0157376_10266765 3300014969 Bacteria 1606
111 Ga0163161_10005519 3300017792 Bacteria 8763
112 Ga0209563_100007 3300025230 Bacteria 1579402
113 Ga0209677_104292 3300025253 Bacteria 4176
114 Ga0209675_1000053 3300025291 Bacteria 194511
115 Ga0209676_1000824 3300025292 Bacteria 40329
116 Ga0209050_1000042 3300025298 Bacteria 402842
117 Ga0209257_1000826 3300025304 Bacteria 44769
118 Ga0207696_1000606 3300025711 Bacteria 26792
119 Ga0207655_1023970 3300025728 Bacteria 3007
120 Ga0207713_1000769 3300025735 Bacteria 29621
121 Ga0207713_1001664 3300025735 Bacteria 17228
122 Ga0207713_1004791 3300025735 Bacteria 8691
123 Ga0207705_10027401 3300025909 Bacteria 4064
124 Ga0207705_10410315 3300025909 Bacteria 1048
125 Ga0207695_10153428 3300025913 Bacteria 2240
126 Ga0207695_10272889 3300025913 Bacteria 1586
127 Ga0207671_10043638 3300025914 Bacteria 3316
128 Ga0207671_10070526 3300025914 Bacteria 2605
129 Ga0207660_10011200 3300025917 Bacteria 5831
130 Ga0207652_10002231 3300025921 Bacteria 16521
131 Ga0207681_10235556 3300025923 Bacteria 1423
132 Ga0207687_10004831 3300025927 Bacteria 8963
133 Ga0207664_10406164 3300025929 Bacteria 1212
134 Ga0207709_10041441 3300025935 Bacteria 2763
135 Ga0207689_10173674 3300025942 Bacteria 1777
136 Ga0207661_10010854 3300025944 Bacteria 6573
137 Ga0207667_10003744 3300025949 Bacteria 18752
138 Ga0207651_10123064 3300025960 Bacteria 1971
139 Ga0207658_10025730 3300025986 Bacteria 4122
140 Ga0207648_10138860 3300026089 Bacteria 2141
141 Ga0207648_10302206 3300026089 Unclassified 1435
142 Ga0207674_10402134 3300026116 Bacteria 1323
143 Ga0207698_10129042 3300026142 Bacteria 2157
144 Ga0209970_1000527 3300027614 Bacteria 6578
145 Ga0268266_10033082 3300028379 Bacteria 4397
146 Ga0265318_10000023 3300028577 Bacteria 160826
147 Ga0307517_10217736 3300028786 Bacteria 1165
148 Ga0307515_10037927 3300028794 Bacteria 7729
149 Ga0265324_10032935 3300029957 Bacteria 1810
150 Ga0316182_1155512 3300030745 Bacteria 2754
151 Ga0265339_10113486 3300031249 Unclassified 1399
152 Ga0307513_10100277 3300031456 Unclassified 2922
153 Ga0307509_10011494 3300031507 Bacteria 10708
154 Ga0307408_100000330 3300031548 Bacteria 45434
155 Ga0307408_100000779 3300031548 Bacteria 25638
156 Ga0307408_100060023 3300031548 Bacteria 2771
157 Ga0265313_10010309 3300031595 Bacteria 5935
158 Ga0265314_10000631 3300031711 Bacteria 43323
159 Ga0307405_10223139 3300031731 Unclassified 1384
160 Ga0307412_10000222 3300031911 Bacteria 38184
161 Ga0307412_10104112 3300031911 Bacteria 2013
162 Ga0307412_10129451 3300031911 Unclassified 1831
163 Ga0307416_100094962 3300032002 Bacteria 2573
164 Ga0307416_100428441 3300032002 Unclassified 1369
165 Ga0307414_10000074 3300032004 Bacteria 94049
166 Ga0307414_10000128 3300032004 Bacteria 53071
167 Ga0307414_10000209 3300032004 Bacteria 39278
168 Ga0307414_10013030 3300032004 Bacteria 4939
169 Ga0307415_100021391 3300032126 Bacteria 3975
170 Ga0373939_0074920 3300035114 Bacteria 1111
171 Ga0373931_0119408 3300035691 Bacteria 1505
172 Ga0395899_0000963 3300037312 Bacteria 26721
173 Ga0395900_0011277 3300037418 Bacteria 9140
174 Ga0395898_0000886 3300037466 Bacteria 48827
175 Ga0395898_0005833 3300037466 Bacteria 13254
176 Ga0395905_0013269 3300037471 Bacteria 7904
177 Ga0395901_0021939 3300038443 Bacteria 6545
178 Ga0400484_01941 3300038725 Bacteria 17261
179 Ga0400488_58007 3300038741 Bacteria 10540
180 Ga0439453_0001655 3300041408 Bacteria 2913
181 Ga0451807_0646179 3300041486 Bacteria 1179
182 Ga0439445_0000023 3300042004 Bacteria 20324
183 Ga0439451_000029 3300042009 Bacteria 31111
184 Ga0439463_002809 3300042016 Bacteria 4413
185 Ga0450894_016674 3300042131 Bacteria 975
186 Ga0439435_0027478 3300042436 Unclassified 1523
187 Ga0439464_0022735 3300042439 Bacteria 1729
188 Ga0451577_0200562 3300042876 Bacteria 1801
189 Ga0466969_0017852 3300044656 Bacteria 3701
190 Ga0453683_0004283 3300044673 Bacteria 10175
191 Ga0466961_0002292 3300044693 Bacteria 11890
