F413276

General Info

Members Datasets Scaffolds Average Seq Length
337 202 674 292

Family's Representative Sequence

Representative Sequence 3300050509|nmdc:mga0qj67_40271_c1|nmdc:mga0qj67_40271_c1_539_1525
Length 328
Sequence MFERPPGNTMQVGPTTIIDTFAEAFRMRYARLVVTADDEYWLEAALHSLSGYGTSVIGCDAEVGVAERLAPADTPDGRPGAAVLLFGFSTDALARAVPHRVGQCVMTCPTTACYNGLPLNGSSGAEETIPLGKHLRFFGDGHQKSKKLGERRYWRIPVMDGEFLIEDTAGVGKGIAGGNIILQAVSQRVALAAARRASEAVAATPGVIAPFPGGVVRSGSKVGSKYKGLVASTNDAFCPTRRGGVETRLVDGANSSYEIVIDGTGEAAVARAMRAAIEAASGDGVLAIGAGNYGGKLGKFHFHLHEVMGGRASGGSGGSAPAETAAKQ

Samples

Sample ID Description Type Environment
1 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
20 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
21 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
22 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
23 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
24 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
25 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
26 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
33 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
46 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
66 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
72 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
73 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
74 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
76 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
81 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
83 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
90 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
91 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
92 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
93 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
94 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
102 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
106 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
107 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
108 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
109 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
127 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
128 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
129 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
145 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
146 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
147 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
148 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
149 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
150 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
151 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
160 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
161 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
162 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
163 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
164 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
165 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
170 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
171 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
172 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
173 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
174 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
175 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
176 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
177 2687453257 Planctomyces sp. SH-PL62 Isolate Unclassified
178 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
179 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
180 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
181 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
182 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
183 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
184 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
185 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
186 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
