F413195

General Info

Members Datasets Scaffolds Average Seq Length
337 215 674 278

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0002963|Ga0466959_0002963_3113_4105
Length 330
Sequence MLMGRVCAGIANRPAAWTIGHETAIPWHIASRPDPGDWTPRNPASPLEEIAMNASTSTTLVLGSSGKTGRRVAQRLHARGLPVRLGSRSGRPAFDWDDRATWAGALAGTSAAYVSYYPDLAMPGAPETIAAFAEQAVAAGTRRLVLLSGRGEAEAQRAERLLQASGADWTILRCSWFMQNFSEGQFLDGLRGGELALPAGDMPEPFVDADDIADVAAAALTDARHAGQLYELTGPRALSFADAVAEIARASGRPLRYAAVPMDAFAAGARAQGVPDEIVEFLGYLFGEVLDGRNRAPADGVQRALGRPPRDFAAYARGAAAAGTWSDAAG

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
141 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
142 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
177 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
178 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
179 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
180 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
183 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
186 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
187 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
188 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
189 2643221578 Streptomyces sp. Root63 Isolate Unclassified
190 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
191 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
192 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
193 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
194 2738543024 Aminobacter sp. AP02 Isolate Unclassified
195 2791355199
196 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
197 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
198 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
199 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
200 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
201 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
202 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
203 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
204 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
205 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
206 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
207 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
208 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
209 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
210 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
211 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
212 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
213 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
214 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
215 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.67
Metatranscriptomes 0
Isolates 8.33

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 2.37
Rhizoplane 7.12
Rhizosphere 76.56
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0002963 3300045049 Bacteria 10959
2 JGI25151J46595_10009888 3300003187 Bacteria 4480
3 rootL2_10097654 3300003322 Bacteria 3049
4 Ga0070676_10029665 3300005328 Bacteria 3113
5 Ga0070676_10313215 3300005328 Bacteria 1068
6 Ga0070670_100157327 3300005331 Bacteria 1969
7 Ga0068869_100038078 3300005334 Bacteria 3424
8 Ga0070666_10029965 3300005335 Bacteria 3582
9 Ga0068868_100016590 3300005338 Bacteria 5474
10 Ga0068868_100593069 3300005338 Bacteria 981
11 Ga0070660_100518145 3300005339 Bacteria 993
12 Ga0070689_100182911 3300005340 Bacteria 1703
13 Ga0070691_10207764 3300005341 Bacteria 1032
14 Ga0070661_100246703 3300005344 Bacteria 1377
