F413184
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 249 | 306 | 258 |
Family's Representative Sequence
| Representative Sequence | 3300042131|Ga0450894_016674|Ga0450894_016674_54_956 |
| Length | 300 |
| Sequence | MALISAARFLWIISTASSFTRKKAITLVSRFLKISRNYEMLRPRIIPCLLIQDGGLVKTVRFKDSKYVGDPINAVKIFNEKEADELIVLDIDATVTDREPNYKQIAILAAECRMPLCYGGGIRTVGQAQKIIASGVEKVAISSAALGNPQLVTQIANEIGRQSVVVVLDHKKRLLSKQHDVWTHNGKVNTKRNVLDVAKEMEALGAGEIVINSIDNDGRMKGYDLELSLQLRKAVNTPVTILGGAGSLDDMRAVISSCGVVGVAAGSFFVFKGPYRAVLISYPDITQKEKFIFSALHPTH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 2 | 2585428060 | Chryseobacterium sp. OV715 | Isolate | Rhizosphere |
| 3 | 2585428183 | Chryseobacterium sp. YR485 | Isolate | Rhizosphere |
| 4 | 2588253712 | Chryseobacterium sp. OV279 | Isolate | Rhizosphere |
| 5 | 2588254257 | Chryseobacterium sp. YR203 | Isolate | Rhizosphere |
| 6 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 7 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 8 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 9 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 10 | 2643221699 | Brevundimonas sp. Root1423 | Isolate | Unclassified |
| 11 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 12 | 2728369107 | Chryseobacterium kwangjuense KJ1R5 | Isolate | Unclassified |
| 13 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 14 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 15 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 16 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 17 | 2772190705 | Chryseobacterium contaminans C-26 | Isolate | Rhizosphere |
| 18 | 2775506739 | Chryseobacterium sp. 1335 | Isolate | Unclassified |
| 19 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 20 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 21 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 22 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 23 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 24 | 2842083920 | Chryseobacterium lathyri KCTC 22544 | Isolate | Rhizosphere |
| 25 | 2871720351 | Chryseobacterium sp. KLBC 52 | Isolate | Nodule |
| 26 | 2902048731 | Pedobacter ureilyticus THG-T11 | Isolate | Rhizosphere |
| 27 | 2919097161 | Chryseobacterium ginsenosidimutans 1394 | Isolate | Rhizosphere |
| 28 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 29 | 2946019816 | Chryseobacterium sp. W4I1 | Isolate | Rhizosphere |
| 30 | 2993372514 | Chryseobacterium sp. SLBN-27 | Isolate | Rhizosphere |
| 31 | 2998344455 | Vogesella urethralis SLBN-145 | Isolate | Rhizosphere |
| 32 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 33 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 34 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 35 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 38 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 39 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 40 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 41 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 42 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 43 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 52 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 132 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 133 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 134 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 136 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 140 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 141 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 142 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 145 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 146 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 147 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 150 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 151 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 152 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 153 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 154 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 155 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 156 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 157 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 158 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 159 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 160 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 161 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 162 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 163 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 164 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 165 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 166 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 167 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 168 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 169 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 170 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 171 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 172 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 173 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 174 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 175 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 213 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 214 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 215 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 216 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 217 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 218 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 219 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 220 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 221 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 222 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 223 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 224 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 225 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 229 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 230 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 233 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 234 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 235 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 241 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 242 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 243 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 244 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 246 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 247 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 248 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 249 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.5 |