187 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
188 2889415604 Paludisphaera rhizosphaerae JC665 Isolate Rhizosphere
189 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
190 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
191 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
192 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
193 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
194 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
195 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
196 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
197 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
198 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
199 8002060224 Methylocystis sp. Sn-Cys Isolate Unclassified
200 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
201 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
202 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.91
Metatranscriptomes 1.19
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 5.64
Rhizoplane 2.08
Rhizosphere 87.83
Stem 0
Stem Tuber 0
Unclassified 3.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0qj67_40271_c1 3300050509 Bacteria 3672
2 JGI25405J52794_10001584 3300003911 Bacteria 3776
3 Ga0065707_10150224 3300005295 Bacteria 1667
4 Ga0070658_10040996 3300005327 Bacteria 3735
5 Ga0070670_100086906 3300005331 Bacteria 2687
6 Ga0070660_100115383 3300005339 Bacteria 2140
7 Ga0070714_100182117 3300005435 Bacteria 1912
8 Ga0070711_100080799 3300005439 Bacteria 2315
9 Ga0070662_100131967 3300005457 Bacteria 1927
10 Ga0070681_10108210 3300005458 Bacteria 2720
11 Ga0070707_100028704 3300005468 Bacteria 5295
12 Ga0070679_100089012 3300005530 Bacteria 3074
13 Ga0070686_100192640 3300005544 Bacteria 1456
14 Ga0070665_100001187 3300005548 Bacteria 31815
15 Ga0068855_100036934 3300005563 Bacteria 5812
16 Ga0068855_100051229 3300005563 Bacteria 4863
17 Ga0070664_100177229 3300005564 Bacteria 1893
18 Ga0068856_100073318 3300005614 Bacteria 3390
19 Ga0081455_10007222 3300005937 Bacteria 11736
20 Ga0081455_10183583 3300005937 Bacteria 1581
21 Ga0081538_10006540 3300005981 Bacteria 10238
22 Ga0081540_1000081 3300005983 Bacteria 102423
23 Ga0081540_1010448 3300005983 Bacteria 6286
24 Ga0075432_10019013 3300006058 Bacteria 2345
25 Ga0070716_100161631 3300006173 Bacteria 1452
26 Ga0070712_100117140 3300006175 Bacteria 1999
27 Ga0075369_10062432 3300006186 Bacteria 1628
28 Ga0075427_10000504 3300006194 Bacteria 4481
29 Ga0075428_100016318 3300006844 Bacteria 8209
30 Ga0075428_100017339 3300006844 Bacteria 7959
31 Ga0075428_100030243 3300006844 Bacteria 5990
32 Ga0075428_100193342 3300006844 Bacteria 2200
33 Ga0075428_100237968 3300006844 Bacteria 1965
34 Ga0075430_100000743 3300006846 Bacteria 25027
35 Ga0075431_100001726 3300006847 Bacteria 20564
36 Ga0075431_100512218 3300006847 Bacteria 1190
37 Ga0075433_10003133 3300006852 Bacteria 12743
38 Ga0075434_100000055 3300006871 Bacteria 55965
39 Ga0075434_100001511 3300006871 Bacteria 19654
40 Ga0075429_100000478 3300006880 Bacteria 29852
41 Ga0075435_100022866 3300007076 Bacteria 4826
42 Ga0099794_10125924 3300007265 Unclassified 1291
43 Ga0105240_10069500 3300009093 Bacteria 4358
44 Ga0111539_10000074 3300009094 Bacteria 99231
45 Ga0111539_10076793 3300009094 Bacteria 3933
46 Ga0105247_10272411 3300009101 Bacteria 1165
47 Ga0114129_10002842 3300009147 Bacteria 24194
48 Ga0114129_10018894 3300009147 Bacteria 9819
49 Ga0114129_10019627 3300009147 Bacteria 9621
50 Ga0105243_10457688 3300009148 Bacteria 1199
51 Ga0105238_10000141 3300009551 Bacteria 79659
52 Ga0105249_10083375 3300009553 Bacteria 2975
53 Ga0157374_10040510 3300013296 Bacteria 4290
54 Ga0157380_10113503 3300014326 Bacteria 2282
55 Ga0206356_10848928 3300020070 Bacteria 2883
56 Ga0206354_10637545 3300020081 Bacteria 2447
57 Ga0206353_11711845 3300020082 Bacteria 2347
58 Ga0213875_10000045 3300021388 Bacteria 150013
59 Ga0207684_10201470 3300025910 Bacteria 1717
60 Ga0207695_10094989 3300025913 Bacteria 2987
61 Ga0207663_10096477 3300025916 Bacteria 1975
62 Ga0207660_10071319 3300025917 Bacteria 2527