15 Ga0070668_100064207 3300005347 Bacteria 2846
16 Ga0070675_100122183 3300005354 Bacteria 2213
17 Ga0070671_100000958 3300005355 Bacteria 21138
18 Ga0070674_100084202 3300005356 Bacteria 2280
19 Ga0070674_100309587 3300005356 Bacteria 1262
20 Ga0070688_100466912 3300005365 Bacteria 946
21 Ga0070659_100322064 3300005366 Bacteria 1292
22 Ga0070667_100001242 3300005367 Bacteria 23152
23 Ga0070709_10066302 3300005434 Bacteria 2315
24 Ga0070714_100085843 3300005435 Bacteria 2750
25 Ga0070714_100246174 3300005435 Bacteria 1652
26 Ga0070694_100369477 3300005444 Bacteria 1116
27 Ga0070678_100017722 3300005456 Bacteria 4594
28 Ga0070678_100098903 3300005456 Bacteria 2256
29 Ga0070678_100254868 3300005456 Bacteria 1473
30 Ga0068867_100021412 3300005459 Bacteria 4614
31 Ga0068867_100222819 3300005459 Bacteria 1521
32 Ga0070698_100267141 3300005471 Bacteria 1643
33 Ga0070699_100059845 3300005518 Bacteria 3299
34 Ga0068853_100009794 3300005539 Bacteria 7735
35 Ga0068853_100117436 3300005539 Bacteria 2369
36 Ga0070672_100063267 3300005543 Bacteria 2922
37 Ga0070686_100007793 3300005544 Bacteria 5985
38 Ga0070686_100078330 3300005544 Bacteria 2182
39 Ga0070686_100488856 3300005544 Bacteria 953
40 Ga0070695_100295484 3300005545 Bacteria 1196
41 Ga0070665_100059150 3300005548 Bacteria 3841
42 Ga0070665_100390406 3300005548 Bacteria 1399
43 Ga0068855_100083013 3300005563 Bacteria 3712
44 Ga0070664_100216144 3300005564 Bacteria 1714
45 Ga0070664_100411800 3300005564 Bacteria 1237
46 Ga0068857_100097086 3300005577 Bacteria 2641
47 Ga0068857_100297587 3300005577 Bacteria 1487
48 Ga0068856_100022537 3300005614 Bacteria 6123
49 Ga0070702_100047786 3300005615 Bacteria 2432
50 Ga0068859_100000896 3300005617 Bacteria 30335
51 Ga0068859_100039154 3300005617 Bacteria 4755
52 Ga0068864_100041682 3300005618 Bacteria 3926
53 Ga0068861_100033132 3300005719 Bacteria 3809
54 Ga0068861_100118529 3300005719 Bacteria 2132
55 Ga0068861_100175312 3300005719 Bacteria 1780
56 Ga0068870_10205092 3300005840 Bacteria 1198
57 Ga0068863_100001326 3300005841 Bacteria 24643
58 Ga0068863_100092105 3300005841 Bacteria 2875
59 Ga0068863_100658609 3300005841 Bacteria 1039
60 Ga0068863_100675731 3300005841 Bacteria 1025
61 Ga0068858_100000111 3300005842 Bacteria 86228
62 Ga0068860_100000296 3300005843 Bacteria 69084
63 Ga0068860_100113000 3300005843 Bacteria 2597
64 Ga0068860_100172283 3300005843 Bacteria 2091
65 Ga0068860_100336985 3300005843 Bacteria 1482
66 Ga0068860_100557004 3300005843 Bacteria 1149
67 Ga0068862_100057402 3300005844 Bacteria 3338
68 Ga0068862_100105340 3300005844 Bacteria 2472
69 Ga0068862_100285934 3300005844 Bacteria 1513
70 Ga0081455_10002600 3300005937 Bacteria 21413
71 Ga0081455_10005681 3300005937 Bacteria 13613
72 Ga0081455_10012544 3300005937 Bacteria 8455
73 Ga0081455_10048642 3300005937 Bacteria 3662
74 Ga0081538_10000065 3300005981 Bacteria 98948
75 Ga0081538_10000173 3300005981 Bacteria 69480
76 Ga0081538_10001042 3300005981 Bacteria 29561
77 Ga0081538_10002259 3300005981 Bacteria 19075
78 Ga0081538_10025650 3300005981 Bacteria 4148
79 Ga0081538_10027159 3300005981 Bacteria 3977
80 Ga0081540_1016755 3300005983 Bacteria 4569
81 Ga0081539_10005587 3300005985 Bacteria 12693
82 Ga0081539_10028836 3300005985 Bacteria 3484
83 Ga0075365_10002257 3300006038 Bacteria 9339
84 Ga0075365_10003395 3300006038 Bacteria 8189
85 Ga0075365_10012915 3300006038 Bacteria 4978
86 Ga0075365_10109241 3300006038 Bacteria 1900
87 Ga0075365_10275991 3300006038 Bacteria 1182