| Metatranscriptomes | 0 |
| Isolates | 9.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.06 |
| Nodule | 1.48 |
| Rhizoplane | 4.15 |
| Rhizosphere | 68.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000014 | 3300003203 | Bacteria | 93855 |
| 2 | rootH2_10243076 | 3300003320 | Bacteria | 1484 |
| 3 | rootL2_10203214 | 3300003322 | Bacteria | 2375 |
| 4 | rootH1_10007743 | 3300003316 | Bacteria | 6031 |
| 5 | rootH1_10007743 | 3300003323 | Bacteria | 19767 |
| 6 | rootH1_10307812 | 3300003323 | Bacteria | 1083 |
| 7 | Ga0055525_1000246 | 3300003759 | Bacteria | 54885 |
| 8 | Ga0055536_1000387 | 3300003781 | Bacteria | 32286 |
| 9 | Ga0055534_1013646 | 3300003784 | Bacteria | 1553 |
| 10 | Ga0055530_10000089 | 3300003791 | Bacteria | 78801 |
| 11 | Ga0055531_10022249 | 3300003794 | Bacteria | 2423 |
| 12 | Ga0065704_10076392 | 3300005289 | Bacteria | 5139 |
| 13 | Ga0065704_10154262 | 3300005289 | Bacteria | 1393 |
| 14 | Ga0070658_10048436 | 3300005327 | Bacteria | 3441 |
| 15 | Ga0070658_10553971 | 3300005327 | Bacteria | 995 |
| 16 | Ga0070683_100010524 | 3300005329 | Bacteria | 7954 |
| 17 | Ga0070683_100365340 | 3300005329 | Bacteria | 1374 |
| 18 | Ga0070670_100016636 | 3300005331 | Bacteria | 6311 |
| 19 | Ga0070666_10315589 | 3300005335 | Unclassified | 1114 |
| 20 | Ga0070680_100677611 | 3300005336 | Bacteria | 887 |
| 21 | Ga0070691_10027757 | 3300005341 | Unclassified | 2642 |
| 22 | Ga0070661_100002180 | 3300005344 | Bacteria | 13483 |
| 23 | Ga0070674_100025207 | 3300005356 | Bacteria | 3869 |
| 24 | Ga0070674_100477338 | 3300005356 | Bacteria | 1034 |
| 25 | Ga0070688_100119318 | 3300005365 | Bacteria | 1764 |
| 26 | Ga0070659_100151017 | 3300005366 | Bacteria | 1895 |
| 27 | Ga0070667_100210057 | 3300005367 | Bacteria | 1730 |
| 28 | Ga0070714_100454658 | 3300005435 | Bacteria | 1217 |
| 29 | Ga0070678_100676577 | 3300005456 | Bacteria | 928 |
| 30 | Ga0068867_100109494 | 3300005459 | Bacteria | 2120 |
| 31 | Ga0068867_100365947 | 3300005459 | Bacteria | 1207 |
| 32 | Ga0070699_100001003 | 3300005518 | Bacteria | 26263 |
| 33 | Ga0070699_100184448 | 3300005518 | Unclassified | 1852 |
| 34 | Ga0070679_100001200 | 3300005530 | Bacteria | 22788 |
| 35 | Ga0070684_100092980 | 3300005535 | Bacteria | 2684 |
| 36 | Ga0068853_100159078 | 3300005539 | Bacteria | 2037 |
| 37 | Ga0070695_100059959 | 3300005545 | Bacteria | 2465 |
| 38 | Ga0070696_100039166 | 3300005546 | Bacteria | 3273 |
| 39 | Ga0070704_100179863 | 3300005549 | Bacteria | 1690 |
| 40 | Ga0068855_100056361 | 3300005563 | Bacteria | 4612 |
| 41 | Ga0068857_100136203 | 3300005577 | Bacteria | 2217 |
| 42 | Ga0068854_100606631 | 3300005578 | Bacteria | 935 |
| 43 | Ga0068859_100031392 | 3300005617 | Bacteria | 5335 |
| 44 | Ga0068859_100161681 | 3300005617 | Bacteria | 2318 |
| 45 | Ga0068859_100262040 | 3300005617 | Bacteria | 1820 |
| 46 | Ga0068859_100330710 | 3300005617 | Bacteria | 1618 |
| 47 | Ga0068860_100153587 | 3300005843 | Bacteria | 2218 |
| 48 | Ga0081540_1019319 | 3300005983 | Bacteria | 4147 |
| 49 | Ga0081540_1104633 | 3300005983 | Bacteria | 1211 |
| 50 | Ga0081539_10000001 | 3300005985 | Bacteria | 808331 |
| 51 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 52 | Ga0075364_10048036 | 3300006051 | Bacteria | 2780 |
| 53 | Ga0075364_10066095 | 3300006051 | Bacteria | 2375 |
| 54 | Ga0075362_10001043 | 3300006177 | Bacteria | 8543 |
| 55 | Ga0075367_10004139 | 3300006178 | Bacteria | 7035 |
| 56 | Ga0075367_10105360 | 3300006178 | Bacteria | 1727 |
| 57 | Ga0075369_10035019 | 3300006186 | Bacteria | 2133 |
| 58 | Ga0075366_10027621 | 3300006195 | Bacteria | 3330 |
| 59 | Ga0075366_10067940 | 3300006195 | Bacteria | 2121 |
| 60 | Ga0075370_10003466 | 3300006353 | Bacteria | 7515 |
| 61 | Ga0075370_10010444 | 3300006353 | Bacteria | 4855 |
| 62 | Ga0075370_10020129 | 3300006353 | Bacteria | 3643 |
| 63 | Ga0068871_100183318 | 3300006358 | Bacteria | 1800 |
| 64 | Ga0075430_100003833 | 3300006846 | Bacteria | 12661 |
| 65 | Ga0075434_100066550 | 3300006871 | Bacteria | 3589 |
| 66 | Ga0075429_100000282 | 3300006880 | Bacteria | 35849 |
| 67 | Ga0097620_100031390 | 3300006931 | Bacteria | 5335 |
| 68 | Ga0097620_100161689 | 3300006931 | Bacteria | 2318 |
| 69 | Ga0097620_100262062 | 3300006931 | Bacteria | 1820 |
| 70 | Ga0097620_100330720 | 3300006931 | Bacteria | 1618 |
| 71 | Ga0105251_10000751 | 3300009011 | Bacteria | 29613 |
| 72 | Ga0105250_10000586 | 3300009092 | Bacteria | 23882 |
| 73 | Ga0105250_10189609 | 3300009092 | Bacteria | 865 |
| 74 | Ga0105240_10196678 | 3300009093 | Bacteria | 2366 |
| 75 | Ga0105240_10284265 | 3300009093 | Bacteria | 1899 |
| 76 | Ga0111539_10016755 | 3300009094 | Bacteria | 9083 |
| 77 | Ga0111539_10042908 | 3300009094 | Bacteria | 5427 |
| 78 | Ga0105245_10009933 | 3300009098 | Bacteria | 8292 |
| 79 | Ga0105245_10352631 | 3300009098 | Bacteria | 1458 |
| 80 | Ga0105247_10312799 | 3300009101 | Bacteria | 1093 |
| 81 | Ga0105243_10000971 | 3300009148 | Bacteria | 26695 |
| 82 | Ga0105242_10157841 | 3300009176 | Bacteria | 1983 |
| 83 | Ga0105237_10058845 | 3300009545 | Bacteria | 3846 |
| 84 | Ga0105238_10457443 | 3300009551 | Bacteria | 1274 |
| 85 | Ga0105249_10796706 | 3300009553 | Bacteria | 1009 |
| 86 | Ga0105239_10037970 | 3300010375 | Bacteria | 5278 |
| 87 | Ga0157371_10003057 | 3300013102 | Bacteria | 15523 |
| 88 | Ga0157371_10004211 | 3300013102 | Bacteria | 12663 |
| 89 | Ga0157371_10008952 | 3300013102 | Bacteria | 7920 |
| 90 | Ga0157371_10010391 | 3300013102 | Bacteria | 7257 |
| 91 | Ga0157370_10000637 | 3300013104 | Bacteria | 43772 |
| 92 | Ga0157370_10002654 | 3300013104 | Bacteria | 21470 |
| 93 | Ga0157370_10003839 | 3300013104 | Bacteria | 17518 |
| 94 | Ga0157370_10277291 | 3300013104 | Bacteria | 1549 |
| 95 | Ga0157370_10467577 | 3300013104 | Bacteria | 1159 |
| 96 | Ga0157369_10000477 | 3300013105 | Bacteria | 53128 |
| 97 | Ga0163162_10000585 | 3300013306 | Bacteria | 33759 |
| 98 | Ga0163162_10258953 | 3300013306 | Bacteria | 1871 |
| 99 | Ga0157372_10001711 | 3300013307 | Bacteria | 23811 |