63 Ga0207657_10035080 3300025919 Bacteria 4503
64 Ga0207652_10110321 3300025921 Bacteria 2439
65 Ga0207646_10027574 3300025922 Bacteria 5179
66 Ga0207709_10357832 3300025935 Bacteria 1104
67 Ga0207667_10403198 3300025949 Bacteria 1392
68 Ga0207712_10029061 3300025961 Bacteria 3705
69 Ga0207708_10136857 3300026075 Bacteria 1919
70 Ga0207674_10323871 3300026116 Bacteria 1491
71 Ga0207428_10000094 3300027907 Bacteria 123649
72 Ga0207428_10098723 3300027907 Bacteria 2259
73 Ga0268266_10081255 3300028379 Bacteria 2825
74 Ga0265338_10157212 3300028800 Bacteria 1760
75 Ga0265760_10001388 3300031090 Bacteria 7105
76 Ga0265328_10000024 3300031239 Bacteria 123047
77 Ga0265328_10000025 3300031239 Bacteria 118295
78 Ga0265328_10000271 3300031239 Bacteria 23972
79 Ga0265328_10002076 3300031239 Bacteria 9044
80 Ga0265328_10002525 3300031239 Bacteria 8204
81 Ga0265325_10005370 3300031241 Bacteria 7922
82 Ga0265331_10000005 3300031250 Bacteria 465192
83 Ga0265331_10002340 3300031250 Bacteria 12874
84 Ga0265331_10006120 3300031250 Bacteria 7161
85 Ga0265327_10007113 3300031251 Bacteria 8737
86 Ga0265327_10009583 3300031251 Bacteria 6960
87 Ga0265327_10017011 3300031251 Bacteria 4585
88 Ga0265327_10058562 3300031251 Bacteria 1977
89 Ga0265316_10000169 3300031344 Bacteria 73902
90 Ga0307408_100373112 3300031548 Bacteria 1217
91 Ga0265342_10111423 3300031712 Bacteria 1549
92 Ga0307406_10020786 3300031901 Bacteria 3873
93 Ga0307416_100013210 3300032002 Bacteria 5605
94 Ga0307411_10136499 3300032005 Bacteria 1802
95 Ga0373944_0044299 3300035089 Bacteria 1385
96 Ga0373936_0090480 3300035113 Bacteria 1283
97 Ga0373945_0011392 3300035116 Bacteria 2941
98 Ga0373945_0041342 3300035116 Bacteria 1666
99 Ga0373956_0051284 3300035119 Bacteria 1854
100 Ga0373943_0068300 3300035170 Bacteria 1794
101 Ga0373946_0001998 3300035171 Bacteria 7140
102 Ga0373955_0048190 3300035172 Bacteria 2310
103 Ga0373931_0027342 3300035691 Bacteria 2912
104 Ga0373935_0000990 3300035692 Bacteria 15452
105 Ga0373935_0034921 3300035692 Bacteria 3136
106 Ga0373927_0004359 3300035695 Bacteria 9920
107 Ga0373927_0073952 3300035695 Bacteria 2207
108 Ga0373927_0117194 3300035695 Bacteria 1737
109 Ga0373933_0425370 3300035724 Bacteria 868
110 Ga0373947_0001284 3300035725 Bacteria 15473
111 Ga0373947_0050966 3300035725 Bacteria 2489
112 Ga0373925_0037734 3300037068 Bacteria 3568
113 Ga0436364_0341284 3300037853 Bacteria 1166
114 Ga0436364_1057555 3300037853 Bacteria 51632
115 Ga0436360_0247413 3300039438 Bacteria 1330
116 Ga0436363_0154016 3300039450 Bacteria 1519
117 Ga0436363_1601312 3300039450 Bacteria 1315
118 Ga0436362_0445353 3300039453 Bacteria 929
119 Ga0439436_0049250 3300041404 Bacteria 1194
120 Ga0439439_0073773 3300041406 Bacteria 916
121 Ga0439453_0004303 3300041408 Bacteria 2111
122 Ga0439449_0018893 3300042007 Bacteria 2584
123 Ga0466963_0537045 3300044694 Bacteria 826
124 Ga0451576_0106342 3300045051 Bacteria 2920
125 Ga0451576_0146300 3300045051 Bacteria 2464
126 Ga0466967_0015842 3300045976 Bacteria 5925
127 Ga0495592_0010790 3300046454 Bacteria 6890
128 Ga0495603_0000416 3300046455 Bacteria 23560
129 Ga0495629_0002468 3300046459 Bacteria 14194
130 Ga0495629_0047222 3300046459 Bacteria 3020
131 Ga0495638_0166455 3300046460 Bacteria 1268
132 Ga0495641_0021011 3300046461 Unclassified 3294
133 Ga0495582_0005148 3300046473 Bacteria 7321
134 Ga0495582_0146041 3300046473 Bacteria 1342
135 Ga0495662_0025493 3300046476 Bacteria 2855
136 Ga0495662_0045828 3300046476 Bacteria 2111
137 Ga0495662_0119377 3300046476 Bacteria 1294
138 Ga0495664_0003207 3300046477 Bacteria 8874
139 Ga0495594_0010502 3300046499 Bacteria 4802
140 Ga0495606_0105781 3300046507 Bacteria 1705
141 Ga0495618_0001026 3300046514 Bacteria 19150
142 Ga0495630_0076379 3300046517 Bacteria 2524
143 Ga0495630_0120106 3300046517 Bacteria 1994
144 Ga0495652_0003570 3300046529 Bacteria 15274
145 Ga0495652_0083914 3300046529 Bacteria 2621
146 Ga0495640_0001631 3300046533 Bacteria 17720
147 Ga0495640_0007523 3300046533 Bacteria 8559
148 Ga0495667_0197315 3300046559 Bacteria 1289