88 Ga0075363_100002562 3300006048 Bacteria 7472
89 Ga0075364_10000398 3300006051 Bacteria 21738
90 Ga0075364_10032821 3300006051 Bacteria 3338
91 Ga0075362_10005795 3300006177 Bacteria 4553
92 Ga0075367_10027388 3300006178 Bacteria 3242
93 Ga0075367_10150227 3300006178 Bacteria 1445
94 Ga0075369_10002925 3300006186 Bacteria 6166
95 Ga0075369_10020606 3300006186 Bacteria 2700
96 Ga0075366_10128422 3300006195 Bacteria 1529
97 Ga0068871_100099033 3300006358 Bacteria 2440
98 Ga0075428_100045649 3300006844 Bacteria 4814
99 Ga0075428_100046992 3300006844 Bacteria 4742
100 Ga0075428_100213728 3300006844 Bacteria 2084
101 Ga0075428_100563062 3300006844 Bacteria 1218
102 Ga0075428_100578619 3300006844 Bacteria 1200
103 Ga0075430_100006226 3300006846 Bacteria 10066
104 Ga0075430_100044932 3300006846 Bacteria 3734
105 Ga0075430_100121603 3300006846 Bacteria 2177
106 Ga0075431_100031179 3300006847 Bacteria 5491
107 Ga0075431_100034006 3300006847 Bacteria 5253
108 Ga0075431_100088579 3300006847 Bacteria 3195
109 Ga0075431_100817477 3300006847 Bacteria 904
110 Ga0075434_100133110 3300006871 Bacteria 2506
111 Ga0075429_100155849 3300006880 Bacteria 2000
112 Ga0097620_100000896 3300006931 Bacteria 30335
113 Ga0097620_100039156 3300006931 Bacteria 4755
114 Ga0075435_100348331 3300007076 Bacteria 1269
115 Ga0105250_10025906 3300009092 Bacteria 2363
116 Ga0105240_10084100 3300009093 Bacteria 3902
117 Ga0111539_10912249 3300009094 Bacteria 1022
118 Ga0105245_10036518 3300009098 Bacteria 4365
119 Ga0105245_10115973 3300009098 Bacteria 2497
120 Ga0105247_10001088 3300009101 Bacteria 20266
121 Ga0114129_10036402 3300009147 Bacteria 6950
122 Ga0105242_10661823 3300009176 Bacteria 1017
123 Ga0105248_10017849 3300009177 Bacteria 7831
124 Ga0105248_10021386 3300009177 Bacteria 7168
125 Ga0105248_10544332 3300009177 Bacteria 1309
126 Ga0105237_10074857 3300009545 Bacteria 3378
127 Ga0105237_10225255 3300009545 Bacteria 1875
128 Ga0105237_10494382 3300009545 Bacteria 1230
129 Ga0105238_10092565 3300009551 Bacteria 3011
130 Ga0105238_10305492 3300009551 Bacteria 1575
131 Ga0105249_10015929 3300009553 Bacteria 6663
132 Ga0105249_10378565 3300009553 Bacteria 1441
133 Ga0105249_10461001 3300009553 Bacteria 1311
134 Ga0105239_10046080 3300010375 Bacteria 4778
135 Ga0105239_10099429 3300010375 Bacteria 3216
136 Ga0105239_10105754 3300010375 Bacteria 3117
137 Ga0105246_10044280 3300011119 Bacteria 3024
138 Ga0105246_10075774 3300011119 Bacteria 2382
139 Ga0157371_10317161 3300013102 Bacteria 1131
140 Ga0157378_10104678 3300013297 Bacteria 2587
141 Ga0163162_10061356 3300013306 Bacteria 3797
142 Ga0163162_10153100 3300013306 Bacteria 2424
143 Ga0157372_10072676 3300013307 Unclassified 3876
144 Ga0157375_10069191 3300013308 Bacteria 3535
145 Ga0157375_10201189 3300013308 Bacteria 2148
146 Ga0163163_10027603 3300014325 Bacteria 5440
147 Ga0163163_10068802 3300014325 Bacteria 3524
148 Ga0157380_10102849 3300014326 Bacteria 2383
149 Ga0157377_10071181 3300014745 Bacteria 2010
150 Ga0157379_10016289 3300014968 Bacteria 6540
151 Ga0157379_10031892 3300014968 Bacteria 4696
152 Ga0157379_10116722 3300014968 Bacteria 2400
153 Ga0157376_10237943 3300014969 Bacteria 1695
154 Ga0209025_1000088 3300025294 Bacteria 255087
155 Ga0207710_10000159 3300025900 Bacteria 71625
156 Ga0207688_10008323 3300025901 Bacteria 5640
157 Ga0207688_10166453 3300025901 Bacteria 1309
158 Ga0207680_10035844 3300025903 Bacteria 2853
159 Ga0207699_10222782 3300025906 Bacteria 1288
160 Ga0207645_10076045 3300025907 Bacteria 2150