192 Ga0466964_0017133 3300044706 Bacteria 2771
193 Ga0453684_0453977 3300044712 Unclassified 1426
194 Ga0453684_0549463 3300044712 Bacteria 1272
195 Ga0466971_0000466 3300044719 Bacteria 15850
196 Ga0466970_0015686 3300044765 Bacteria 3901
197 Ga0466957_0000307 3300044842 Bacteria 23957
198 Ga0451576_0000183 3300045051 Bacteria 157422
199 Ga0451576_0037322 3300045051 Bacteria 5147
200 Ga0451576_0101119 3300045051 Bacteria 2998
201 Ga0451576_0111252 3300045051 Bacteria 2850
202 Ga0466967_0455745 3300045976 Bacteria 1250
203 Ga0495627_000245 3300046453 Bacteria 57165
204 Ga0495590_0000338 3300046457 Bacteria 24377
205 Ga0495638_0000726 3300046460 Bacteria 35496
206 Ga0495584_0002205 3300046491 Bacteria 11109
207 Ga0495585_0002038 3300046492 Bacteria 14899
208 Ga0495585_0199329 3300046492 Bacteria 1020
209 Ga0495607_0000810 3300046501 Bacteria 29648
210 Ga0495583_0000460 3300046506 Bacteria 60178
211 Ga0495606_0001096 3300046507 Bacteria 38817
212 Ga0495606_0002199 3300046507 Bacteria 23384
213 Ga0495632_0000120 3300046519 Bacteria 80853
214 Ga0495637_0000574 3300046520 Bacteria 26147
215 Ga0495643_0015956 3300046522 Bacteria 4423
216 Ga0495648_0108691 3300046524 Bacteria 1514
217 Ga0495642_0000421 3300046528 Bacteria 22501
218 Ga0495654_0000711 3300046530 Bacteria 26011
219 Ga0495597_0000822 3300046542 Bacteria 24434
220 Ga0495622_0027292 3300046557 Bacteria 2665
221 Ga0495668_0002285 3300046616 Bacteria 16110
222 Ga0495625_0119832 3300046660 Bacteria 1792
223 Ga0495625_0193334 3300046660 Bacteria 1347
224 Ga0495635_0095125 3300046663 Bacteria 2037
225 Ga0495659_0027104 3300046664 Bacteria 1974
226 Ga0495661_0034122 3300046665 Bacteria 3204
227 Ga0495661_0064591 3300046665 Bacteria 2159
228 Ga0495669_0002671 3300046684 Bacteria 7300
229 Ga0495613_0208010 3300046689 Bacteria 1377
230 Ga0495671_0000349 3300046692 Bacteria 38480
231 Ga0495671_0000405 3300046692 Bacteria 34951
232 Ga0495671_0000501 3300046692 Bacteria 30161
233 Ga0495649_0000913 3300046694 Bacteria 23330
234 Ga0495589_0010358 3300046794 Bacteria 4841
235 Ga0495660_0000971 3300046810 Bacteria 20957
236 Ga0495604_0121629 3300047317 Bacteria 1889
237 Ga0495672_0000795 3300047320 Bacteria 34131
238 Ga0495683_0006783 3300047323 Bacteria 6225
239 Ga0495677_0014934 3300047445 Bacteria 2824
240 Ga0495673_0107215 3300047469 Bacteria 1121
241 Ga0495686_0042086 3300047472 Bacteria 2906
242 Ga0495686_0139150 3300047472 Unclassified 1433
243 Ga0496102_0074008 3300048905 Bacteria 3131
244 Ga0496104_0117007 3300048907 Bacteria 2558
245 Ga0496105_0186220 3300048908 Bacteria 1699
246 Ga0496105_0318869 3300048908 Bacteria 1246
247 Ga0496110_0084734 3300048913 Bacteria 2829
248 Ga0496112_0000008 3300048915 Bacteria 310323
249 Ga0496113_0057161 3300048916 Bacteria 2931
250 Ga0496114_0011085 3300048917 Bacteria 7194
251 Ga0496115_0025775 3300048918 Bacteria 4582
252 Ga0496115_0142184 3300048918 Bacteria 1980
253 Ga0496116_0000006 3300048919 Bacteria 811937
254 Ga0496117_0000027 3300048920 Bacteria 412234
255 Ga0496118_0000620 3300048921 Bacteria 58296
256 Ga0496119_0000006 3300048922 Bacteria 505999
257 Ga0496119_0060202 3300048922 Bacteria 2275
258 Ga0496122_0000444 3300048925 Bacteria 86587
259 Ga0496122_0002040 3300048925 Bacteria 29985
260 Ga0496122_0096477 3300048925 Bacteria 1993
261 Ga0496123_0000958 3300048926 Bacteria 44671
262 Ga0496123_0001660 3300048926 Bacteria 29864
263 Ga0496123_0016233 3300048926 Bacteria 6058
264 Ga0496124_0000475 3300048927 Bacteria 69109
265 Ga0496124_0002357 3300048927 Bacteria 24921
266 Ga0496124_0009718 3300048927 Bacteria 9847
267 Ga0496124_0064775 3300048927 Bacteria 3050
268 Ga0496125_0000031 3300048928 Bacteria 365156
269 Ga0496125_0015116 3300048928 Bacteria 7484
270 Ga0496125_0017623 3300048928 Bacteria 6803
271 Ga0496126_0009607 3300048929 Bacteria 10259
272 Ga0496126_0217890 3300048929 Bacteria 1605
273 Ga0495678_006186 3300049459 Bacteria 6407