149 Ga0495634_0009738 3300046642 Bacteria 7069
150 Ga0495634_0105650 3300046642 Bacteria 1815
151 Ga0495635_0011621 3300046663 Bacteria 6171
152 Ga0495635_0137915 3300046663 Bacteria 1662
153 Ga0495599_0098925 3300046678 Bacteria 1818
154 Ga0495647_0000264 3300046681 Bacteria 14505
155 Ga0495647_0112965 3300046681 Bacteria 1135
156 Ga0495658_0015679 3300046683 Bacteria 3890
157 Ga0495600_0015886 3300046809 Bacteria 4769
158 Ga0495581_0005166 3300047315 Bacteria 7552
159 Ga0495604_0129343 3300047317 Bacteria 1817
160 Ga0495674_0007079 3300047319 Bacteria 10731
161 Ga0495674_0046677 3300047319 Unclassified 3844
162 Ga0495676_0010139 3300047321 Bacteria 8555
163 Ga0495684_0021315 3300047471 Bacteria 4990
164 Ga0495684_0177297 3300047471 Bacteria 1582
165 Ga0496100_0243789 3300048903 Bacteria 1327
166 Ga0496104_0248393 3300048907 Bacteria 1692
167 Ga0496106_0424264 3300048909 Bacteria 1069
168 Ga0496108_0257632 3300048911 Unclassified 1518
169 Ga0496114_0102506 3300048917 Bacteria 2445
170 Ga0496115_0029474 3300048918 Bacteria 4310
171 Ga0496115_0203073 3300048918 Bacteria 1637
172 Ga0501031_0129972 3300049568 Bacteria 1645
173 Ga0501032_0176176 3300049569 Unclassified 1401
174 Ga0501033_0011086 3300049570 Bacteria 6904
175 Ga0501033_0015908 3300049570 Bacteria 5698
176 Ga0501033_0196100 3300049570 Bacteria 1444
177 Ga0501034_0008448 3300049571 Bacteria 10875
178 Ga0501034_0012913 3300049571 Bacteria 8613
179 Ga0501034_0138304 3300049571 Bacteria 2416
180 Ga0501034_0172085 3300049571 Bacteria 2132
181 Ga0501034_0231672 3300049571 Bacteria 1796
182 Ga0501036_0000584 3300049572 Bacteria 26372
183 Ga0501036_0004791 3300049572 Bacteria 10937
184 Ga0501036_0241361 3300049572 Bacteria 1515
185 Ga0501036_0271976 3300049572 Bacteria 1418
186 Ga0501037_0032756 3300049573 Bacteria 3839
187 Ga0501038_0002389 3300049574 Bacteria 17490
188 Ga0501038_0003463 3300049574 Bacteria 14720
189 Ga0501038_0138337 3300049574 Bacteria 1994
190 Ga0501038_0244150 3300049574 Bacteria 1425
191 Ga0501039_0001168 3300049575 Bacteria 19305
192 Ga0501039_0034359 3300049575 Bacteria 3913
193 Ga0501039_0070424 3300049575 Bacteria 2717
194 Ga0501039_0097542 3300049575 Bacteria 2292
195 Ga0501039_0233506 3300049575 Bacteria 1446
196 Ga0501040_0000068 3300049576 Bacteria 50114
197 Ga0501040_0026156 3300049576 Bacteria 3925
198 Ga0501040_0044013 3300049576 Bacteria 3043
199 Ga0501040_0403709 3300049576 Bacteria 981
200 Ga0501041_0000108 3300049577 Bacteria 34606
201 Ga0501041_0051719 3300049577 Bacteria 2504
202 Ga0501041_0225656 3300049577 Bacteria 1176
203 Ga0501042_0000244 3300049578 Bacteria 26283
204 Ga0501042_0030792 3300049578 Bacteria 3793
205 Ga0501042_0124404 3300049578 Bacteria 1857
206 Ga0501042_0129369 3300049578 Bacteria 1819
207 Ga0501043_0004073 3300049579 Bacteria 11946
208 Ga0501043_0004993 3300049579 Bacteria 10735
209 Ga0501043_0067515 3300049579 Bacteria 2808
210 Ga0501046_0000539 3300049580 Bacteria 37574
211 Ga0501046_0003560 3300049580 Bacteria 14272
212 Ga0501046_0019985 3300049580 Bacteria 5545
213 Ga0501046_0116128 3300049580 Unclassified 2040
214 Ga0501046_0217651 3300049580 Bacteria 1415
215 Ga0501047_0013276 3300049581 Bacteria 7803
216 Ga0501047_0101516 3300049581 Unclassified 2756
217 Ga0501048_0020753 3300049582 Bacteria 4814
218 Ga0501048_0021306 3300049582 Bacteria 4746
219 Ga0501048_0137798 3300049582 Bacteria 1725
220 Ga0501048_0167018 3300049582 Bacteria 1558
221 Ga0501048_0227131 3300049582 Bacteria 1324
222 Ga0501068_0010724 3300049584 Bacteria 5152
223 Ga0501070_0000246 3300049586 Bacteria 51049
224 Ga0501071_0001699 3300049587 Bacteria 12922
225 Ga0501071_0007815 3300049587 Bacteria 7052
226 Ga0501072_0000069 3300049588 Bacteria 74196
227 Ga0501072_0007853 3300049588 Bacteria 8106
228 Ga0501072_0013664 3300049588 Bacteria 6218
229 Ga0501072_0027011 3300049588 Bacteria 4479
230 Ga0501072_0269365 3300049588 Bacteria 1355
231 Ga0501074_0008064 3300049590 Bacteria 7629
232 Ga0501075_0000008 3300049591 Bacteria 99121
233 Ga0501075_0000299 3300049591 Bacteria 27590
234 Ga0501075_0008390 3300049591 Bacteria 7207