161 Ga0207695_10008820 3300025913 Bacteria 12557
162 Ga0207649_10211883 3300025920 Bacteria 1375
163 Ga0207681_10088728 3300025923 Bacteria 2203
164 Ga0207681_10271611 3300025923 Bacteria 1331
165 Ga0207694_10005781 3300025924 Bacteria 9472
166 Ga0207694_10246254 3300025924 Bacteria 1462
167 Ga0207659_10117900 3300025926 Bacteria 2029
168 Ga0207664_10021989 3300025929 Bacteria 4753
169 Ga0207644_10002989 3300025931 Bacteria 10873
170 Ga0207690_10047725 3300025932 Bacteria 2843
171 Ga0207706_10293836 3300025933 Bacteria 1416
172 Ga0207706_10390881 3300025933 Bacteria 1206
173 Ga0207686_10108362 3300025934 Bacteria 1869
174 Ga0207686_10379483 3300025934 Bacteria 1071
175 Ga0207670_10092771 3300025936 Bacteria 2138
176 Ga0207669_10154086 3300025937 Bacteria 1614
177 Ga0207669_10183716 3300025937 Bacteria 1502
178 Ga0207704_10033932 3300025938 Bacteria 2907
179 Ga0207704_10322831 3300025938 Bacteria 1192
180 Ga0207691_10066946 3300025940 Bacteria 3249
181 Ga0207691_10286551 3300025940 Bacteria 1417
182 Ga0207711_10099237 3300025941 Bacteria 2574
183 Ga0207689_10035667 3300025942 Bacteria 4131
184 Ga0207661_10213180 3300025944 Bacteria 1703
185 Ga0207679_10120728 3300025945 Bacteria 2086
186 Ga0207667_10005671 3300025949 Bacteria 15220
187 Ga0207651_10068114 3300025960 Bacteria 2508
188 Ga0207712_10021136 3300025961 Bacteria 4270
189 Ga0207712_10120916 3300025961 Unclassified 1981
190 Ga0207668_10015986 3300025972 Bacteria 4674
191 Ga0207668_10156909 3300025972 Bacteria 1769
192 Ga0207703_10010088 3300026035 Bacteria 7403
193 Ga0207703_10174597 3300026035 Bacteria 1893
194 Ga0207639_10018158 3300026041 Bacteria 4995
195 Ga0207678_10018217 3300026067 Bacteria 6167
196 Ga0207641_10007413 3300026088 Bacteria 9124
197 Ga0207641_10075118 3300026088 Bacteria 2918
198 Ga0207641_10530381 3300026088 Bacteria 1146
199 Ga0207648_10026877 3300026089 Bacteria 5110
200 Ga0207648_10165208 3300026089 Bacteria 1956
201 Ga0207648_10271587 3300026089 Bacteria 1515
202 Ga0207674_10060893 3300026116 Bacteria 3816
203 Ga0207675_100019500 3300026118 Bacteria 6329
204 Ga0207675_100020502 3300026118 Bacteria 6162
205 Ga0207675_100209719 3300026118 Bacteria 1873
206 Ga0207683_10023505 3300026121 Bacteria 5302
207 Ga0207683_10086370 3300026121 Bacteria 2789
208 Ga0207683_10225040 3300026121 Bacteria 1710
209 Ga0207698_10149617 3300026142 Bacteria 2024
210 Ga0207698_10177646 3300026142 Bacteria 1882
211 Ga0268266_10490049 3300028379 Bacteria 1172
212 Ga0268265_10010708 3300028380 Bacteria 6191
213 Ga0268265_10024629 3300028380 Bacteria 4260
214 Ga0268265_10396055 3300028380 Bacteria 1275
215 Ga0268265_10435155 3300028380 Bacteria 1221
216 Ga0268264_10000088 3300028381 Bacteria 235344
217 Ga0268264_10077753 3300028381 Bacteria 2827
218 Ga0307513_10032762 3300031456 Bacteria 5854
219 Ga0307513_10058872 3300031456 Bacteria 4080
220 Ga0307509_10000028 3300031507 Bacteria 223572
221 Ga0307405_10000766 3300031731 Bacteria 12559
222 Ga0307412_10075091 3300031911 Bacteria 2318
223 Ga0307409_100044844 3300031995 Bacteria 3333
224 Ga0307409_100178988 3300031995 Bacteria 1875
225 Ga0307416_100579895 3300032002 Bacteria 1199
226 Ga0307414_10246346 3300032004 Bacteria 1483
227 Ga0307411_10003330 3300032005 Bacteria 7435
228 Ga0307415_100316662 3300032126 Bacteria 1299
229 Ga0307510_10015408 3300033180 Bacteria 9039
230 Ga0373933_0340896 3300035724 Bacteria 973
231 Ga0395898_0128633 3300037466 Bacteria 2426
232 Ga0395898_0454312 3300037466 Bacteria 1220
233 Ga0395901_0166090 3300038443 Bacteria 2318