274 Ga0501043_0535219 3300049579 Unclassified 872
275 Ga0501047_0349635 3300049581 Bacteria 1315
276 Ga0501198_014564 3300049649 Bacteria 1199
277 Ga0501241_000018 3300049758 Bacteria 95195
278 Ga0501269_000035 3300049766 Bacteria 41924
279 Ga0501044_0022540 3300049823 Bacteria 6710
280 Ga0501044_0493976 3300049823 Unclassified 1126
281 nmdc:mga03683_13112_c1 3300050489 Bacteria 3044
282 nmdc:mga00v17_136613_c1 3300050491 Bacteria 1570
283 nmdc:mga00v17_15256_c1 3300050491 Bacteria 4309
284 nmdc:mga0k408_150836_c1 3300050493 Bacteria 1384
285 nmdc:mga0k408_27307_c1 3300050493 Bacteria 3242
286 nmdc:mga0k408_30076_c1 3300050493 Bacteria 3095
287 nmdc:mga0k408_33290_c1 3300050493 Bacteria 2948
288 nmdc:mga0k408_52532_c1 3300050493 Bacteria 2362
289 nmdc:mga06z11_19038_c1 3300050494 Bacteria 3148
290 nmdc:mga07m45_17411_c1 3300050496 Bacteria 3860
291 nmdc:mga07m45_20887_c1 3300050496 Bacteria 3560
292 nmdc:mga07m45_6844_c1 3300050496 Bacteria 5796
293 nmdc:mga07m45_8017_c1 3300050496 Bacteria 5416
294 nmdc:mga09592_425_c1 3300050508 Bacteria 31113
295 nmdc:mga0qj67_3517_c1 3300050509 Bacteria 11303
296 nmdc:mga08y16_911436_c1 3300050511 Bacteria 864
297 Ga0500646_0011229 3300053090 Bacteria 2302
298 Ga0500641_0000062 3300053096 Bacteria 45077
299 Ga0500650_0110338 3300053098 Bacteria 1284
300 Ga0500555_053585 3300053103 Bacteria 1099
301 Ga0500556_0050666 3300053104 Bacteria 1501
302 Ga0500595_002193 3300053119 Bacteria 9918
303 Ga0500652_157218 3300053131 Bacteria 941
304 Ga0500655_029808 3300053133 Bacteria 1048
305 Ga0500559_0101263 3300053136 Bacteria 1328
306 Ga0466962_0001100 3300061719 Bacteria 12445

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049758 Ga0501241_000018 Ga0501241_000018_31311_31991 226
2 3300025927 Ga0207687_10004831 Ga0207687_100048318 230
3 3300025923 Ga0207681_10235556 Ga0207681_102355562 231
4 3300013104 Ga0157370_10003839 Ga0157370_100038395 232
5 3300013307 Ga0157372_11284938 Ga0157372_112849381 239
6 3300005983 Ga0081540_1104633 Ga0081540_11046331 241
7 3300009098 Ga0105245_10352631 Ga0105245_103526312 241
8 3300053090 Ga0500646_0011229 Ga0500646_0011229_587_1312 241
9 3300053098 Ga0500650_0110338 Ga0500650_0110338_490_1215 241
10 3300053104 Ga0500556_0050666 Ga0500556_0050666_734_1459 241
11 3300053133 Ga0500655_029808 Ga0500655_029808_154_879 241
12 iso_pu_bacteria 2842038055 2842045189 241
13 iso_pu_bacteria 2842045827 2842049149 241
14 3300005335 Ga0070666_10315589 Ga0070666_103155892 242
15 3300014969 Ga0157376_10124743 Ga0157376_101247433 242
16 3300013307 Ga0157372_10111810 Ga0157372_101118103 247
17 3300050496 nmdc:mga07m45_6844_c1 nmdc:mga07m45_6844_c1_3984_4727 247
18 3300053136 Ga0500559_0101263 Ga0500559_0101263_117_860 247
19 iso_pu_bacteria 2825651385 2825653078 247
20 3300046689 Ga0495613_0208010 Ga0495613_0208010_571_1317 248
21 3300048918 Ga0496115_0142184 Ga0496115_0142184_341_1087 248
22 3300003323 rootH1_10007743 rootH1_1000774318 249
23 3300005341 Ga0070691_10027757 Ga0070691_100277573 249
24 3300013104 Ga0157370_10002654 Ga0157370_100026549 249
25 3300014326 Ga0157380_10003703 Ga0157380_100037038 249
26 3300031456 Ga0307513_10100277 Ga0307513_101002772 249
27 3300053103 Ga0500555_053585 Ga0500555_053585_233_985 249
28 3300053131 Ga0500652_157218 Ga0500652_157218_58_810 249
29 iso_pu_bacteria 2871720351 2871724023 249
30 3300046522 Ga0495643_0015956 Ga0495643_0015956_807_1559 250
31 3300046528 Ga0495642_0000421 Ga0495642_0000421_13290_14042 250
32 3300046616 Ga0495668_0002285 Ga0495668_0002285_2069_2821 250
33 3300048907 Ga0496104_0117007 Ga0496104_0117007_505_1257 250
34 3300048908 Ga0496105_0318869 Ga0496105_0318869_422_1174 250
35 3300048917 Ga0496114_0011085 Ga0496114_0011085_2019_2771 250
36 3300049579 Ga0501043_0535219 Ga0501043_0535219_106_858 250
37 3300049823 Ga0501044_0493976 Ga0501044_0493976_273_1025 250
38 iso_pu_bacteria 2585428060 2587746060 250
39 iso_pu_bacteria 2585428183 2588214550 250