235 Ga0501075_0277932 3300049591 Bacteria 1276
236 Ga0501075_0291169 3300049591 Unclassified 1244
237 Ga0501076_0000004 3300049592 Bacteria 149972
238 Ga0501076_0000059 3300049592 Bacteria 54243
239 Ga0501076_0014052 3300049592 Bacteria 6018
240 Ga0501076_0032349 3300049592 Bacteria 4082
241 Ga0501076_0161979 3300049592 Bacteria 1823
242 Ga0501077_0000177 3300049593 Bacteria 36642
243 Ga0501077_0207714 3300049593 Bacteria 1244
244 Ga0501077_0235674 3300049593 Bacteria 1163
245 Ga0501077_0242611 3300049593 Bacteria 1145
246 Ga0501077_0340209 3300049593 Bacteria 957
247 Ga0501079_0000540 3300049741 Bacteria 24613
248 Ga0501079_0044666 3300049741 Bacteria 3419
249 Ga0501079_0091679 3300049741 Bacteria 2355
250 Ga0501080_0000819 3300049742 Bacteria 25385
251 Ga0501080_0122123 3300049742 Bacteria 2413
252 Ga0501080_0228319 3300049742 Bacteria 1702
253 Ga0501081_0000140 3300049743 Bacteria 32412
254 Ga0501081_0000572 3300049743 Bacteria 20956
255 Ga0501081_0024156 3300049743 Bacteria 4080
256 Ga0501081_0114545 3300049743 Bacteria 1916
257 Ga0501035_0003582 3300049822 Bacteria 14837
258 Ga0501035_0144092 3300049822 Bacteria 2070
259 Ga0501044_0030525 3300049823 Bacteria 5680
260 Ga0501044_0047227 3300049823 Bacteria 4454
261 Ga0501044_0126076 3300049823 Bacteria 2558
262 Ga0501044_0126926 3300049823 Bacteria 2548
263 Ga0501044_0378523 3300049823 Bacteria 1331
264 Ga0501045_0000004 3300049824 Bacteria 86792
265 Ga0501045_0015183 3300049824 Bacteria 5466
266 Ga0501045_0158106 3300049824 Bacteria 1686
267 nmdc:mga05p37_1203_c2 3300050507 Bacteria 20381
268 nmdc:mga05p37_1320_c1 3300050507 Bacteria 28850
269 nmdc:mga05p37_202_c1 3300050507 Bacteria 59597
270 nmdc:mga09592_2085_c1 3300050508 Bacteria 16128
271 nmdc:mga0qj67_766_c1 3300050509 Bacteria 21844
272 nmdc:mga06r32_1323_c1 3300050510 Bacteria 22334
273 nmdc:mga06r32_338053_c1 3300050510 Bacteria 1490
274 nmdc:mga06r32_407505_c1 3300050510 Bacteria 1341
275 nmdc:mga06r32_496186_c1 3300050510 Bacteria 1198
276 nmdc:mga08y16_168020_c1 3300050511 Bacteria 2279
277 nmdc:mga08y16_9892_c1 3300050511 Bacteria 10010
278 nmdc:mga0n895_1464_c1 3300050512 Bacteria 17689
279 nmdc:mga0n895_233105_c1 3300050512 Bacteria 1868
280 nmdc:mga0n895_958_c1 3300050512 Bacteria 20899
281 nmdc:mga0rr50_25071_c1 3300050513 Unclassified 4142
282 nmdc:mga0rr50_36626_c1 3300050513 Bacteria 3535
283 nmdc:mga0a205_3063_c1 3300050515 Bacteria 14833
284 nmdc:mga0a205_9615_c1 3300050515 Bacteria 8851
285 Ga0495601_0001298 3300053077 Bacteria 13725
286 Ga0495601_0002214 3300053077 Bacteria 10944
287 Ga0495601_0199754 3300053077 Unclassified 1307
288 Ga0495612_0004473 3300053078 Bacteria 5801
289 Ga0495612_0131727 3300053078 Bacteria 1080
290 Ga0500610_0084008 3300053079 Bacteria 1658
291 Ga0495595_0010443 3300053084 Bacteria 3858
292 Ga0495619_0001638 3300053085 Bacteria 14768
293 Ga0501084_0001678 3300054114 Bacteria 17589
294 Ga0501084_0006189 3300054114 Bacteria 9841
295 Ga0501084_0038957 3300054114 Bacteria 3975
296 Ga0501084_0394501 3300054114 Bacteria 1169
297 Ga0501082_0000464 3300060353 Bacteria 35789
298 Ga0501082_0005913 3300060353 Bacteria 10610
299 Ga0501082_0065424 3300060353 Bacteria 3131
300 Ga0501082_0185264 3300060353 Bacteria 1811
301 Ga0501082_0237005 3300060353 Unclassified 1588
302 Ga0501082_0253739 3300060353 Bacteria 1530
303 Ga0530510_0000005 3300061734 Bacteria 198759
304 Ga0530510_0000749 3300061734 Bacteria 21052
305 Ga0530510_0013088 3300061734 Bacteria 5834
306 Ga0530510_0026228 3300061734 Bacteria 4169
307 Ga0530510_0279323 3300061734 Bacteria 1247
308 2513927159 2513237146 Bacteria 7166346
309 2523105940 2522572158 Bacteria 6514390
310 2597812580 2597489875 Bacteria 7010078
311 2599415402 2599185170 Bacteria 7295545
312 2688066678 2687453257 Bacteria 6784659
313 2838038876 2838035591 Bacteria 7166484
314 2838664534 2838661181 Bacteria 7385261
315 2839997583 2839993093 Bacteria 5512535
316 2841738573 2841734538 Bacteria 6784580
317 2856347033 2856342000 Bacteria 7176905
318 2871475416 2871474448 Bacteria 6806570
319 2874124844 2874123672 Bacteria 7238285
320 2878790088 2878788777 Bacteria 6567085