234 Ga0400490_37622 3300038726 Bacteria 23446
235 Ga0400491_17412 3300038727 Unclassified 3912
236 Ga0450916_007468 3300042530 Bacteria 1313
237 Ga0466972_0068550 3300044658 Bacteria 1695
238 Ga0466960_0187277 3300044901 Bacteria 1125
239 Ga0466960_0209533 3300044901 Bacteria 1068
240 Ga0495584_0108776 3300046491 Bacteria 1402
241 Ga0495632_0031795 3300046519 Unclassified 2725
242 Ga0495632_0071119 3300046519 Bacteria 1672
243 Ga0495666_0134369 3300046526 Bacteria 1155
244 Ga0495645_0028162 3300046543 Bacteria 4082
245 Ga0495668_0000002 3300046616 Bacteria 763179
246 Ga0495668_0059194 3300046616 Bacteria 2114
247 Ga0495625_0167185 3300046660 Bacteria 1470
248 Ga0495661_0096471 3300046665 Bacteria 1672
249 Ga0495588_0001286 3300046674 Bacteria 10740
250 Ga0495589_0167551 3300046794 Bacteria 1045
251 Ga0495636_0055140 3300047318 Bacteria 1671
252 Ga0496100_0274378 3300048903 Bacteria 1255
253 Ga0496101_0105756 3300048904 Bacteria 2112
254 Ga0496102_0078662 3300048905 Bacteria 3036
255 Ga0496102_0137645 3300048905 Bacteria 2288
256 Ga0496102_0251380 3300048905 Bacteria 1667
257 Ga0496102_0474177 3300048905 Bacteria 1173
258 Ga0496104_0041004 3300048907 Bacteria 4340
259 Ga0496104_0045546 3300048907 Bacteria 4126
260 Ga0496104_0108885 3300048907 Bacteria 2656
261 Ga0496105_0225311 3300048908 Bacteria 1525
262 Ga0496105_0386859 3300048908 Bacteria 1112
263 Ga0496107_0211152 3300048910 Bacteria 1443
264 Ga0496107_0222229 3300048910 Bacteria 1405
265 Ga0496108_0104699 3300048911 Bacteria 2415
266 Ga0496108_0159220 3300048911 Bacteria 1951
267 Ga0496109_0156857 3300048912 Bacteria 2132
268 Ga0496110_0311580 3300048913 Bacteria 1433
269 Ga0496110_0322681 3300048913 Bacteria 1407
270 Ga0496110_0606535 3300048913 Bacteria 993
271 Ga0496112_0014768 3300048915 Bacteria 7262
272 Ga0496112_0038527 3300048915 Bacteria 4668
273 Ga0496112_0153277 3300048915 Bacteria 2272
274 Ga0496112_0282145 3300048915 Bacteria 1608
275 Ga0496113_0149529 3300048916 Bacteria 1842
276 Ga0496117_0017367 3300048920 Bacteria 6009
277 Ga0496118_0007929 3300048921 Bacteria 11109
278 Ga0496118_0081647 3300048921 Bacteria 2269
279 Ga0496121_0001213 3300048924 Bacteria 44955
280 Ga0496121_0352809 3300048924 Bacteria 979
281 Ga0496124_0261930 3300048927 Bacteria 1272
282 Ga0496125_0092216 3300048928 Bacteria 2266
283 Ga0496125_0195902 3300048928 Bacteria 1329
284 Ga0501036_0175260 3300049572 Bacteria 1806
285 Ga0501039_0015920 3300049575 Bacteria 5758
286 Ga0501048_0300792 3300049582 Bacteria 1141
287 Ga0501072_0009270 3300049588 Bacteria 7479
288 Ga0501076_0036445 3300049592 Bacteria 3854
289 nmdc:mga03n38_16009_c1 3300050490 Bacteria 2909
290 nmdc:mga00v17_1652_c1 3300050491 Bacteria 11632
291 nmdc:mga00v17_233820_c1 3300050491 Bacteria 1191
292 nmdc:mga00v17_47010_c1 3300050491 Bacteria 2613
293 nmdc:mga0yw44_178529_c1 3300050492 Bacteria 1397
294 nmdc:mga0yw44_234535_c1 3300050492 Bacteria 1218
295 nmdc:mga05p37_152228_c1 3300050507 Bacteria 2828
296 nmdc:mga05p37_259253_c1 3300050507 Bacteria 2082
297 nmdc:mga09592_277848_c1 3300050508 Bacteria 1452
298 nmdc:mga09592_356616_c1 3300050508 Bacteria 1265
299 nmdc:mga0qj67_37481_c1 3300050509 Bacteria 3798
300 nmdc:mga0qj67_6464_c1 3300050509 Bacteria 8613
301 nmdc:mga06r32_164147_c1 3300050510 Bacteria 2204
302 nmdc:mga06r32_178234_c1 3300050510 Bacteria 2110
303 nmdc:mga06r32_41210_c1 3300050510 Bacteria 4386
304 nmdc:mga06r32_47549_c1 3300050510 Bacteria 4098
305 nmdc:mga08y16_367722_c1 3300050511 Bacteria 1475
306 nmdc:mga0n895_173702_c1 3300050512 Bacteria 2186