40 iso_pu_bacteria 2588253712 2588444179 250
41 iso_pu_bacteria 2588254257 2590613943 250
42 iso_pu_bacteria 2728369107 2729199965 250
43 iso_pu_bacteria 2772190705 2772607489 250
44 iso_pu_bacteria 2775506739 2775672003 250
45 iso_pu_bacteria 2842083920 2842085990 250
46 iso_pu_bacteria 2919097161 2919098559 250
47 iso_pu_bacteria 2946019816 2946022592 250
48 iso_pu_bacteria 2993372514 2993374593 250
49 3300046457 Ga0495590_0000338 Ga0495590_0000338_14379_15134 251
50 3300046491 Ga0495584_0002205 Ga0495584_0002205_3739_4494 251
51 3300046501 Ga0495607_0000810 Ga0495607_0000810_17519_18274 251
52 3300046507 Ga0495606_0002199 Ga0495606_0002199_13203_13958 251
53 3300046520 Ga0495637_0000574 Ga0495637_0000574_10864_11619 251
54 3300046530 Ga0495654_0000711 Ga0495654_0000711_10886_11641 251
55 3300046542 Ga0495597_0000822 Ga0495597_0000822_14375_15130 251
56 3300046694 Ga0495649_0000913 Ga0495649_0000913_9226_9981 251
57 3300047472 Ga0495686_0042086 Ga0495686_0042086_1052_1807 251
58 3300048913 Ga0496110_0084734 Ga0496110_0084734_1502_2257 251
59 3300048927 Ga0496124_0002357 Ga0496124_0002357_19983_20738 251
60 3300049459 Ga0495678_006186 Ga0495678_006186_4371_5126 251
61 3300013308 Ga0157375_10031078 Ga0157375_100310782 252
62 3300031911 Ga0307412_10104112 Ga0307412_101041122 252
63 3300009553 Ga0105249_10796706 Ga0105249_107967061 253
64 3300046519 Ga0495632_0000120 Ga0495632_0000120_58439_59200 253
65 3300049649 Ga0501198_014564 Ga0501198_014564_278_1039 253
66 3300003320 rootH2_10243076 rootH2_102430762 254
67 3300003322 rootL2_10203214 rootL2_102032142 254
68 3300003784 Ga0055534_1013646 Ga0055534_10136461 254
69 3300005331 Ga0070670_100016636 Ga0070670_1000166365 254
70 3300013308 Ga0157375_10000220 Ga0157375_1000022032 254
71 3300025291 Ga0209675_1000053 Ga0209675_1000053123 254
72 3300031911 Ga0307412_10000222 Ga0307412_1000022231 254
73 3300032004 Ga0307414_10000128 Ga0307414_1000012821 254
74 3300042004 Ga0439445_0000023 Ga0439445_0000023_12930_13694 254
75 3300048905 Ga0496102_0074008 Ga0496102_0074008_1220_1984 254
76 3300048919 Ga0496116_0000006 Ga0496116_0000006_152125_152889 254
77 3300048920 Ga0496117_0000027 Ga0496117_0000027_202297_203061 254
78 3300048921 Ga0496118_0000620 Ga0496118_0000620_34771_35535 254
79 3300048922 Ga0496119_0000006 Ga0496119_0000006_387033_387797 254
80 3300048925 Ga0496122_0000444 Ga0496122_0000444_60731_61495 254
81 3300048926 Ga0496123_0000958 Ga0496123_0000958_25093_25857 254
82 3300048927 Ga0496124_0000475 Ga0496124_0000475_53379_54143 254
83 3300048928 Ga0496125_0015116 Ga0496125_0015116_4135_4899 254
84 3300048928 Ga0496125_0017623 Ga0496125_0017623_3902_4666 254
85 3300048929 Ga0496126_0217890 Ga0496126_0217890_569_1333 254
86 3300049766 Ga0501269_000035 Ga0501269_000035_11777_12541 254
87 iso_pu_bacteria 2643221591 2643964983 255
88 iso_pu_bacteria 2806310737 2807407231 255
89 iso_pu_bacteria 2806310745 2807455560 255
90 3300005367 Ga0070667_100210057 Ga0070667_1002100572 256
91 3300005459 Ga0068867_100365947 Ga0068867_1003659472 256
92 3300013105 Ga0157369_10000477 Ga0157369_1000047746 256
93 3300025986 Ga0207658_10025730 Ga0207658_100257303 256
94 3300026089 Ga0207648_10302206 Ga0207648_103022062 256
95 iso_pu_bacteria 2511231024 2511375636 256
96 iso_pu_bacteria 2599185302 2599941834 256
97 iso_pu_bacteria 2599185304 2599952646 256
98 iso_pu_bacteria 2600254931 2600364300 256
99 iso_pu_bacteria 2643221699 2644550416 256
100 iso_pu_bacteria 2675903515 2678262568 256
101 iso_pu_bacteria 2744054620 2745008910 256
102 iso_pu_bacteria 2765235841 2765585391 256
103 iso_pu_bacteria 2941531003 2941535251 256
104 iso_pu_bacteria 2998344455 2998348387 256
105 iso_pu_bacteria 3007803356 3007805160 256
106 3300005329 Ga0070683_100010524 Ga0070683_1000105246 257
107 3300005535 Ga0070684_100092980 Ga0070684_1000929802 257
108 iso_pu_bacteria 2738541294 2738809677 257
109 iso_pu_bacteria 2738541309 2738897037 257