321 2885318553 2885312484 Bacteria 6415165
322 2888346529 2888343758 Bacteria 6611049
323 2889415885 2889415604 Bacteria 8048700
324 2891090614 2891088606 Bacteria 4762464
325 2920113744 2920107658 Bacteria 10042636
326 2924758824 2924754689 Bacteria 6774424
327 2933018150 2933016740 Bacteria 6355406
328 2937841854 2937836603 Bacteria 6811263
329 2958077805 2958071322 Bacteria 6815895
330 2970528081 2970524798 Bacteria 6840927
331 2970546966 2970540015 Bacteria 6977556
332 2996314335 2996310559 Bacteria 6357320
333 3003935609 3003930520 Bacteria 5667563
334 8002063818 8002060224 Bacteria 4026565
335 8004403030 8004395343 Bacteria 6620908
336 8004638397 8004633249 Bacteria 6723080
337 8055620202 8055617313 Bacteria 7548464
338 nmdc:mga0qj67_40271_c1
339 JGI25405J52794_10001584
340 Ga0065707_10150224
341 Ga0070658_10040996
342 Ga0070670_100086906
343 Ga0070660_100115383
344 Ga0070714_100182117
345 Ga0070711_100080799
346 Ga0070662_100131967
347 Ga0070681_10108210
348 Ga0070707_100028704
349 Ga0070679_100089012
350 Ga0070686_100192640
351 Ga0070665_100001187
352 Ga0068855_100036934
353 Ga0068855_100051229
354 Ga0070664_100177229
355 Ga0068856_100073318
356 Ga0081455_10007222
357 Ga0081455_10183583
358 Ga0081538_10006540
359 Ga0081540_1000081
360 Ga0081540_1010448
361 Ga0075432_10019013
362 Ga0070716_100161631
363 Ga0070712_100117140
364 Ga0075369_10062432
365 Ga0075427_10000504
366 Ga0075428_100016318
367 Ga0075428_100017339
368 Ga0075428_100030243
369 Ga0075428_100193342
370 Ga0075428_100237968
371 Ga0075430_100000743
372 Ga0075431_100001726
373 Ga0075431_100512218
374 Ga0075433_10003133
375 Ga0075434_100000055
376 Ga0075434_100001511
377 Ga0075429_100000478
378 Ga0075435_100022866
379 Ga0099794_10125924
380 Ga0105240_10069500
381 Ga0111539_10000074
382 Ga0111539_10076793
383 Ga0105247_10272411
384 Ga0114129_10002842
385 Ga0114129_10018894
386 Ga0114129_10019627
387 Ga0105243_10457688
388 Ga0105238_10000141
389 Ga0105249_10083375
390 Ga0157374_10040510
391 Ga0157380_10113503
392 Ga0206356_10848928
393 Ga0206354_10637545
394 Ga0206353_11711845
395 Ga0213875_10000045
396 Ga0207684_10201470
397 Ga0207695_10094989
398 Ga0207663_10096477
399 Ga0207660_10071319
400 Ga0207657_10035080
401 Ga0207652_10110321
402 Ga0207646_10027574
403 Ga0207709_10357832
404 Ga0207667_10403198
405 Ga0207712_10029061
406 Ga0207708_10136857
407 Ga0207674_10323871
408 Ga0207428_10000094
409 Ga0207428_10098723
410 Ga0268266_10081255
411 Ga0265338_10157212
412 Ga0265760_10001388
413 Ga0265328_10000024
414 Ga0265328_10000025
415 Ga0265328_10000271
416 Ga0265328_10002076
417 Ga0265328_10002525
418 Ga0265325_10005370
419 Ga0265331_10000005
420 Ga0265331_10002340
421 Ga0265331_10006120
422 Ga0265327_10007113
423 Ga0265327_10009583
424 Ga0265327_10017011
425 Ga0265327_10058562
426 Ga0265316_10000169
427 Ga0307408_100373112
428 Ga0265342_10111423
429 Ga0307406_10020786
430 Ga0307416_100013210
431 Ga0307411_10136499
432 Ga0373944_0044299
433 Ga0373936_0090480
434 Ga0373945_0011392
435 Ga0373945_0041342
436 Ga0373956_0051284
437 Ga0373943_0068300
438 Ga0373946_0001998
439 Ga0373955_0048190
440 Ga0373931_0027342
441 Ga0373935_0000990
442 Ga0373935_0034921
443 Ga0373927_0004359
444 Ga0373927_0073952
445 Ga0373927_0117194
446 Ga0373933_0425370
447 Ga0373947_0001284
448 Ga0373947_0050966
449 Ga0373925_0037734
450 Ga0436364_0341284
451 Ga0436364_1057555
452 Ga0436360_0247413
453 Ga0436363_0154016
454 Ga0436363_1601312
455 Ga0436362_0445353
456 Ga0439436_0049250
457 Ga0439439_0073773
458 Ga0439453_0004303
459 Ga0439449_0018893
460 Ga0466963_0537045
461 Ga0451576_0106342
462 Ga0451576_0146300
463 Ga0466967_0015842
464 Ga0495592_0010790
465 Ga0495603_0000416
466 Ga0495629_0002468
467 Ga0495629_0047222
468 Ga0495638_0166455
469 Ga0495641_0021011
470 Ga0495582_0005148
471 Ga0495582_0146041
472 Ga0495662_0025493
473 Ga0495662_0045828
474 Ga0495662_0119377
475 Ga0495664_0003207
476 Ga0495594_0010502
477 Ga0495606_0105781
478 Ga0495618_0001026
479 Ga0495630_0076379
480 Ga0495630_0120106
481 Ga0495652_0003570
482 Ga0495652_0083914
483 Ga0495640_0001631