307 Ga0500616_0000064 3300053153 Bacteria 243072
308 Ga0501082_0487860 3300060353 Bacteria 1077
309 2513692255 2513237101 Bacteria 7952346
310 2515754682 2515154137 Bacteria 5711575
311 2643902734 2643221578 Bacteria 9213798
312 2644131283 2643221623 Bacteria 5239945
313 2644404757 2643221673 Bacteria 9196637
314 2676479622 2675903059 Bacteria 8644972
315 2723845370 2721755755 Bacteria 8322773
316 2739310207 2738543024 Bacteria 5603683
317 2793083425
318 2862297076 2862290372 Bacteria 7471434
319 2874608724 2874604998 Bacteria 7834745
320 2876815243 2876808645 Bacteria 8824342
321 2879111418 2879110137 Bacteria 8907982
322 2883823619 2883821847 Bacteria 5121194
323 2889040126 2889033259 Bacteria 9099371
324 2895433021 2895427314 Bacteria 13147766
325 2904544834 2904541872 Bacteria 8915136
326 2919121087 2919119836 Bacteria 5208557
327 2922390721 2922386360 Bacteria 7017218
328 2929163494 2929160207 Bacteria 9075316
329 2946048762 2946045630 Bacteria 8527308
330 3005422988 3005416602 Bacteria 7064308
331 8002290464 8002285264 Bacteria 6717907
332 8005315315 8005314921 Bacteria 7072929
333 8006973062 8006964411 Bacteria 8966052
334 8007000514 8006994254 Bacteria 8309700
335 8025478577 8025478263 Bacteria 8209203
336 8056448536 8056447290 Bacteria 7680491
337 8056671895 8056667051 Bacteria 6953971
338 Ga0466959_0002963
339 JGI25151J46595_10009888
340 rootL2_10097654
341 Ga0070676_10029665
342 Ga0070676_10313215
343 Ga0070670_100157327
344 Ga0068869_100038078
345 Ga0070666_10029965
346 Ga0068868_100016590
347 Ga0068868_100593069
348 Ga0070660_100518145
349 Ga0070689_100182911
350 Ga0070691_10207764
351 Ga0070661_100246703
352 Ga0070668_100064207
353 Ga0070675_100122183
354 Ga0070671_100000958
355 Ga0070674_100084202
356 Ga0070674_100309587
357 Ga0070688_100466912
358 Ga0070659_100322064
359 Ga0070667_100001242
360 Ga0070709_10066302
361 Ga0070714_100085843
362 Ga0070714_100246174
363 Ga0070694_100369477
364 Ga0070678_100017722
365 Ga0070678_100098903
366 Ga0070678_100254868
367 Ga0068867_100021412
368 Ga0068867_100222819
369 Ga0070698_100267141
370 Ga0070699_100059845
371 Ga0068853_100009794
372 Ga0068853_100117436
373 Ga0070672_100063267
374 Ga0070686_100007793
375 Ga0070686_100078330
376 Ga0070686_100488856
377 Ga0070695_100295484
378 Ga0070665_100059150
379 Ga0070665_100390406
380 Ga0068855_100083013
381 Ga0070664_100216144
382 Ga0070664_100411800
383 Ga0068857_100097086
384 Ga0068857_100297587
385 Ga0068856_100022537
386 Ga0070702_100047786
387 Ga0068859_100000896
388 Ga0068859_100039154
389 Ga0068864_100041682
390 Ga0068861_100033132
391 Ga0068861_100118529
392 Ga0068861_100175312
393 Ga0068870_10205092
394 Ga0068863_100001326
395 Ga0068863_100092105
396 Ga0068863_100658609
397 Ga0068863_100675731
398 Ga0068858_100000111
399 Ga0068860_100000296
400 Ga0068860_100113000
401 Ga0068860_100172283
402 Ga0068860_100336985
403 Ga0068860_100557004
404 Ga0068862_100057402
405 Ga0068862_100105340
406 Ga0068862_100285934
407 Ga0081455_10002600
408 Ga0081455_10005681
409 Ga0081455_10012544
410 Ga0081455_10048642
411 Ga0081538_10000065
412 Ga0081538_10000173
413 Ga0081538_10001042
414 Ga0081538_10002259
415 Ga0081538_10025650
416 Ga0081538_10027159
417 Ga0081540_1016755
418 Ga0081539_10005587
419 Ga0081539_10028836
420 Ga0075365_10002257
421 Ga0075365_10003395
422 Ga0075365_10012915
423 Ga0075365_10109241
424 Ga0075365_10275991
425 Ga0075363_100002562
426 Ga0075364_10000398
427 Ga0075364_10032821
428 Ga0075362_10005795
429 Ga0075367_10027388
430 Ga0075367_10150227