| 100 | Ga0157372_10111810 | 3300013307 | Bacteria | 3129 |
| 101 | Ga0157372_11284938 | 3300013307 | Bacteria | 845 |
| 102 | Ga0157375_10000220 | 3300013308 | Bacteria | 53557 |
| 103 | Ga0157375_10017740 | 3300013308 | Bacteria | 6434 |
| 104 | Ga0157375_10031078 | 3300013308 | Bacteria | 5041 |
| 105 | Ga0157380_10003703 | 3300014326 | Bacteria | 10507 |
| 106 | Ga0157380_10004132 | 3300014326 | Bacteria | 10031 |
| 107 | Ga0157380_10029945 | 3300014326 | Bacteria | 4165 |
| 108 | Ga0157380_10056191 | 3300014326 | Bacteria | 3129 |
| 109 | Ga0157376_10124743 | 3300014969 | Bacteria | 2288 |
| 110 | Ga0157376_10266765 | 3300014969 | Bacteria | 1606 |
| 111 | Ga0163161_10005519 | 3300017792 | Bacteria | 8763 |
| 112 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 113 | Ga0209677_104292 | 3300025253 | Bacteria | 4176 |
| 114 | Ga0209675_1000053 | 3300025291 | Bacteria | 194511 |
| 115 | Ga0209676_1000824 | 3300025292 | Bacteria | 40329 |
| 116 | Ga0209050_1000042 | 3300025298 | Bacteria | 402842 |
| 117 | Ga0209257_1000826 | 3300025304 | Bacteria | 44769 |
| 118 | Ga0207696_1000606 | 3300025711 | Bacteria | 26792 |
| 119 | Ga0207655_1023970 | 3300025728 | Bacteria | 3007 |
| 120 | Ga0207713_1000769 | 3300025735 | Bacteria | 29621 |
| 121 | Ga0207713_1001664 | 3300025735 | Bacteria | 17228 |
| 122 | Ga0207713_1004791 | 3300025735 | Bacteria | 8691 |
| 123 | Ga0207705_10027401 | 3300025909 | Bacteria | 4064 |
| 124 | Ga0207705_10410315 | 3300025909 | Bacteria | 1048 |
| 125 | Ga0207695_10153428 | 3300025913 | Bacteria | 2240 |
| 126 | Ga0207695_10272889 | 3300025913 | Bacteria | 1586 |
| 127 | Ga0207671_10043638 | 3300025914 | Bacteria | 3316 |
| 128 | Ga0207671_10070526 | 3300025914 | Bacteria | 2605 |
| 129 | Ga0207660_10011200 | 3300025917 | Bacteria | 5831 |
| 130 | Ga0207652_10002231 | 3300025921 | Bacteria | 16521 |
| 131 | Ga0207681_10235556 | 3300025923 | Bacteria | 1423 |
| 132 | Ga0207687_10004831 | 3300025927 | Bacteria | 8963 |
| 133 | Ga0207664_10406164 | 3300025929 | Bacteria | 1212 |
| 134 | Ga0207709_10041441 | 3300025935 | Bacteria | 2763 |
| 135 | Ga0207689_10173674 | 3300025942 | Bacteria | 1777 |
| 136 | Ga0207661_10010854 | 3300025944 | Bacteria | 6573 |
| 137 | Ga0207667_10003744 | 3300025949 | Bacteria | 18752 |
| 138 | Ga0207651_10123064 | 3300025960 | Bacteria | 1971 |
| 139 | Ga0207658_10025730 | 3300025986 | Bacteria | 4122 |
| 140 | Ga0207648_10138860 | 3300026089 | Bacteria | 2141 |
| 141 | Ga0207648_10302206 | 3300026089 | Unclassified | 1435 |
| 142 | Ga0207674_10402134 | 3300026116 | Bacteria | 1323 |
| 143 | Ga0207698_10129042 | 3300026142 | Bacteria | 2157 |
| 144 | Ga0209970_1000527 | 3300027614 | Bacteria | 6578 |
| 145 | Ga0268266_10033082 | 3300028379 | Bacteria | 4397 |
| 146 | Ga0265318_10000023 | 3300028577 | Bacteria | 160826 |
| 147 | Ga0307517_10217736 | 3300028786 | Bacteria | 1165 |
| 148 | Ga0307515_10037927 | 3300028794 | Bacteria | 7729 |
| 149 | Ga0265324_10032935 | 3300029957 | Bacteria | 1810 |
| 150 | Ga0316182_1155512 | 3300030745 | Bacteria | 2754 |
| 151 | Ga0265339_10113486 | 3300031249 | Unclassified | 1399 |
| 152 | Ga0307513_10100277 | 3300031456 | Unclassified | 2922 |
| 153 | Ga0307509_10011494 | 3300031507 | Bacteria | 10708 |
| 154 | Ga0307408_100000330 | 3300031548 | Bacteria | 45434 |
| 155 | Ga0307408_100000779 | 3300031548 | Bacteria | 25638 |
| 156 | Ga0307408_100060023 | 3300031548 | Bacteria | 2771 |
| 157 | Ga0265313_10010309 | 3300031595 | Bacteria | 5935 |
| 158 | Ga0265314_10000631 | 3300031711 | Bacteria | 43323 |
| 159 | Ga0307405_10223139 | 3300031731 | Unclassified | 1384 |
| 160 | Ga0307412_10000222 | 3300031911 | Bacteria | 38184 |
| 161 | Ga0307412_10104112 | 3300031911 | Bacteria | 2013 |
| 162 | Ga0307412_10129451 | 3300031911 | Unclassified | 1831 |
| 163 | Ga0307416_100094962 | 3300032002 | Bacteria | 2573 |
| 164 | Ga0307416_100428441 | 3300032002 | Unclassified | 1369 |
| 165 | Ga0307414_10000074 | 3300032004 | Bacteria | 94049 |
| 166 | Ga0307414_10000128 | 3300032004 | Bacteria | 53071 |
| 167 | Ga0307414_10000209 | 3300032004 | Bacteria | 39278 |
| 168 | Ga0307414_10013030 | 3300032004 | Bacteria | 4939 |
| 169 | Ga0307415_100021391 | 3300032126 | Bacteria | 3975 |
| 170 | Ga0373939_0074920 | 3300035114 | Bacteria | 1111 |
| 171 | Ga0373931_0119408 | 3300035691 | Bacteria | 1505 |
| 172 | Ga0395899_0000963 | 3300037312 | Bacteria | 26721 |
| 173 | Ga0395900_0011277 | 3300037418 | Bacteria | 9140 |
| 174 | Ga0395898_0000886 | 3300037466 | Bacteria | 48827 |
| 175 | Ga0395898_0005833 | 3300037466 | Bacteria | 13254 |
| 176 | Ga0395905_0013269 | 3300037471 | Bacteria | 7904 |
| 177 | Ga0395901_0021939 | 3300038443 | Bacteria | 6545 |
| 178 | Ga0400484_01941 | 3300038725 | Bacteria | 17261 |
| 179 | Ga0400488_58007 | 3300038741 | Bacteria | 10540 |
| 180 | Ga0439453_0001655 | 3300041408 | Bacteria | 2913 |
| 181 | Ga0451807_0646179 | 3300041486 | Bacteria | 1179 |
| 182 | Ga0439445_0000023 | 3300042004 | Bacteria | 20324 |
| 183 | Ga0439451_000029 | 3300042009 | Bacteria | 31111 |
| 184 | Ga0439463_002809 | 3300042016 | Bacteria | 4413 |
| 185 | Ga0450894_016674 | 3300042131 | Bacteria | 975 |
| 186 | Ga0439435_0027478 | 3300042436 | Unclassified | 1523 |
| 187 | Ga0439464_0022735 | 3300042439 | Bacteria | 1729 |
| 188 | Ga0451577_0200562 | 3300042876 | Bacteria | 1801 |
| 189 | Ga0466969_0017852 | 3300044656 | Bacteria | 3701 |
| 190 | Ga0453683_0004283 | 3300044673 | Bacteria | 10175 |
| 191 | Ga0466961_0002292 | 3300044693 | Bacteria | 11890 |
| 192 | Ga0466964_0017133 | 3300044706 | Bacteria | 2771 |
| 193 | Ga0453684_0453977 | 3300044712 | Unclassified | 1426 |
| 194 | Ga0453684_0549463 | 3300044712 | Bacteria | 1272 |
| 195 | Ga0466971_0000466 | 3300044719 | Bacteria | 15850 |
| 196 | Ga0466970_0015686 | 3300044765 | Bacteria | 3901 |
| 197 | Ga0466957_0000307 | 3300044842 | Bacteria | 23957 |
| 198 | Ga0451576_0000183 | 3300045051 | Bacteria | 157422 |
| 199 | Ga0451576_0037322 | 3300045051 | Bacteria | 5147 |
| 200 | Ga0451576_0101119 | 3300045051 | Bacteria | 2998 |
| 201 | Ga0451576_0111252 | 3300045051 | Bacteria | 2850 |
| 202 | Ga0466967_0455745 | 3300045976 | Bacteria | 1250 |
| 203 | Ga0495627_000245 | 3300046453 | Bacteria | 57165 |
| 204 | Ga0495590_0000338 | 3300046457 | Bacteria | 24377 |
| 205 | Ga0495638_0000726 | 3300046460 | Bacteria | 35496 |
| 206 | Ga0495584_0002205 | 3300046491 | Bacteria | 11109 |