110 iso_pu_bacteria 2902048731 2902049523 257
111 3300005459 Ga0068867_100109494 Ga0068867_1001094942 258
112 3300005539 Ga0068853_100159078 Ga0068853_1001590783 258
113 3300005545 Ga0070695_100059959 Ga0070695_1000599592 258
114 3300005546 Ga0070696_100039166 Ga0070696_1000391663 258
115 3300005549 Ga0070704_100179863 Ga0070704_1001798633 258
116 3300005578 Ga0068854_100606631 Ga0068854_1006066311 258
117 3300005617 Ga0068859_100161681 Ga0068859_1001616812 258
118 3300005617 Ga0068859_100330710 Ga0068859_1003307102 258
119 3300005985 Ga0081539_10000001 Ga0081539_10000001298 258
120 3300006051 Ga0075364_10066095 Ga0075364_100660952 258
121 3300006177 Ga0075362_10001043 Ga0075362_100010432 258
122 3300006178 Ga0075367_10105360 Ga0075367_101053602 258
123 3300006195 Ga0075366_10027621 Ga0075366_100276214 258
124 3300006195 Ga0075366_10067940 Ga0075366_100679401 258
125 3300006353 Ga0075370_10003466 Ga0075370_100034665 258
126 3300006353 Ga0075370_10020129 Ga0075370_100201292 258
127 3300006931 Ga0097620_100161689 Ga0097620_1001616892 258
128 3300006931 Ga0097620_100330720 Ga0097620_1003307202 258
129 3300009093 Ga0105240_10196678 Ga0105240_101966783 258
130 3300009094 Ga0111539_10016755 Ga0111539_100167552 258
131 3300009098 Ga0105245_10009933 Ga0105245_100099338 258
132 3300009101 Ga0105247_10312799 Ga0105247_103127992 258
133 3300009545 Ga0105237_10058845 Ga0105237_100588454 258
134 3300009551 Ga0105238_10457443 Ga0105238_104574432 258
135 3300010375 Ga0105239_10037970 Ga0105239_100379702 258
136 3300013104 Ga0157370_10000637 Ga0157370_1000063710 258
137 3300013306 Ga0163162_10258953 Ga0163162_102589532 258
138 3300014326 Ga0157380_10029945 Ga0157380_100299452 258
139 3300014326 Ga0157380_10056191 Ga0157380_100561912 258
140 3300017792 Ga0163161_10005519 Ga0163161_100055191 258
141 3300025913 Ga0207695_10153428 Ga0207695_101534282 258
142 3300025913 Ga0207695_10272889 Ga0207695_102728892 258
143 3300025914 Ga0207671_10043638 Ga0207671_100436383 258
144 3300025960 Ga0207651_10123064 Ga0207651_101230643 258
145 3300026089 Ga0207648_10138860 Ga0207648_101388602 258
146 3300026116 Ga0207674_10402134 Ga0207674_104021342 258
147 3300026142 Ga0207698_10129042 Ga0207698_101290422 258
148 3300028786 Ga0307517_10217736 Ga0307517_102177362 258
149 3300031548 Ga0307408_100060023 Ga0307408_1000600233 258
150 3300031731 Ga0307405_10223139 Ga0307405_102231392 258
151 3300032002 Ga0307416_100428441 Ga0307416_1004284412 258
152 3300032004 Ga0307414_10000074 Ga0307414_1000007442 258
153 3300047323 Ga0495683_0006783 Ga0495683_0006783_1429_2205 258
154 3300050489 nmdc:mga03683_13112_c1 nmdc:mga03683_13112_c1_1677_2453 258
155 3300050491 nmdc:mga00v17_136613_c1 nmdc:mga00v17_136613_c1_223_999 258
156 3300050493 nmdc:mga0k408_30076_c1 nmdc:mga0k408_30076_c1_1285_2061 258
157 3300050493 nmdc:mga0k408_33290_c1 nmdc:mga0k408_33290_c1_1730_2506 258
158 3300050493 nmdc:mga0k408_52532_c1 nmdc:mga0k408_52532_c1_757_1533 258
159 3300050496 nmdc:mga07m45_17411_c1 nmdc:mga07m45_17411_c1_1284_2060 258
160 3300050496 nmdc:mga07m45_20887_c1 nmdc:mga07m45_20887_c1_1438_2214 258
161 3300003781 Ga0055536_1000387 Ga0055536_100038711 259
162 3300003791 Ga0055530_10000089 Ga0055530_1000008958 259
163 3300003794 Ga0055531_10022249 Ga0055531_100222493 259
164 3300005329 Ga0070683_100365340 Ga0070683_1003653401 259
165 3300005365 Ga0070688_100119318 Ga0070688_1001193182 259
166 3300005366 Ga0070659_100151017 Ga0070659_1001510171 259
167 3300005518 Ga0070699_100001003 Ga0070699_10000100322 259
168 3300005577 Ga0068857_100136203 Ga0068857_1001362033 259
169 3300005617 Ga0068859_100031392 Ga0068859_1000313923 259
170 3300005617 Ga0068859_100262040 Ga0068859_1002620401 259
171 3300005843 Ga0068860_100153587 Ga0068860_1001535872 259
172 3300006051 Ga0075364_10048036 Ga0075364_100480362 259
173 3300006178 Ga0075367_10004139 Ga0075367_100041392 259
174 3300006353 Ga0075370_10010444 Ga0075370_100104444 259