431 Ga0075369_10002925
432 Ga0075369_10020606
433 Ga0075366_10128422
434 Ga0068871_100099033
435 Ga0075428_100045649
436 Ga0075428_100046992
437 Ga0075428_100213728
438 Ga0075428_100563062
439 Ga0075428_100578619
440 Ga0075430_100006226
441 Ga0075430_100044932
442 Ga0075430_100121603
443 Ga0075431_100031179
444 Ga0075431_100034006
445 Ga0075431_100088579
446 Ga0075431_100817477
447 Ga0075434_100133110
448 Ga0075429_100155849
449 Ga0097620_100000896
450 Ga0097620_100039156
451 Ga0075435_100348331
452 Ga0105250_10025906
453 Ga0105240_10084100
454 Ga0111539_10912249
455 Ga0105245_10036518
456 Ga0105245_10115973
457 Ga0105247_10001088
458 Ga0114129_10036402
459 Ga0105242_10661823
460 Ga0105248_10017849
461 Ga0105248_10021386
462 Ga0105248_10544332
463 Ga0105237_10074857
464 Ga0105237_10225255
465 Ga0105237_10494382
466 Ga0105238_10092565
467 Ga0105238_10305492
468 Ga0105249_10015929
469 Ga0105249_10378565
470 Ga0105249_10461001
471 Ga0105239_10046080
472 Ga0105239_10099429
473 Ga0105239_10105754
474 Ga0105246_10044280
475 Ga0105246_10075774
476 Ga0157371_10317161
477 Ga0157378_10104678
478 Ga0163162_10061356
479 Ga0163162_10153100
480 Ga0157372_10072676
481 Ga0157375_10069191
482 Ga0157375_10201189
483 Ga0163163_10027603
484 Ga0163163_10068802
485 Ga0157380_10102849
486 Ga0157377_10071181
487 Ga0157379_10016289
488 Ga0157379_10031892
489 Ga0157379_10116722
490 Ga0157376_10237943
491 Ga0209025_1000088
492 Ga0207710_10000159
493 Ga0207688_10008323
494 Ga0207688_10166453
495 Ga0207680_10035844
496 Ga0207699_10222782
497 Ga0207645_10076045
498 Ga0207695_10008820
499 Ga0207649_10211883
500 Ga0207681_10088728
501 Ga0207681_10271611
502 Ga0207694_10005781
503 Ga0207694_10246254
504 Ga0207659_10117900
505 Ga0207664_10021989
506 Ga0207644_10002989
507 Ga0207690_10047725
508 Ga0207706_10293836
509 Ga0207706_10390881
510 Ga0207686_10108362
511 Ga0207686_10379483
512 Ga0207670_10092771
513 Ga0207669_10154086
514 Ga0207669_10183716
515 Ga0207704_10033932
516 Ga0207704_10322831
517 Ga0207691_10066946
518 Ga0207691_10286551
519 Ga0207711_10099237
520 Ga0207689_10035667
521 Ga0207661_10213180
522 Ga0207679_10120728
523 Ga0207667_10005671
524 Ga0207651_10068114
525 Ga0207712_10021136
526 Ga0207712_10120916
527 Ga0207668_10015986
528 Ga0207668_10156909
529 Ga0207703_10010088
530 Ga0207703_10174597
531 Ga0207639_10018158
532 Ga0207678_10018217
533 Ga0207641_10007413
534 Ga0207641_10075118
535 Ga0207641_10530381
536 Ga0207648_10026877
537 Ga0207648_10165208
538 Ga0207648_10271587
539 Ga0207674_10060893
540 Ga0207675_100019500
541 Ga0207675_100020502
542 Ga0207675_100209719
543 Ga0207683_10023505
544 Ga0207683_10086370
545 Ga0207683_10225040
546 Ga0207698_10149617
547 Ga0207698_10177646
548 Ga0268266_10490049
549 Ga0268265_10010708
550 Ga0268265_10024629
551 Ga0268265_10396055
552 Ga0268265_10435155
553 Ga0268264_10000088
554 Ga0268264_10077753
555 Ga0307513_10032762
556 Ga0307513_10058872
557 Ga0307509_10000028
558 Ga0307405_10000766
559 Ga0307412_10075091
560 Ga0307409_100044844
561 Ga0307409_100178988
562 Ga0307416_100579895
563 Ga0307414_10246346
564 Ga0307411_10003330
565 Ga0307415_100316662
566 Ga0307510_10015408
567 Ga0373933_0340896
568 Ga0395898_0128633
569 Ga0395898_0454312
570 Ga0395901_0166090
571 Ga0400490_37622
572 Ga0400491_17412
573 Ga0450916_007468
574 Ga0466972_0068550
575 Ga0466960_0187277
576 Ga0466960_0209533
577 Ga0495584_0108776
578 Ga0495632_0031795
579 Ga0495632_0071119
580 Ga0495666_0134369
581 Ga0495645_0028162
582 Ga0495668_0000002