| 207 | Ga0495585_0002038 | 3300046492 | Bacteria | 14899 |
| 208 | Ga0495585_0199329 | 3300046492 | Bacteria | 1020 |
| 209 | Ga0495607_0000810 | 3300046501 | Bacteria | 29648 |
| 210 | Ga0495583_0000460 | 3300046506 | Bacteria | 60178 |
| 211 | Ga0495606_0001096 | 3300046507 | Bacteria | 38817 |
| 212 | Ga0495606_0002199 | 3300046507 | Bacteria | 23384 |
| 213 | Ga0495632_0000120 | 3300046519 | Bacteria | 80853 |
| 214 | Ga0495637_0000574 | 3300046520 | Bacteria | 26147 |
| 215 | Ga0495643_0015956 | 3300046522 | Bacteria | 4423 |
| 216 | Ga0495648_0108691 | 3300046524 | Bacteria | 1514 |
| 217 | Ga0495642_0000421 | 3300046528 | Bacteria | 22501 |
| 218 | Ga0495654_0000711 | 3300046530 | Bacteria | 26011 |
| 219 | Ga0495597_0000822 | 3300046542 | Bacteria | 24434 |
| 220 | Ga0495622_0027292 | 3300046557 | Bacteria | 2665 |
| 221 | Ga0495668_0002285 | 3300046616 | Bacteria | 16110 |
| 222 | Ga0495625_0119832 | 3300046660 | Bacteria | 1792 |
| 223 | Ga0495625_0193334 | 3300046660 | Bacteria | 1347 |
| 224 | Ga0495635_0095125 | 3300046663 | Bacteria | 2037 |
| 225 | Ga0495659_0027104 | 3300046664 | Bacteria | 1974 |
| 226 | Ga0495661_0034122 | 3300046665 | Bacteria | 3204 |
| 227 | Ga0495661_0064591 | 3300046665 | Bacteria | 2159 |
| 228 | Ga0495669_0002671 | 3300046684 | Bacteria | 7300 |
| 229 | Ga0495613_0208010 | 3300046689 | Bacteria | 1377 |
| 230 | Ga0495671_0000349 | 3300046692 | Bacteria | 38480 |
| 231 | Ga0495671_0000405 | 3300046692 | Bacteria | 34951 |
| 232 | Ga0495671_0000501 | 3300046692 | Bacteria | 30161 |
| 233 | Ga0495649_0000913 | 3300046694 | Bacteria | 23330 |
| 234 | Ga0495589_0010358 | 3300046794 | Bacteria | 4841 |
| 235 | Ga0495660_0000971 | 3300046810 | Bacteria | 20957 |
| 236 | Ga0495604_0121629 | 3300047317 | Bacteria | 1889 |
| 237 | Ga0495672_0000795 | 3300047320 | Bacteria | 34131 |
| 238 | Ga0495683_0006783 | 3300047323 | Bacteria | 6225 |
| 239 | Ga0495677_0014934 | 3300047445 | Bacteria | 2824 |
| 240 | Ga0495673_0107215 | 3300047469 | Bacteria | 1121 |
| 241 | Ga0495686_0042086 | 3300047472 | Bacteria | 2906 |
| 242 | Ga0495686_0139150 | 3300047472 | Unclassified | 1433 |
| 243 | Ga0496102_0074008 | 3300048905 | Bacteria | 3131 |
| 244 | Ga0496104_0117007 | 3300048907 | Bacteria | 2558 |
| 245 | Ga0496105_0186220 | 3300048908 | Bacteria | 1699 |
| 246 | Ga0496105_0318869 | 3300048908 | Bacteria | 1246 |
| 247 | Ga0496110_0084734 | 3300048913 | Bacteria | 2829 |
| 248 | Ga0496112_0000008 | 3300048915 | Bacteria | 310323 |
| 249 | Ga0496113_0057161 | 3300048916 | Bacteria | 2931 |
| 250 | Ga0496114_0011085 | 3300048917 | Bacteria | 7194 |
| 251 | Ga0496115_0025775 | 3300048918 | Bacteria | 4582 |
| 252 | Ga0496115_0142184 | 3300048918 | Bacteria | 1980 |
| 253 | Ga0496116_0000006 | 3300048919 | Bacteria | 811937 |
| 254 | Ga0496117_0000027 | 3300048920 | Bacteria | 412234 |
| 255 | Ga0496118_0000620 | 3300048921 | Bacteria | 58296 |
| 256 | Ga0496119_0000006 | 3300048922 | Bacteria | 505999 |
| 257 | Ga0496119_0060202 | 3300048922 | Bacteria | 2275 |
| 258 | Ga0496122_0000444 | 3300048925 | Bacteria | 86587 |
| 259 | Ga0496122_0002040 | 3300048925 | Bacteria | 29985 |
| 260 | Ga0496122_0096477 | 3300048925 | Bacteria | 1993 |
| 261 | Ga0496123_0000958 | 3300048926 | Bacteria | 44671 |
| 262 | Ga0496123_0001660 | 3300048926 | Bacteria | 29864 |
| 263 | Ga0496123_0016233 | 3300048926 | Bacteria | 6058 |
| 264 | Ga0496124_0000475 | 3300048927 | Bacteria | 69109 |
| 265 | Ga0496124_0002357 | 3300048927 | Bacteria | 24921 |
| 266 | Ga0496124_0009718 | 3300048927 | Bacteria | 9847 |
| 267 | Ga0496124_0064775 | 3300048927 | Bacteria | 3050 |
| 268 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 269 | Ga0496125_0015116 | 3300048928 | Bacteria | 7484 |
| 270 | Ga0496125_0017623 | 3300048928 | Bacteria | 6803 |
| 271 | Ga0496126_0009607 | 3300048929 | Bacteria | 10259 |
| 272 | Ga0496126_0217890 | 3300048929 | Bacteria | 1605 |
| 273 | Ga0495678_006186 | 3300049459 | Bacteria | 6407 |
| 274 | Ga0501043_0535219 | 3300049579 | Unclassified | 872 |
| 275 | Ga0501047_0349635 | 3300049581 | Bacteria | 1315 |
| 276 | Ga0501198_014564 | 3300049649 | Bacteria | 1199 |
| 277 | Ga0501241_000018 | 3300049758 | Bacteria | 95195 |
| 278 | Ga0501269_000035 | 3300049766 | Bacteria | 41924 |
| 279 | Ga0501044_0022540 | 3300049823 | Bacteria | 6710 |
| 280 | Ga0501044_0493976 | 3300049823 | Unclassified | 1126 |
| 281 | nmdc:mga03683_13112_c1 | 3300050489 | Bacteria | 3044 |
| 282 | nmdc:mga00v17_136613_c1 | 3300050491 | Bacteria | 1570 |
| 283 | nmdc:mga00v17_15256_c1 | 3300050491 | Bacteria | 4309 |
| 284 | nmdc:mga0k408_150836_c1 | 3300050493 | Bacteria | 1384 |
| 285 | nmdc:mga0k408_27307_c1 | 3300050493 | Bacteria | 3242 |
| 286 | nmdc:mga0k408_30076_c1 | 3300050493 | Bacteria | 3095 |
| 287 | nmdc:mga0k408_33290_c1 | 3300050493 | Bacteria | 2948 |
| 288 | nmdc:mga0k408_52532_c1 | 3300050493 | Bacteria | 2362 |
| 289 | nmdc:mga06z11_19038_c1 | 3300050494 | Bacteria | 3148 |
| 290 | nmdc:mga07m45_17411_c1 | 3300050496 | Bacteria | 3860 |
| 291 | nmdc:mga07m45_20887_c1 | 3300050496 | Bacteria | 3560 |
| 292 | nmdc:mga07m45_6844_c1 | 3300050496 | Bacteria | 5796 |
| 293 | nmdc:mga07m45_8017_c1 | 3300050496 | Bacteria | 5416 |
| 294 | nmdc:mga09592_425_c1 | 3300050508 | Bacteria | 31113 |
| 295 | nmdc:mga0qj67_3517_c1 | 3300050509 | Bacteria | 11303 |
| 296 | nmdc:mga08y16_911436_c1 | 3300050511 | Bacteria | 864 |
| 297 | Ga0500646_0011229 | 3300053090 | Bacteria | 2302 |
| 298 | Ga0500641_0000062 | 3300053096 | Bacteria | 45077 |
| 299 | Ga0500650_0110338 | 3300053098 | Bacteria | 1284 |
| 300 | Ga0500555_053585 | 3300053103 | Bacteria | 1099 |
| 301 | Ga0500556_0050666 | 3300053104 | Bacteria | 1501 |
| 302 | Ga0500595_002193 | 3300053119 | Bacteria | 9918 |
| 303 | Ga0500652_157218 | 3300053131 | Bacteria | 941 |
| 304 | Ga0500655_029808 | 3300053133 | Bacteria | 1048 |
| 305 | Ga0500559_0101263 | 3300053136 | Bacteria | 1328 |
| 306 | Ga0466962_0001100 | 3300061719 | Bacteria | 12445 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049758 | Ga0501241_000018 | Ga0501241_000018_31311_31991 | 226 |
| 2 | 3300025927 | Ga0207687_10004831 | Ga0207687_100048318 | 230 |
| 3 | 3300025923 | Ga0207681_10235556 | Ga0207681_102355562 | 231 |
| 4 | 3300013104 | Ga0157370_10003839 | Ga0157370_100038395 | 232 |
| 5 | 3300013307 | Ga0157372_11284938 | Ga0157372_112849381 | 239 |