175 3300006931 Ga0097620_100031390 Ga0097620_1000313904 259
176 3300006931 Ga0097620_100262062 Ga0097620_1002620623 259
177 3300013104 Ga0157370_10467577 Ga0157370_104675772 259
178 3300014969 Ga0157376_10266765 Ga0157376_102667652 259
179 3300025292 Ga0209676_1000824 Ga0209676_100082431 259
180 3300025298 Ga0209050_1000042 Ga0209050_100004269 259
181 3300025304 Ga0209257_1000826 Ga0209257_100082632 259
182 3300025942 Ga0207689_10173674 Ga0207689_101736742 259
183 3300025944 Ga0207661_10010854 Ga0207661_100108544 259
184 3300027614 Ga0209970_1000527 Ga0209970_10005272 259
185 3300028577 Ga0265318_10000023 Ga0265318_10000023122 259
186 3300029957 Ga0265324_10032935 Ga0265324_100329353 259
187 3300031548 Ga0307408_100000330 Ga0307408_10000033022 259
188 3300031595 Ga0265313_10010309 Ga0265313_100103097 259
189 3300031711 Ga0265314_10000631 Ga0265314_1000063112 259
190 3300031911 Ga0307412_10129451 Ga0307412_101294512 259
191 3300032004 Ga0307414_10000209 Ga0307414_1000020912 259
192 3300038725 Ga0400484_01941 Ga0400484_01941_15882_16667 259
193 3300041486 Ga0451807_0646179 Ga0451807_0646179_10_789 259
194 3300042439 Ga0439464_0022735 Ga0439464_0022735_403_1182 259
195 3300044673 Ga0453683_0004283 Ga0453683_0004283_7659_8438 259
196 3300044712 Ga0453684_0549463 Ga0453684_0549463_297_1076 259
197 3300045051 Ga0451576_0111252 Ga0451576_0111252_1953_2732 259
198 3300047317 Ga0495604_0121629 Ga0495604_0121629_174_953 259
199 3300048918 Ga0496115_0025775 Ga0496115_0025775_3208_3987 259
200 3300048928 Ga0496125_0000031 Ga0496125_0000031_101454_102233 259
201 3300048929 Ga0496126_0009607 Ga0496126_0009607_3850_4629 259
202 3300050491 nmdc:mga00v17_15256_c1 nmdc:mga00v17_15256_c1_618_1397 259
203 3300050493 nmdc:mga0k408_27307_c1 nmdc:mga0k408_27307_c1_595_1374 259
204 3300050494 nmdc:mga06z11_19038_c1 nmdc:mga06z11_19038_c1_683_1462 259
205 3300050496 nmdc:mga07m45_8017_c1 nmdc:mga07m45_8017_c1_1329_2108 259
206 3300050511 nmdc:mga08y16_911436_c1 nmdc:mga08y16_911436_c1_56_835 259
207 3300053096 Ga0500641_0000062 Ga0500641_0000062_17043_17822 259
208 3300003323 rootH1_10307812 rootH1_103078122 260
209 3300005289 Ga0065704_10076392 Ga0065704_100763922 260
210 3300005289 Ga0065704_10154262 Ga0065704_101542622 260
211 3300005356 Ga0070674_100025207 Ga0070674_1000252073 260
212 3300005983 Ga0081540_1019319 Ga0081540_10193193 260
213 3300006186 Ga0075369_10035019 Ga0075369_100350193 260
214 3300009092 Ga0105250_10000586 Ga0105250_100005869 260
215 3300009092 Ga0105250_10189609 Ga0105250_101896091 260
216 3300009094 Ga0111539_10042908 Ga0111539_100429082 260
217 3300009148 Ga0105243_10000971 Ga0105243_1000097119 260
218 3300009176 Ga0105242_10157841 Ga0105242_101578413 260
219 3300013102 Ga0157371_10003057 Ga0157371_100030574 260
220 3300013104 Ga0157370_10277291 Ga0157370_102772912 260
221 3300013306 Ga0163162_10000585 Ga0163162_1000058516 260
222 3300013308 Ga0157375_10017740 Ga0157375_100177402 260
223 3300025711 Ga0207696_1000606 Ga0207696_100060617 260
224 3300025728 Ga0207655_1023970 Ga0207655_10239701 260
225 3300025735 Ga0207713_1001664 Ga0207713_10016648 260
226 3300025735 Ga0207713_1004791 Ga0207713_10047912 260
227 3300025914 Ga0207671_10070526 Ga0207671_100705262 260
228 3300025935 Ga0207709_10041441 Ga0207709_100414412 260
229 3300031507 Ga0307509_10011494 Ga0307509_100114942 260
230 3300031548 Ga0307408_100000779 Ga0307408_10000077920 260
231 3300035114 Ga0373939_0074920 Ga0373939_0074920_22_804 260
232 3300035691 Ga0373931_0119408 Ga0373931_0119408_369_1151 260
233 3300038741 Ga0400488_58007 Ga0400488_58007_5674_6462 260
234 3300042876 Ga0451577_0200562 Ga0451577_0200562_55_837 260
235 3300044712 Ga0453684_0453977 Ga0453684_0453977_448_1230 260
236 3300045051 Ga0451576_0000183 Ga0451576_0000183_63974_64762 260
237 3300045051 Ga0451576_0101119 Ga0451576_0101119_1330_2112 260
238 3300046460 Ga0495638_0000726 Ga0495638_0000726_19767_20549 260
239 3300046506 Ga0495583_0000460 Ga0495583_0000460_42913_43695 260