583 Ga0495668_0059194
584 Ga0495625_0167185
585 Ga0495661_0096471
586 Ga0495588_0001286
587 Ga0495589_0167551
588 Ga0495636_0055140
589 Ga0496100_0274378
590 Ga0496101_0105756
591 Ga0496102_0078662
592 Ga0496102_0137645
593 Ga0496102_0251380
594 Ga0496102_0474177
595 Ga0496104_0041004
596 Ga0496104_0045546
597 Ga0496104_0108885
598 Ga0496105_0225311
599 Ga0496105_0386859
600 Ga0496107_0211152
601 Ga0496107_0222229
602 Ga0496108_0104699
603 Ga0496108_0159220
604 Ga0496109_0156857
605 Ga0496110_0311580
606 Ga0496110_0322681
607 Ga0496110_0606535
608 Ga0496112_0014768
609 Ga0496112_0038527
610 Ga0496112_0153277
611 Ga0496112_0282145
612 Ga0496113_0149529
613 Ga0496117_0017367
614 Ga0496118_0007929
615 Ga0496118_0081647
616 Ga0496121_0001213
617 Ga0496121_0352809
618 Ga0496124_0261930
619 Ga0496125_0092216
620 Ga0496125_0195902
621 Ga0501036_0175260
622 Ga0501039_0015920
623 Ga0501048_0300792
624 Ga0501072_0009270
625 Ga0501076_0036445
626 nmdc:mga03n38_16009_c1
627 nmdc:mga00v17_1652_c1
628 nmdc:mga00v17_233820_c1
629 nmdc:mga00v17_47010_c1
630 nmdc:mga0yw44_178529_c1
631 nmdc:mga0yw44_234535_c1
632 nmdc:mga05p37_152228_c1
633 nmdc:mga05p37_259253_c1
634 nmdc:mga09592_277848_c1
635 nmdc:mga09592_356616_c1
636 nmdc:mga0qj67_37481_c1
637 nmdc:mga0qj67_6464_c1
638 nmdc:mga06r32_164147_c1
639 nmdc:mga06r32_178234_c1
640 nmdc:mga06r32_41210_c1
641 nmdc:mga06r32_47549_c1
642 nmdc:mga08y16_367722_c1
643 nmdc:mga0n895_173702_c1
644 Ga0500616_0000064
645 Ga0501082_0487860
646 2513692255
647 2515754682
648 2643902734
649 2644131283
650 2644404757
651 2676479622
652 2723845370
653 2739310207
654 2793083425
655 2862297076
656 2874608724
657 2876815243
658 2879111418
659 2883823619
660 2889040126
661 2895433021
662 2904544834
663 2919121087
664 2922390721
665 2929163494
666 2946048762
667 3005422988
668 8002290464
669 8005315315
670 8006973062
671 8007000514
672 8025478577
673 8056448536
674 8056671895

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13460

NAD_binding_10

NAD(P)H-binding

63

223

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7r41-assembly1.cif.gz_P bovine complex i in the presence of im1761092, active class i (composite map) 0.808 13 283
6yj4-assembly1.cif.gz_P structure of yarrowia lipolytica complex i at 2.7 a 0.8019 15 283
3e48-assembly1.cif.gz_A crystal structure of a nucleoside-diphosphate-sugar epimerase (sav0421) from staphylococcus aureus, northeast structural genomics consortium target zr319 0.798 16 277
5l4l-assembly1.cif.gz_A polyketide ketoreductase simc7 - ternary complex with nadp+ and 7-oxo-sd8 0.7902 17 287
2vrc-assembly1.cif.gz_D crystal structure of the citrobacter sp. triphenylmethane reductase complexed with nadp(h) 0.7867 16 280
ID Description Score Start End Superfamily
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8737 17 280 3.40.50.720
af_F4JRN8_123_262_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8622 17 70 3.40.50.720
af_Q54LW0_12_289_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8298 17 280 3.40.50.720
af_Q55F90_2_211_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8247 17 194 3.40.50.720
af_A0A2R8RUA9_55_239_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8247 16 133 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A352H7G5-F1-model_v4 deleted 0.9828 15 112
AF-A0A7Y7LG42-F1-model_v4 deleted 0.9812 8 289
AF-A0A1I9ZHF8-F1-model_v4 deleted 0.9766 13 290
AF-A0A0Q6WER0-F1-model_v4 NmrA family transcriptional regulator 0.9755 15 286
AF-A0A8A3NT30-F1-model_v4 deleted 0.9748 17 288

Map