| 6 | 3300005983 | Ga0081540_1104633 | Ga0081540_11046331 | 241 |
| 7 | 3300009098 | Ga0105245_10352631 | Ga0105245_103526312 | 241 |
| 8 | 3300053090 | Ga0500646_0011229 | Ga0500646_0011229_587_1312 | 241 |
| 9 | 3300053098 | Ga0500650_0110338 | Ga0500650_0110338_490_1215 | 241 |
| 10 | 3300053104 | Ga0500556_0050666 | Ga0500556_0050666_734_1459 | 241 |
| 11 | 3300053133 | Ga0500655_029808 | Ga0500655_029808_154_879 | 241 |
| 12 | iso_pu_bacteria | 2842038055 | 2842045189 | 241 |
| 13 | iso_pu_bacteria | 2842045827 | 2842049149 | 241 |
| 14 | 3300005335 | Ga0070666_10315589 | Ga0070666_103155892 | 242 |
| 15 | 3300014969 | Ga0157376_10124743 | Ga0157376_101247433 | 242 |
| 16 | 3300013307 | Ga0157372_10111810 | Ga0157372_101118103 | 247 |
| 17 | 3300050496 | nmdc:mga07m45_6844_c1 | nmdc:mga07m45_6844_c1_3984_4727 | 247 |
| 18 | 3300053136 | Ga0500559_0101263 | Ga0500559_0101263_117_860 | 247 |
| 19 | iso_pu_bacteria | 2825651385 | 2825653078 | 247 |
| 20 | 3300046689 | Ga0495613_0208010 | Ga0495613_0208010_571_1317 | 248 |
| 21 | 3300048918 | Ga0496115_0142184 | Ga0496115_0142184_341_1087 | 248 |
| 22 | 3300003323 | rootH1_10007743 | rootH1_1000774318 | 249 |
| 23 | 3300005341 | Ga0070691_10027757 | Ga0070691_100277573 | 249 |
| 24 | 3300013104 | Ga0157370_10002654 | Ga0157370_100026549 | 249 |
| 25 | 3300014326 | Ga0157380_10003703 | Ga0157380_100037038 | 249 |
| 26 | 3300031456 | Ga0307513_10100277 | Ga0307513_101002772 | 249 |
| 27 | 3300053103 | Ga0500555_053585 | Ga0500555_053585_233_985 | 249 |
| 28 | 3300053131 | Ga0500652_157218 | Ga0500652_157218_58_810 | 249 |
| 29 | iso_pu_bacteria | 2871720351 | 2871724023 | 249 |
| 30 | 3300046522 | Ga0495643_0015956 | Ga0495643_0015956_807_1559 | 250 |
| 31 | 3300046528 | Ga0495642_0000421 | Ga0495642_0000421_13290_14042 | 250 |
| 32 | 3300046616 | Ga0495668_0002285 | Ga0495668_0002285_2069_2821 | 250 |
| 33 | 3300048907 | Ga0496104_0117007 | Ga0496104_0117007_505_1257 | 250 |
| 34 | 3300048908 | Ga0496105_0318869 | Ga0496105_0318869_422_1174 | 250 |
| 35 | 3300048917 | Ga0496114_0011085 | Ga0496114_0011085_2019_2771 | 250 |
| 36 | 3300049579 | Ga0501043_0535219 | Ga0501043_0535219_106_858 | 250 |
| 37 | 3300049823 | Ga0501044_0493976 | Ga0501044_0493976_273_1025 | 250 |
| 38 | iso_pu_bacteria | 2585428060 | 2587746060 | 250 |
| 39 | iso_pu_bacteria | 2585428183 | 2588214550 | 250 |
| 40 | iso_pu_bacteria | 2588253712 | 2588444179 | 250 |
| 41 | iso_pu_bacteria | 2588254257 | 2590613943 | 250 |
| 42 | iso_pu_bacteria | 2728369107 | 2729199965 | 250 |
| 43 | iso_pu_bacteria | 2772190705 | 2772607489 | 250 |
| 44 | iso_pu_bacteria | 2775506739 | 2775672003 | 250 |
| 45 | iso_pu_bacteria | 2842083920 | 2842085990 | 250 |
| 46 | iso_pu_bacteria | 2919097161 | 2919098559 | 250 |
| 47 | iso_pu_bacteria | 2946019816 | 2946022592 | 250 |
| 48 | iso_pu_bacteria | 2993372514 | 2993374593 | 250 |
| 49 | 3300046457 | Ga0495590_0000338 | Ga0495590_0000338_14379_15134 | 251 |
| 50 | 3300046491 | Ga0495584_0002205 | Ga0495584_0002205_3739_4494 | 251 |
| 51 | 3300046501 | Ga0495607_0000810 | Ga0495607_0000810_17519_18274 | 251 |
| 52 | 3300046507 | Ga0495606_0002199 | Ga0495606_0002199_13203_13958 | 251 |
| 53 | 3300046520 | Ga0495637_0000574 | Ga0495637_0000574_10864_11619 | 251 |
| 54 | 3300046530 | Ga0495654_0000711 | Ga0495654_0000711_10886_11641 | 251 |
| 55 | 3300046542 | Ga0495597_0000822 | Ga0495597_0000822_14375_15130 | 251 |
| 56 | 3300046694 | Ga0495649_0000913 | Ga0495649_0000913_9226_9981 | 251 |
| 57 | 3300047472 | Ga0495686_0042086 | Ga0495686_0042086_1052_1807 | 251 |
| 58 | 3300048913 | Ga0496110_0084734 | Ga0496110_0084734_1502_2257 | 251 |
| 59 | 3300048927 | Ga0496124_0002357 | Ga0496124_0002357_19983_20738 | 251 |
| 60 | 3300049459 | Ga0495678_006186 | Ga0495678_006186_4371_5126 | 251 |
| 61 | 3300013308 | Ga0157375_10031078 | Ga0157375_100310782 | 252 |
| 62 | 3300031911 | Ga0307412_10104112 | Ga0307412_101041122 | 252 |
| 63 | 3300009553 | Ga0105249_10796706 | Ga0105249_107967061 | 253 |
| 64 | 3300046519 | Ga0495632_0000120 | Ga0495632_0000120_58439_59200 | 253 |
| 65 | 3300049649 | Ga0501198_014564 | Ga0501198_014564_278_1039 | 253 |
| 66 | 3300003320 | rootH2_10243076 | rootH2_102430762 | 254 |
| 67 | 3300003322 | rootL2_10203214 | rootL2_102032142 | 254 |
| 68 | 3300003784 | Ga0055534_1013646 | Ga0055534_10136461 | 254 |
| 69 | 3300005331 | Ga0070670_100016636 | Ga0070670_1000166365 | 254 |
| 70 | 3300013308 | Ga0157375_10000220 | Ga0157375_1000022032 | 254 |
| 71 | 3300025291 | Ga0209675_1000053 | Ga0209675_1000053123 | 254 |
| 72 | 3300031911 | Ga0307412_10000222 | Ga0307412_1000022231 | 254 |
| 73 | 3300032004 | Ga0307414_10000128 | Ga0307414_1000012821 | 254 |
| 74 | 3300042004 | Ga0439445_0000023 | Ga0439445_0000023_12930_13694 | 254 |
| 75 | 3300048905 | Ga0496102_0074008 | Ga0496102_0074008_1220_1984 | 254 |
| 76 | 3300048919 | Ga0496116_0000006 | Ga0496116_0000006_152125_152889 | 254 |
| 77 | 3300048920 | Ga0496117_0000027 | Ga0496117_0000027_202297_203061 | 254 |
| 78 | 3300048921 | Ga0496118_0000620 | Ga0496118_0000620_34771_35535 | 254 |
| 79 | 3300048922 | Ga0496119_0000006 | Ga0496119_0000006_387033_387797 | 254 |
| 80 | 3300048925 | Ga0496122_0000444 | Ga0496122_0000444_60731_61495 | 254 |
| 81 | 3300048926 | Ga0496123_0000958 | Ga0496123_0000958_25093_25857 | 254 |
| 82 | 3300048927 | Ga0496124_0000475 | Ga0496124_0000475_53379_54143 | 254 |
| 83 | 3300048928 | Ga0496125_0015116 | Ga0496125_0015116_4135_4899 | 254 |
| 84 | 3300048928 | Ga0496125_0017623 | Ga0496125_0017623_3902_4666 | 254 |
| 85 | 3300048929 | Ga0496126_0217890 | Ga0496126_0217890_569_1333 | 254 |
| 86 | 3300049766 | Ga0501269_000035 | Ga0501269_000035_11777_12541 | 254 |
| 87 | iso_pu_bacteria | 2643221591 | 2643964983 | 255 |
| 88 | iso_pu_bacteria | 2806310737 | 2807407231 | 255 |
| 89 | iso_pu_bacteria | 2806310745 | 2807455560 | 255 |
| 90 | 3300005367 | Ga0070667_100210057 | Ga0070667_1002100572 | 256 |
| 91 | 3300005459 | Ga0068867_100365947 | Ga0068867_1003659472 | 256 |
| 92 | 3300013105 | Ga0157369_10000477 | Ga0157369_1000047746 | 256 |
| 93 | 3300025986 | Ga0207658_10025730 | Ga0207658_100257303 | 256 |
| 94 | 3300026089 | Ga0207648_10302206 | Ga0207648_103022062 | 256 |
| 95 | iso_pu_bacteria | 2511231024 | 2511375636 | 256 |
| 96 | iso_pu_bacteria | 2599185302 | 2599941834 | 256 |
| 97 | iso_pu_bacteria | 2599185304 | 2599952646 | 256 |
| 98 | iso_pu_bacteria | 2600254931 | 2600364300 | 256 |