484 Ga0495640_0007523
485 Ga0495667_0197315
486 Ga0495634_0009738
487 Ga0495634_0105650
488 Ga0495635_0011621
489 Ga0495635_0137915
490 Ga0495599_0098925
491 Ga0495647_0000264
492 Ga0495647_0112965
493 Ga0495658_0015679
494 Ga0495600_0015886
495 Ga0495581_0005166
496 Ga0495604_0129343
497 Ga0495674_0007079
498 Ga0495674_0046677
499 Ga0495676_0010139
500 Ga0495684_0021315
501 Ga0495684_0177297
502 Ga0496100_0243789
503 Ga0496104_0248393
504 Ga0496106_0424264
505 Ga0496108_0257632
506 Ga0496114_0102506
507 Ga0496115_0029474
508 Ga0496115_0203073
509 Ga0501031_0129972
510 Ga0501032_0176176
511 Ga0501033_0011086
512 Ga0501033_0015908
513 Ga0501033_0196100
514 Ga0501034_0008448
515 Ga0501034_0012913
516 Ga0501034_0138304
517 Ga0501034_0172085
518 Ga0501034_0231672
519 Ga0501036_0000584
520 Ga0501036_0004791
521 Ga0501036_0241361
522 Ga0501036_0271976
523 Ga0501037_0032756
524 Ga0501038_0002389
525 Ga0501038_0003463
526 Ga0501038_0138337
527 Ga0501038_0244150
528 Ga0501039_0001168
529 Ga0501039_0034359
530 Ga0501039_0070424
531 Ga0501039_0097542
532 Ga0501039_0233506
533 Ga0501040_0000068
534 Ga0501040_0026156
535 Ga0501040_0044013
536 Ga0501040_0403709
537 Ga0501041_0000108
538 Ga0501041_0051719
539 Ga0501041_0225656
540 Ga0501042_0000244
541 Ga0501042_0030792
542 Ga0501042_0124404
543 Ga0501042_0129369
544 Ga0501043_0004073
545 Ga0501043_0004993
546 Ga0501043_0067515
547 Ga0501046_0000539
548 Ga0501046_0003560
549 Ga0501046_0019985
550 Ga0501046_0116128
551 Ga0501046_0217651
552 Ga0501047_0013276
553 Ga0501047_0101516
554 Ga0501048_0020753
555 Ga0501048_0021306
556 Ga0501048_0137798
557 Ga0501048_0167018
558 Ga0501048_0227131
559 Ga0501068_0010724
560 Ga0501070_0000246
561 Ga0501071_0001699
562 Ga0501071_0007815
563 Ga0501072_0000069
564 Ga0501072_0007853
565 Ga0501072_0013664
566 Ga0501072_0027011
567 Ga0501072_0269365
568 Ga0501074_0008064
569 Ga0501075_0000008
570 Ga0501075_0000299
571 Ga0501075_0008390
572 Ga0501075_0277932
573 Ga0501075_0291169
574 Ga0501076_0000004
575 Ga0501076_0000059
576 Ga0501076_0014052
577 Ga0501076_0032349
578 Ga0501076_0161979
579 Ga0501077_0000177
580 Ga0501077_0207714
581 Ga0501077_0235674
582 Ga0501077_0242611
583 Ga0501077_0340209
584 Ga0501079_0000540
585 Ga0501079_0044666
586 Ga0501079_0091679
587 Ga0501080_0000819
588 Ga0501080_0122123
589 Ga0501080_0228319
590 Ga0501081_0000140
591 Ga0501081_0000572
592 Ga0501081_0024156
593 Ga0501081_0114545
594 Ga0501035_0003582
595 Ga0501035_0144092
596 Ga0501044_0030525
597 Ga0501044_0047227
598 Ga0501044_0126076
599 Ga0501044_0126926
600 Ga0501044_0378523
601 Ga0501045_0000004
602 Ga0501045_0015183
603 Ga0501045_0158106
604 nmdc:mga05p37_1203_c2
605 nmdc:mga05p37_1320_c1
606 nmdc:mga05p37_202_c1
607 nmdc:mga09592_2085_c1
608 nmdc:mga0qj67_766_c1
609 nmdc:mga06r32_1323_c1
610 nmdc:mga06r32_338053_c1
611 nmdc:mga06r32_407505_c1
612 nmdc:mga06r32_496186_c1
613 nmdc:mga08y16_168020_c1
614 nmdc:mga08y16_9892_c1
615 nmdc:mga0n895_1464_c1
616 nmdc:mga0n895_233105_c1
617 nmdc:mga0n895_958_c1
618 nmdc:mga0rr50_25071_c1
619 nmdc:mga0rr50_36626_c1
620 nmdc:mga0a205_3063_c1
621 nmdc:mga0a205_9615_c1
622 Ga0495601_0001298
623 Ga0495601_0002214
624 Ga0495601_0199754
625 Ga0495612_0004473
626 Ga0495612_0131727
627 Ga0500610_0084008
628 Ga0495595_0010443
629 Ga0495619_0001638
630 Ga0501084_0001678
631 Ga0501084_0006189
632 Ga0501084_0038957
633 Ga0501084_0394501
634 Ga0501082_0000464
635 Ga0501082_0005913
636 Ga0501082_0065424
637 Ga0501082_0185264
638 Ga0501082_0237005
639 Ga0501082_0253739
640 Ga0530510_0000005
641 Ga0530510_0000749
642 Ga0530510_0013088
643 Ga0530510_0026228
644 Ga0530510_0279323
645 2513927159
646 2523105940
647 2597812580
648 2599415402
649 2688066678
650 2838038876
651 2838664534
652 2839997583
653 2841738573
654 2856347033
655 2871475416
656 2874124844
657 2878790088
658 2885318553
659 2888346529
660 2889415885
661 2891090614
662 2920113744
663 2924758824
664 2933018150
665 2937841854
666 2958077805
667 2970528081
668 2970546966
669 2996314335
670 3003935609
671 8002063818
672 8004403030
673 8004638397
674 8055620202