240 3300046557 Ga0495622_0027292 Ga0495622_0027292_1046_1828 260
241 3300046660 Ga0495625_0119832 Ga0495625_0119832_863_1645 260
242 3300046663 Ga0495635_0095125 Ga0495635_0095125_725_1507 260
243 3300046665 Ga0495661_0034122 Ga0495661_0034122_1537_2319 260
244 3300046692 Ga0495671_0000501 Ga0495671_0000501_14210_14992 260
245 3300046810 Ga0495660_0000971 Ga0495660_0000971_9024_9806 260
246 3300047320 Ga0495672_0000795 Ga0495672_0000795_14138_14920 260
247 3300047469 Ga0495673_0107215 Ga0495673_0107215_267_1049 260
248 3300047472 Ga0495686_0139150 Ga0495686_0139150_343_1125 260
249 3300048908 Ga0496105_0186220 Ga0496105_0186220_467_1249 260
250 3300048922 Ga0496119_0060202 Ga0496119_0060202_124_906 260
251 3300048927 Ga0496124_0009718 Ga0496124_0009718_7999_8787 260
252 3300048927 Ga0496124_0064775 Ga0496124_0064775_2115_2897 260
253 3300053119 Ga0500595_002193 Ga0500595_002193_2696_3478 260
254 3300005327 Ga0070658_10048436 Ga0070658_100484362 261
255 3300005344 Ga0070661_100002180 Ga0070661_1000021802 261
256 3300005456 Ga0070678_100676577 Ga0070678_1006765771 261
257 3300005518 Ga0070699_100184448 Ga0070699_1001844482 261
258 3300005530 Ga0070679_100001200 Ga0070679_1000012007 261
259 3300005563 Ga0068855_100056361 Ga0068855_1000563614 261
260 3300006358 Ga0068871_100183318 Ga0068871_1001833182 261
261 3300006846 Ga0075430_100003833 Ga0075430_1000038332 261
262 3300006880 Ga0075429_100000282 Ga0075429_10000028224 261
263 3300009011 Ga0105251_10000751 Ga0105251_1000075113 261
264 3300009093 Ga0105240_10284265 Ga0105240_102842651 261
265 3300013102 Ga0157371_10004211 Ga0157371_1000421112 261
266 3300013102 Ga0157371_10008952 Ga0157371_100089523 261
267 3300013102 Ga0157371_10010391 Ga0157371_100103917 261
268 3300013307 Ga0157372_10001711 Ga0157372_1000171114 261
269 3300025735 Ga0207713_1000769 Ga0207713_100076918 261
270 3300025909 Ga0207705_10027401 Ga0207705_100274013 261
271 3300025917 Ga0207660_10011200 Ga0207660_100112004 261
272 3300025921 Ga0207652_10002231 Ga0207652_100022317 261
273 3300025949 Ga0207667_10003744 Ga0207667_100037444 261
274 3300028379 Ga0268266_10033082 Ga0268266_100330825 261
275 3300028794 Ga0307515_10037927 Ga0307515_100379273 261
276 3300030745 Ga0316182_1155512 Ga0316182_11555123 261
277 3300032004 Ga0307414_10013030 Ga0307414_100130304 261
278 3300042009 Ga0439451_000029 Ga0439451_000029_9712_10497 261
279 3300042016 Ga0439463_002809 Ga0439463_002809_1666_2451 261
280 3300042131 Ga0450894_016674 Ga0450894_016674_54_956 261
281 3300045051 Ga0451576_0037322 Ga0451576_0037322_1651_2439 261
282 3300046660 Ga0495625_0193334 Ga0495625_0193334_350_1135 261
283 3300046664 Ga0495659_0027104 Ga0495659_0027104_1022_1816 261
284 3300048925 Ga0496122_0002040 Ga0496122_0002040_12697_13482 261
285 3300048926 Ga0496123_0001660 Ga0496123_0001660_16408_17193 261
286 3300050493 nmdc:mga0k408_150836_c1 nmdc:mga0k408_150836_c1_252_1037 261
287 3300050508 nmdc:mga09592_425_c1 nmdc:mga09592_425_c1_17897_18688 261
288 3300050509 nmdc:mga0qj67_3517_c1 nmdc:mga0qj67_3517_c1_6112_6903 261
289 3300003759 Ga0055525_1000246 Ga0055525_100024635 262
290 3300005327 Ga0070658_10553971 Ga0070658_105539711 262
291 3300005336 Ga0070680_100677611 Ga0070680_1006776111 262
292 3300005435 Ga0070714_100454658 Ga0070714_1004546582 262
293 3300025230 Ga0209563_100007 Ga0209563_1000071392 262
294 3300025253 Ga0209677_104292 Ga0209677_1042925 262
295 3300025909 Ga0207705_10410315 Ga0207705_104103152 262
296 3300025929 Ga0207664_10406164 Ga0207664_104061642 262
297 3300031249 Ga0265339_10113486 Ga0265339_101134862 262
298 3300032002 Ga0307416_100094962 Ga0307416_1000949623 262
299 3300037312 Ga0395899_0000963 Ga0395899_0000963_23337_24125 262
300 3300037418 Ga0395900_0011277 Ga0395900_0011277_7700_8488 262
301 3300037466 Ga0395898_0000886 Ga0395898_0000886_20479_21273 262
302 3300037466 Ga0395898_0005833 Ga0395898_0005833_2461_3249 262
303 3300037471 Ga0395905_0013269 Ga0395905_0013269_3487_4275 262
304 3300038443 Ga0395901_0021939 Ga0395901_0021939_2598_3386 262
305 3300041408 Ga0439453_0001655 Ga0439453_0001655_54_857 262
306 3300042436 Ga0439435_0027478 Ga0439435_0027478_158_961 262
307 3300044656 Ga0466969_0017852 Ga0466969_0017852_2873_3667 262
308 3300044693 Ga0466961_0002292 Ga0466961_0002292_6854_7648 262
309 3300044706 Ga0466964_0017133 Ga0466964_0017133_794_1588 262
310 3300044719 Ga0466971_0000466 Ga0466971_0000466_7485_8279 262
311 3300044765 Ga0466970_0015686 Ga0466970_0015686_2441_3235 262
312 3300044842 Ga0466957_0000307 Ga0466957_0000307_16423_17217 262
313 3300045976 Ga0466967_0455745 Ga0466967_0455745_24_818 262
314 3300046453 Ga0495627_000245 Ga0495627_000245_19306_20094 262
315 3300046492 Ga0495585_0002038 Ga0495585_0002038_8830_9618 262
316 3300046492 Ga0495585_0199329 Ga0495585_0199329_220_1008 262
317 3300046524 Ga0495648_0108691 Ga0495648_0108691_32_820 262
318 3300046665 Ga0495661_0064591 Ga0495661_0064591_88_876 262
319 3300046684 Ga0495669_0002671 Ga0495669_0002671_2509_3297 262
320 3300046692 Ga0495671_0000349 Ga0495671_0000349_15512_16300 262
321 3300046692 Ga0495671_0000405 Ga0495671_0000405_20177_20965 262
322 3300046794 Ga0495589_0010358 Ga0495589_0010358_2770_3558 262
323 3300047445 Ga0495677_0014934 Ga0495677_0014934_1680_2468 262
324 3300048916 Ga0496113_0057161 Ga0496113_0057161_1794_2594 262
325 3300048925 Ga0496122_0096477 Ga0496122_0096477_228_1028 262
326 3300048926 Ga0496123_0016233 Ga0496123_0016233_4134_4934 262
327 3300049581 Ga0501047_0349635 Ga0501047_0349635_112_903 262
328 3300049823 Ga0501044_0022540 Ga0501044_0022540_2337_3143 262
329 3300061719 Ga0466962_0001100 Ga0466962_0001100_6978_7772 262
330 3300014326 Ga0157380_10004132 Ga0157380_100041322 263
331 3300032126 Ga0307415_100021391 Ga0307415_1000213912 263
332 3300005356 Ga0070674_100477338 Ga0070674_1004773381 264
333 3300006871 Ga0075434_100066550 Ga0075434_1000665501 264
334 3300046507 Ga0495606_0001096 Ga0495606_0001096_16779_17585 268
335 3300003203 JGI25406J46586_10000014 JGI25406J46586_1000001426 269
336 3300005985 Ga0081539_10000008 Ga0081539_10000008168 269
337 3300048915 Ga0496112_0000008 Ga0496112_0000008_249646_250455 269

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

44

275

0.97

PF01207

Dus

Dihydrouridine synthase (Dus)

92

189

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tdn-assembly1.cif.gz_A computationally designed two-fold symmetric tim-barrel protein, flr 0.9553 122 229
3tdm-assembly2.cif.gz_C computationally designed tim-barrel protein, halfflr 0.9442 122 228
4evz-assembly2.cif.gz_B structure of hisf-luca 0.9235 1 230
4fx7-assembly4.cif.gz_D structure of sym2 d9v+d55v+d130v+d176v 0.9143 5 229
4evz-assembly1.cif.gz_A structure of hisf-luca 0.9039 1 257
ID Description Score Start End Superfamily
3tdnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9553 122 229 3.40.50.12600
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9297 6 229 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.901 8 229 3.20.20.70
4x2rA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8907 3 229 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.882 5 254 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A383DGM3-F1-model_v4 Uncharacterized protein 0.9874 1 121 GO:0000105
GO:0000107
AF-N1U730-F1-model_v4 imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) 0.987 1 185 GO:0000105
GO:0000107
GO:0016829
AF-A0A379SSS1-F1-model_v4 Imidazole glycerol phosphate synthase cyclasesubunit (EC 4.1.3.-) 0.9852 1 106 GO:0000105
GO:0000107
GO:0016829
AF-A0A109WUZ0-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9848 75 216 GO:0000105
GO:0000107
GO:0016829
AF-A0A4V1SLZ8-F1-model_v4 Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) 0.9835 1 165 GO:0000105
GO:0000107
GO:0016829

Feature Viewer

pLDDT pTM Quality
91.22 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map