| 99 | iso_pu_bacteria | 2643221699 | 2644550416 | 256 |
| 100 | iso_pu_bacteria | 2675903515 | 2678262568 | 256 |
| 101 | iso_pu_bacteria | 2744054620 | 2745008910 | 256 |
| 102 | iso_pu_bacteria | 2765235841 | 2765585391 | 256 |
| 103 | iso_pu_bacteria | 2941531003 | 2941535251 | 256 |
| 104 | iso_pu_bacteria | 2998344455 | 2998348387 | 256 |
| 105 | iso_pu_bacteria | 3007803356 | 3007805160 | 256 |
| 106 | 3300005329 | Ga0070683_100010524 | Ga0070683_1000105246 | 257 |
| 107 | 3300005535 | Ga0070684_100092980 | Ga0070684_1000929802 | 257 |
| 108 | iso_pu_bacteria | 2738541294 | 2738809677 | 257 |
| 109 | iso_pu_bacteria | 2738541309 | 2738897037 | 257 |
| 110 | iso_pu_bacteria | 2902048731 | 2902049523 | 257 |
| 111 | 3300005459 | Ga0068867_100109494 | Ga0068867_1001094942 | 258 |
| 112 | 3300005539 | Ga0068853_100159078 | Ga0068853_1001590783 | 258 |
| 113 | 3300005545 | Ga0070695_100059959 | Ga0070695_1000599592 | 258 |
| 114 | 3300005546 | Ga0070696_100039166 | Ga0070696_1000391663 | 258 |
| 115 | 3300005549 | Ga0070704_100179863 | Ga0070704_1001798633 | 258 |
| 116 | 3300005578 | Ga0068854_100606631 | Ga0068854_1006066311 | 258 |
| 117 | 3300005617 | Ga0068859_100161681 | Ga0068859_1001616812 | 258 |
| 118 | 3300005617 | Ga0068859_100330710 | Ga0068859_1003307102 | 258 |
| 119 | 3300005985 | Ga0081539_10000001 | Ga0081539_10000001298 | 258 |
| 120 | 3300006051 | Ga0075364_10066095 | Ga0075364_100660952 | 258 |
| 121 | 3300006177 | Ga0075362_10001043 | Ga0075362_100010432 | 258 |
| 122 | 3300006178 | Ga0075367_10105360 | Ga0075367_101053602 | 258 |
| 123 | 3300006195 | Ga0075366_10027621 | Ga0075366_100276214 | 258 |
| 124 | 3300006195 | Ga0075366_10067940 | Ga0075366_100679401 | 258 |
| 125 | 3300006353 | Ga0075370_10003466 | Ga0075370_100034665 | 258 |
| 126 | 3300006353 | Ga0075370_10020129 | Ga0075370_100201292 | 258 |
| 127 | 3300006931 | Ga0097620_100161689 | Ga0097620_1001616892 | 258 |
| 128 | 3300006931 | Ga0097620_100330720 | Ga0097620_1003307202 | 258 |
| 129 | 3300009093 | Ga0105240_10196678 | Ga0105240_101966783 | 258 |
| 130 | 3300009094 | Ga0111539_10016755 | Ga0111539_100167552 | 258 |
| 131 | 3300009098 | Ga0105245_10009933 | Ga0105245_100099338 | 258 |
| 132 | 3300009101 | Ga0105247_10312799 | Ga0105247_103127992 | 258 |
| 133 | 3300009545 | Ga0105237_10058845 | Ga0105237_100588454 | 258 |
| 134 | 3300009551 | Ga0105238_10457443 | Ga0105238_104574432 | 258 |
| 135 | 3300010375 | Ga0105239_10037970 | Ga0105239_100379702 | 258 |
| 136 | 3300013104 | Ga0157370_10000637 | Ga0157370_1000063710 | 258 |
| 137 | 3300013306 | Ga0163162_10258953 | Ga0163162_102589532 | 258 |
| 138 | 3300014326 | Ga0157380_10029945 | Ga0157380_100299452 | 258 |
| 139 | 3300014326 | Ga0157380_10056191 | Ga0157380_100561912 | 258 |
| 140 | 3300017792 | Ga0163161_10005519 | Ga0163161_100055191 | 258 |
| 141 | 3300025913 | Ga0207695_10153428 | Ga0207695_101534282 | 258 |
| 142 | 3300025913 | Ga0207695_10272889 | Ga0207695_102728892 | 258 |
| 143 | 3300025914 | Ga0207671_10043638 | Ga0207671_100436383 | 258 |
| 144 | 3300025960 | Ga0207651_10123064 | Ga0207651_101230643 | 258 |
| 145 | 3300026089 | Ga0207648_10138860 | Ga0207648_101388602 | 258 |
| 146 | 3300026116 | Ga0207674_10402134 | Ga0207674_104021342 | 258 |
| 147 | 3300026142 | Ga0207698_10129042 | Ga0207698_101290422 | 258 |
| 148 | 3300028786 | Ga0307517_10217736 | Ga0307517_102177362 | 258 |
| 149 | 3300031548 | Ga0307408_100060023 | Ga0307408_1000600233 | 258 |
| 150 | 3300031731 | Ga0307405_10223139 | Ga0307405_102231392 | 258 |
| 151 | 3300032002 | Ga0307416_100428441 | Ga0307416_1004284412 | 258 |
| 152 | 3300032004 | Ga0307414_10000074 | Ga0307414_1000007442 | 258 |
| 153 | 3300047323 | Ga0495683_0006783 | Ga0495683_0006783_1429_2205 | 258 |
| 154 | 3300050489 | nmdc:mga03683_13112_c1 | nmdc:mga03683_13112_c1_1677_2453 | 258 |
| 155 | 3300050491 | nmdc:mga00v17_136613_c1 | nmdc:mga00v17_136613_c1_223_999 | 258 |
| 156 | 3300050493 | nmdc:mga0k408_30076_c1 | nmdc:mga0k408_30076_c1_1285_2061 | 258 |
| 157 | 3300050493 | nmdc:mga0k408_33290_c1 | nmdc:mga0k408_33290_c1_1730_2506 | 258 |
| 158 | 3300050493 | nmdc:mga0k408_52532_c1 | nmdc:mga0k408_52532_c1_757_1533 | 258 |
| 159 | 3300050496 | nmdc:mga07m45_17411_c1 | nmdc:mga07m45_17411_c1_1284_2060 | 258 |
| 160 | 3300050496 | nmdc:mga07m45_20887_c1 | nmdc:mga07m45_20887_c1_1438_2214 | 258 |
| 161 | 3300003781 | Ga0055536_1000387 | Ga0055536_100038711 | 259 |
| 162 | 3300003791 | Ga0055530_10000089 | Ga0055530_1000008958 | 259 |
| 163 | 3300003794 | Ga0055531_10022249 | Ga0055531_100222493 | 259 |
| 164 | 3300005329 | Ga0070683_100365340 | Ga0070683_1003653401 | 259 |
| 165 | 3300005365 | Ga0070688_100119318 | Ga0070688_1001193182 | 259 |
| 166 | 3300005366 | Ga0070659_100151017 | Ga0070659_1001510171 | 259 |
| 167 | 3300005518 | Ga0070699_100001003 | Ga0070699_10000100322 | 259 |
| 168 | 3300005577 | Ga0068857_100136203 | Ga0068857_1001362033 | 259 |
| 169 | 3300005617 | Ga0068859_100031392 | Ga0068859_1000313923 | 259 |
| 170 | 3300005617 | Ga0068859_100262040 | Ga0068859_1002620401 | 259 |
| 171 | 3300005843 | Ga0068860_100153587 | Ga0068860_1001535872 | 259 |
| 172 | 3300006051 | Ga0075364_10048036 | Ga0075364_100480362 | 259 |
| 173 | 3300006178 | Ga0075367_10004139 | Ga0075367_100041392 | 259 |
| 174 | 3300006353 | Ga0075370_10010444 | Ga0075370_100104444 | 259 |
| 175 | 3300006931 | Ga0097620_100031390 | Ga0097620_1000313904 | 259 |
| 176 | 3300006931 | Ga0097620_100262062 | Ga0097620_1002620623 | 259 |
| 177 | 3300013104 | Ga0157370_10467577 | Ga0157370_104675772 | 259 |
| 178 | 3300014969 | Ga0157376_10266765 | Ga0157376_102667652 | 259 |
| 179 | 3300025292 | Ga0209676_1000824 | Ga0209676_100082431 | 259 |
| 180 | 3300025298 | Ga0209050_1000042 | Ga0209050_100004269 | 259 |
| 181 | 3300025304 | Ga0209257_1000826 | Ga0209257_100082632 | 259 |
| 182 | 3300025942 | Ga0207689_10173674 | Ga0207689_101736742 | 259 |
| 183 | 3300025944 | Ga0207661_10010854 | Ga0207661_100108544 | 259 |
| 184 | 3300027614 | Ga0209970_1000527 | Ga0209970_10005272 | 259 |
| 185 | 3300028577 | Ga0265318_10000023 | Ga0265318_10000023122 | 259 |
| 186 | 3300029957 | Ga0265324_10032935 | Ga0265324_100329353 | 259 |
| 187 | 3300031548 | Ga0307408_100000330 | Ga0307408_10000033022 | 259 |
| 188 | 3300031595 | Ga0265313_10010309 | Ga0265313_100103097 | 259 |
| 189 | 3300031711 | Ga0265314_10000631 | Ga0265314_1000063112 | 259 |