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02741

FTR_C

FTR, proximal lobe

161

307

0.99

PF01913

FTR

Formylmethanofuran-tetrahydromethanopterin formyltransferase

10

158

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s6y-assembly2.cif.gz_P x-ray crystal structure of the formyltransferase/hydrolase complex (fhcabcd) from methylorubrum extorquens in complex with methylofuran 0.9549 1 299
6s6y-assembly2.cif.gz_P x-ray crystal structure of the formyltransferase/hydrolase complex (fhcabcd) from methylorubrum extorquens in complex with methylofuran 0.9517 1 299
1m5h-assembly2.cif.gz_E formylmethanofuran:tetrahydromethanopterin formyltransferase from archaeoglobus fulgidus 0.9222 1 298
1m5h-assembly2.cif.gz_E formylmethanofuran:tetrahydromethanopterin formyltransferase from archaeoglobus fulgidus 0.9193 1 298
1ftr-assembly1.cif.gz_D formylmethanofuran:tetrahydromethanopterin formyltransferase from methanopyrus kandleri 0.9178 1 298
ID Description Score Start End Superfamily
af_Q57766_18_158_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9537 20 155 3.30.70.520
af_Q57766_18_158_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9146 20 155 3.30.70.520
af_Q57766_160_295_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8588 159 293 3.30.70.520
af_Q57766_160_295_3.30.70.520 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8468 159 293 3.30.70.520
af_Q7KRR5_243_283_3.10.620.30 Alpha Beta;Roll;C8orf32 fold; 0.7975 129 151 3.10.620.30
ID Description Score Start End GO Terms
AF-A0A842ZHB9-F1-model_v4 deleted 0.982 9 91
AF-A0A497MCU1-F1-model_v4 Formylmethanofuran: tetrahydromethanopterin formyltransferase Ftr N-terminal domain-containing protein 0.9815 9 88 GO:0006730
GO:0016740
AF-A0A2U0S695-F1-model_v4 Formylmethanofuran: tetrahydromethanopterin formyltransferase Ftr N-terminal domain-containing protein 0.9804 9 102 GO:0006730
GO:0016740
AF-A0A3S2F1J1-F1-model_v4 deleted 0.9797 1 121
AF-A0A348N1P5-F1-model_v4 Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101) 0.977 1 202 GO:0006730
GO:0030270

Map