| 190 | 3300031911 | Ga0307412_10129451 | Ga0307412_101294512 | 259 |
| 191 | 3300032004 | Ga0307414_10000209 | Ga0307414_1000020912 | 259 |
| 192 | 3300038725 | Ga0400484_01941 | Ga0400484_01941_15882_16667 | 259 |
| 193 | 3300041486 | Ga0451807_0646179 | Ga0451807_0646179_10_789 | 259 |
| 194 | 3300042439 | Ga0439464_0022735 | Ga0439464_0022735_403_1182 | 259 |
| 195 | 3300044673 | Ga0453683_0004283 | Ga0453683_0004283_7659_8438 | 259 |
| 196 | 3300044712 | Ga0453684_0549463 | Ga0453684_0549463_297_1076 | 259 |
| 197 | 3300045051 | Ga0451576_0111252 | Ga0451576_0111252_1953_2732 | 259 |
| 198 | 3300047317 | Ga0495604_0121629 | Ga0495604_0121629_174_953 | 259 |
| 199 | 3300048918 | Ga0496115_0025775 | Ga0496115_0025775_3208_3987 | 259 |
| 200 | 3300048928 | Ga0496125_0000031 | Ga0496125_0000031_101454_102233 | 259 |
| 201 | 3300048929 | Ga0496126_0009607 | Ga0496126_0009607_3850_4629 | 259 |
| 202 | 3300050491 | nmdc:mga00v17_15256_c1 | nmdc:mga00v17_15256_c1_618_1397 | 259 |
| 203 | 3300050493 | nmdc:mga0k408_27307_c1 | nmdc:mga0k408_27307_c1_595_1374 | 259 |
| 204 | 3300050494 | nmdc:mga06z11_19038_c1 | nmdc:mga06z11_19038_c1_683_1462 | 259 |
| 205 | 3300050496 | nmdc:mga07m45_8017_c1 | nmdc:mga07m45_8017_c1_1329_2108 | 259 |
| 206 | 3300050511 | nmdc:mga08y16_911436_c1 | nmdc:mga08y16_911436_c1_56_835 | 259 |
| 207 | 3300053096 | Ga0500641_0000062 | Ga0500641_0000062_17043_17822 | 259 |
| 208 | 3300003323 | rootH1_10307812 | rootH1_103078122 | 260 |
| 209 | 3300005289 | Ga0065704_10076392 | Ga0065704_100763922 | 260 |
| 210 | 3300005289 | Ga0065704_10154262 | Ga0065704_101542622 | 260 |
| 211 | 3300005356 | Ga0070674_100025207 | Ga0070674_1000252073 | 260 |
| 212 | 3300005983 | Ga0081540_1019319 | Ga0081540_10193193 | 260 |
| 213 | 3300006186 | Ga0075369_10035019 | Ga0075369_100350193 | 260 |
| 214 | 3300009092 | Ga0105250_10000586 | Ga0105250_100005869 | 260 |
| 215 | 3300009092 | Ga0105250_10189609 | Ga0105250_101896091 | 260 |
| 216 | 3300009094 | Ga0111539_10042908 | Ga0111539_100429082 | 260 |
| 217 | 3300009148 | Ga0105243_10000971 | Ga0105243_1000097119 | 260 |
| 218 | 3300009176 | Ga0105242_10157841 | Ga0105242_101578413 | 260 |
| 219 | 3300013102 | Ga0157371_10003057 | Ga0157371_100030574 | 260 |
| 220 | 3300013104 | Ga0157370_10277291 | Ga0157370_102772912 | 260 |
| 221 | 3300013306 | Ga0163162_10000585 | Ga0163162_1000058516 | 260 |
| 222 | 3300013308 | Ga0157375_10017740 | Ga0157375_100177402 | 260 |
| 223 | 3300025711 | Ga0207696_1000606 | Ga0207696_100060617 | 260 |
| 224 | 3300025728 | Ga0207655_1023970 | Ga0207655_10239701 | 260 |
| 225 | 3300025735 | Ga0207713_1001664 | Ga0207713_10016648 | 260 |
| 226 | 3300025735 | Ga0207713_1004791 | Ga0207713_10047912 | 260 |
| 227 | 3300025914 | Ga0207671_10070526 | Ga0207671_100705262 | 260 |
| 228 | 3300025935 | Ga0207709_10041441 | Ga0207709_100414412 | 260 |
| 229 | 3300031507 | Ga0307509_10011494 | Ga0307509_100114942 | 260 |
| 230 | 3300031548 | Ga0307408_100000779 | Ga0307408_10000077920 | 260 |
| 231 | 3300035114 | Ga0373939_0074920 | Ga0373939_0074920_22_804 | 260 |
| 232 | 3300035691 | Ga0373931_0119408 | Ga0373931_0119408_369_1151 | 260 |
| 233 | 3300038741 | Ga0400488_58007 | Ga0400488_58007_5674_6462 | 260 |
| 234 | 3300042876 | Ga0451577_0200562 | Ga0451577_0200562_55_837 | 260 |
| 235 | 3300044712 | Ga0453684_0453977 | Ga0453684_0453977_448_1230 | 260 |
| 236 | 3300045051 | Ga0451576_0000183 | Ga0451576_0000183_63974_64762 | 260 |
| 237 | 3300045051 | Ga0451576_0101119 | Ga0451576_0101119_1330_2112 | 260 |
| 238 | 3300046460 | Ga0495638_0000726 | Ga0495638_0000726_19767_20549 | 260 |
| 239 | 3300046506 | Ga0495583_0000460 | Ga0495583_0000460_42913_43695 | 260 |
| 240 | 3300046557 | Ga0495622_0027292 | Ga0495622_0027292_1046_1828 | 260 |
| 241 | 3300046660 | Ga0495625_0119832 | Ga0495625_0119832_863_1645 | 260 |
| 242 | 3300046663 | Ga0495635_0095125 | Ga0495635_0095125_725_1507 | 260 |
| 243 | 3300046665 | Ga0495661_0034122 | Ga0495661_0034122_1537_2319 | 260 |
| 244 | 3300046692 | Ga0495671_0000501 | Ga0495671_0000501_14210_14992 | 260 |
| 245 | 3300046810 | Ga0495660_0000971 | Ga0495660_0000971_9024_9806 | 260 |
| 246 | 3300047320 | Ga0495672_0000795 | Ga0495672_0000795_14138_14920 | 260 |
| 247 | 3300047469 | Ga0495673_0107215 | Ga0495673_0107215_267_1049 | 260 |
| 248 | 3300047472 | Ga0495686_0139150 | Ga0495686_0139150_343_1125 | 260 |
| 249 | 3300048908 | Ga0496105_0186220 | Ga0496105_0186220_467_1249 | 260 |
| 250 | 3300048922 | Ga0496119_0060202 | Ga0496119_0060202_124_906 | 260 |
| 251 | 3300048927 | Ga0496124_0009718 | Ga0496124_0009718_7999_8787 | 260 |
| 252 | 3300048927 | Ga0496124_0064775 | Ga0496124_0064775_2115_2897 | 260 |
| 253 | 3300053119 | Ga0500595_002193 | Ga0500595_002193_2696_3478 | 260 |
| 254 | 3300005327 | Ga0070658_10048436 | Ga0070658_100484362 | 261 |
| 255 | 3300005344 | Ga0070661_100002180 | Ga0070661_1000021802 | 261 |
| 256 | 3300005456 | Ga0070678_100676577 | Ga0070678_1006765771 | 261 |
| 257 | 3300005518 | Ga0070699_100184448 | Ga0070699_1001844482 | 261 |
| 258 | 3300005530 | Ga0070679_100001200 | Ga0070679_1000012007 | 261 |
| 259 | 3300005563 | Ga0068855_100056361 | Ga0068855_1000563614 | 261 |
| 260 | 3300006358 | Ga0068871_100183318 | Ga0068871_1001833182 | 261 |
| 261 | 3300006846 | Ga0075430_100003833 | Ga0075430_1000038332 | 261 |
| 262 | 3300006880 | Ga0075429_100000282 | Ga0075429_10000028224 | 261 |
| 263 | 3300009011 | Ga0105251_10000751 | Ga0105251_1000075113 | 261 |
| 264 | 3300009093 | Ga0105240_10284265 | Ga0105240_102842651 | 261 |
| 265 | 3300013102 | Ga0157371_10004211 | Ga0157371_1000421112 | 261 |
| 266 | 3300013102 | Ga0157371_10008952 | Ga0157371_100089523 | 261 |
| 267 | 3300013102 | Ga0157371_10010391 | Ga0157371_100103917 | 261 |
| 268 | 3300013307 | Ga0157372_10001711 | Ga0157372_1000171114 | 261 |
| 269 | 3300025735 | Ga0207713_1000769 | Ga0207713_100076918 | 261 |
| 270 | 3300025909 | Ga0207705_10027401 | Ga0207705_100274013 | 261 |
| 271 | 3300025917 | Ga0207660_10011200 | Ga0207660_100112004 | 261 |
| 272 | 3300025921 | Ga0207652_10002231 | Ga0207652_100022317 | 261 |
| 273 | 3300025949 | Ga0207667_10003744 | Ga0207667_100037444 | 261 |
| 274 | 3300028379 | Ga0268266_10033082 | Ga0268266_100330825 | 261 |
| 275 | 3300028794 | Ga0307515_10037927 | Ga0307515_100379273 | 261 |
| 276 | 3300030745 | Ga0316182_1155512 | Ga0316182_11555123 | 261 |
| 277 | 3300032004 | Ga0307414_10013030 | Ga0307414_100130304 | 261 |
| 278 | 3300042009 | Ga0439451_000029 | Ga0439451_000029_9712_10497 | 261 |
| 279 | 3300042016 | Ga0439463_002809 | Ga0439463_002809_1666_2451 | 261 |
| 280 | 3300042131 | Ga0450894_016674 | Ga0450894_016674_54_956 | 261 |
| 281 | 3300045051 | Ga0451576_0037322 | Ga0451576_0037322_1651_2439 | 261 |
| 282 | 3300046660 | Ga0495625_0193334 | Ga0495625_0193334_350_1135 | 261 |
| 283 | 3300046664 | Ga0495659_0027104 | Ga0495659_0027104_1022_1816 | 261 |
| 284 | 3300048925 | Ga0496122_0002040 | Ga0496122_0002040_12697_13482 | 261 |
| 285 | 3300048926 | Ga0496123_0001660 | Ga0496123_0001660_16408_17193 | 261 |
| 286 | 3300050493 | nmdc:mga0k408_150836_c1 | nmdc:mga0k408_150836_c1_252_1037 | 261 |
| 287 | 3300050508 | nmdc:mga09592_425_c1 | nmdc:mga09592_425_c1_17897_18688 | 261 |
| 288 | 3300050509 | nmdc:mga0qj67_3517_c1 | nmdc:mga0qj67_3517_c1_6112_6903 | 261 |
| 289 | 3300003759 | Ga0055525_1000246 | Ga0055525_100024635 | 262 |
| 290 | 3300005327 | Ga0070658_10553971 | Ga0070658_105539711 | 262 |
| 291 | 3300005336 | Ga0070680_100677611 | Ga0070680_1006776111 | 262 |
| 292 | 3300005435 | Ga0070714_100454658 | Ga0070714_1004546582 | 262 |
| 293 | 3300025230 | Ga0209563_100007 | Ga0209563_1000071392 | 262 |
| 294 | 3300025253 | Ga0209677_104292 | Ga0209677_1042925 | 262 |
| 295 | 3300025909 | Ga0207705_10410315 | Ga0207705_104103152 | 262 |
| 296 | 3300025929 | Ga0207664_10406164 | Ga0207664_104061642 | 262 |
| 297 | 3300031249 | Ga0265339_10113486 | Ga0265339_101134862 | 262 |
| 298 | 3300032002 | Ga0307416_100094962 | Ga0307416_1000949623 | 262 |
| 299 | 3300037312 | Ga0395899_0000963 | Ga0395899_0000963_23337_24125 | 262 |
| 300 | 3300037418 | Ga0395900_0011277 | Ga0395900_0011277_7700_8488 | 262 |
| 301 | 3300037466 | Ga0395898_0000886 | Ga0395898_0000886_20479_21273 | 262 |
| 302 | 3300037466 | Ga0395898_0005833 | Ga0395898_0005833_2461_3249 | 262 |
| 303 | 3300037471 | Ga0395905_0013269 | Ga0395905_0013269_3487_4275 | 262 |
| 304 | 3300038443 | Ga0395901_0021939 | Ga0395901_0021939_2598_3386 | 262 |
| 305 | 3300041408 | Ga0439453_0001655 | Ga0439453_0001655_54_857 | 262 |
| 306 | 3300042436 | Ga0439435_0027478 | Ga0439435_0027478_158_961 | 262 |
| 307 | 3300044656 | Ga0466969_0017852 | Ga0466969_0017852_2873_3667 | 262 |
| 308 | 3300044693 | Ga0466961_0002292 | Ga0466961_0002292_6854_7648 | 262 |
| 309 | 3300044706 | Ga0466964_0017133 | Ga0466964_0017133_794_1588 | 262 |
| 310 | 3300044719 | Ga0466971_0000466 | Ga0466971_0000466_7485_8279 | 262 |
| 311 | 3300044765 | Ga0466970_0015686 | Ga0466970_0015686_2441_3235 | 262 |
| 312 | 3300044842 | Ga0466957_0000307 | Ga0466957_0000307_16423_17217 | 262 |
| 313 | 3300045976 | Ga0466967_0455745 | Ga0466967_0455745_24_818 | 262 |
| 314 | 3300046453 | Ga0495627_000245 | Ga0495627_000245_19306_20094 | 262 |
| 315 | 3300046492 | Ga0495585_0002038 | Ga0495585_0002038_8830_9618 | 262 |
| 316 | 3300046492 | Ga0495585_0199329 | Ga0495585_0199329_220_1008 | 262 |
| 317 | 3300046524 | Ga0495648_0108691 | Ga0495648_0108691_32_820 | 262 |
| 318 | 3300046665 | Ga0495661_0064591 | Ga0495661_0064591_88_876 | 262 |
| 319 | 3300046684 | Ga0495669_0002671 | Ga0495669_0002671_2509_3297 | 262 |
| 320 | 3300046692 | Ga0495671_0000349 | Ga0495671_0000349_15512_16300 | 262 |
| 321 | 3300046692 | Ga0495671_0000405 | Ga0495671_0000405_20177_20965 | 262 |
| 322 | 3300046794 | Ga0495589_0010358 | Ga0495589_0010358_2770_3558 | 262 |
| 323 | 3300047445 | Ga0495677_0014934 | Ga0495677_0014934_1680_2468 | 262 |
| 324 | 3300048916 | Ga0496113_0057161 | Ga0496113_0057161_1794_2594 | 262 |
| 325 | 3300048925 | Ga0496122_0096477 | Ga0496122_0096477_228_1028 | 262 |
| 326 | 3300048926 | Ga0496123_0016233 | Ga0496123_0016233_4134_4934 | 262 |
| 327 | 3300049581 | Ga0501047_0349635 | Ga0501047_0349635_112_903 | 262 |
| 328 | 3300049823 | Ga0501044_0022540 | Ga0501044_0022540_2337_3143 | 262 |
| 329 | 3300061719 | Ga0466962_0001100 | Ga0466962_0001100_6978_7772 | 262 |
| 330 | 3300014326 | Ga0157380_10004132 | Ga0157380_100041322 | 263 |
| 331 | 3300032126 | Ga0307415_100021391 | Ga0307415_1000213912 | 263 |
| 332 | 3300005356 | Ga0070674_100477338 | Ga0070674_1004773381 | 264 |
| 333 | 3300006871 | Ga0075434_100066550 | Ga0075434_1000665501 | 264 |
| 334 | 3300046507 | Ga0495606_0001096 | Ga0495606_0001096_16779_17585 | 268 |
| 335 | 3300003203 | JGI25406J46586_10000014 | JGI25406J46586_1000001426 | 269 |
| 336 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008168 | 269 |
| 337 | 3300048915 | Ga0496112_0000008 | Ga0496112_0000008_249646_250455 | 269 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3tdn-assembly1.cif.gz_A | computationally designed two-fold symmetric tim-barrel protein, flr | 0.9553 | 122 | 229 |
| 3tdm-assembly2.cif.gz_C | computationally designed tim-barrel protein, halfflr | 0.9442 | 122 | 228 |
| 4evz-assembly2.cif.gz_B | structure of hisf-luca | 0.9235 | 1 | 230 |
| 4fx7-assembly4.cif.gz_D | structure of sym2 d9v+d55v+d130v+d176v | 0.9143 | 5 | 229 |
| 4evz-assembly1.cif.gz_A | structure of hisf-luca | 0.9039 | 1 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3tdnA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9553 | 122 | 229 | 3.40.50.12600 |
| af_P10371_1_245_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.9297 | 6 | 229 | 3.20.20.70 |
| af_Q2FUU2_4_232_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.901 | 8 | 229 | 3.20.20.70 |
| 4x2rA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.8907 | 3 | 229 | 3.20.20.70 |
| af_Q58927_1_237_3.20.20.70 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I | 0.882 | 5 | 254 | 3.20.20.70 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A383DGM3-F1-model_v4 | Uncharacterized protein | 0.9874 | 1 | 121 |
GO:0000105
GO:0000107 |
| AF-N1U730-F1-model_v4 | imidazole glycerol-phosphate synthase (EC 4.3.2.10) (IGP synthase cyclase subunit) | 0.987 | 1 | 185 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A379SSS1-F1-model_v4 | Imidazole glycerol phosphate synthase cyclasesubunit (EC 4.1.3.-) | 0.9852 | 1 | 106 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A109WUZ0-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) | 0.9848 | 75 | 216 |
GO:0000105
GO:0000107 GO:0016829 |
| AF-A0A4V1SLZ8-F1-model_v4 | Imidazole glycerol phosphate synthase subunit HisF (EC 4.1.3.-) | 0.9835 | 1 | 165 |
GO:0000105
GO:0000107 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar