F413279

General Info

Members Datasets Scaffolds Average Seq Length
337 178 666 269

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_94541_c1|nmdc:mga06r32_94541_c1_71_976
Length 301
Sequence LNVGGLLFYKEVAYQLHWLGPCSETIIKNTKENIFMRNKMLFAVFSVLVILAVAVSPVGAITDGTPDGNGHPYVGLMVAQTAAGAPLWRCSGTLLSPTLFLTAGHCTEAPAAHVEIWFDADVQSGIPANGYPLNGDVGGTPHTHPQYNPNAFFLFDLGVVVLDEPVVMDEYGSLPELNQLDALKPNRHTTFTAVGYGLQQSFPDAASWKDVALRVRMVAHPKLNQINTGFTGDFSLLLSNNTNTGGTCFGDSGGPNFVGDSNVVGGVTSYGLNGSCAGTGGVYRVDRADDLNWLATFGVTP

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
129 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
140 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
141 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
151 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
152 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
158 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
168 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 2643221711 Terrabacter sp. Root85 Isolate Unclassified
177 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
178 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.03
Metatranscriptomes 2.08
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.08
Rhizosphere 97.03
Stem 0
Stem Tuber 0
Unclassified 12.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_94541_c1 3300050510 Unclassified 2924
2 MBSR1b_contig_9553136 2162886012 Bacteria 1010
3 JGI24738J21930_10017077 3300002075 Bacteria 1527
4 JGI25406J46586_10009980 3300003203 Bacteria 4235
5 Ga0006562J51391_1132900 3300003578 Bacteria 1622
6 Ga0065707_10089189 3300005295 Bacteria 4442
7 Ga0065707_10228287 3300005295 Bacteria 1198
8 Ga0070683_100151790 3300005329 Bacteria 2196
9 Ga0070683_100373252 3300005329 Bacteria 1359
10 Ga0070690_100156709 3300005330 Bacteria 1557
11 Ga0070690_100220651 3300005330 Bacteria 1328
12 Ga0070670_100005923 3300005331 Bacteria 10336
13 Ga0070677_10068163 3300005333 Bacteria 1488
14 Ga0070677_10084574 3300005333 Bacteria 1366
15 Ga0068869_100000028 3300005334 Bacteria 61654
16 Ga0068869_100090510 3300005334 Bacteria 2300
17 Ga0068869_100194873 3300005334 Bacteria 1595
18 Ga0068869_100239973 3300005334 Bacteria 1444
19 Ga0068869_100610080 3300005334 Bacteria 923
20 Ga0070680_100430092 3300005336 Bacteria 1126
21 Ga0070682_100191419 3300005337 Bacteria 1436
22 Ga0070660_100201914 3300005339 Bacteria 1613
23 Ga0070689_100078408 3300005340 Unclassified 2590
24 Ga0070689_100304033 3300005340 Unclassified 1328
25 Ga0070689_100438522 3300005340 Bacteria 1109
26 Ga0070689_100521612 3300005340 Unclassified 1020
27 Ga0070687_100109946 3300005343 Bacteria 1558
28 Ga0070661_100391327 3300005344 Bacteria 1097
29 Ga0070692_10017278 3300005345 Bacteria 3445
30 Ga0070692_10032679 3300005345 Bacteria 2617
31 Ga0070692_10083159 3300005345 Bacteria 1728
32 Ga0070668_100011258 3300005347 Bacteria 6662
33 Ga0070669_100031209 3300005353 Bacteria 3849
34 Ga0070669_100083418 3300005353 Bacteria 2383
35 Ga0070669_100402401 3300005353 Unclassified 1120
36 Ga0070669_100577114 3300005353 Bacteria 940
37 Ga0070671_100262810 3300005355 Bacteria 1467
38 Ga0070673_100079103 3300005364 Bacteria 2661
39 Ga0070688_100271960 3300005365 Bacteria 1214
40 Ga0070659_100451430 3300005366 Bacteria 1090
41 Ga0070667_100001790 3300005367 Bacteria 19123
42 Ga0070703_10013762 3300005406 Bacteria 2300
43 Ga0070703_10018916 3300005406 Unclassified 1995
44 Ga0070701_10236766 3300005438 Bacteria 1096
45 Ga0070700_100284965 3300005441 Bacteria 1199
46 Ga0070694_100011227 3300005444 Bacteria 5546
47 Ga0070694_100041097 3300005444 Bacteria 3083
48 Ga0070694_100085037 3300005444 Bacteria 2208
49 Ga0070694_100428417 3300005444 Unclassified 1040
50 Ga0070708_100001354 3300005445 Bacteria 18706
51 Ga0070663_100017434 3300005455 Bacteria 4687
52 Ga0070663_100107007 3300005455 Bacteria 2096
53 Ga0070678_100058393 3300005456 Bacteria 2831
54 Ga0070662_100037326 3300005457 Bacteria 3445
55 Ga0070681_10065550 3300005458 Bacteria 3600
56 Ga0068867_100031053 3300005459 Bacteria 3855
57 Ga0068867_100619042 3300005459 Bacteria 946
58 Ga0070706_100179119 3300005467 Bacteria 1979
59 Ga0070707_100024316 3300005468 Bacteria 5737
60 Ga0070707_100179831 3300005468 Unclassified 2062
61 Ga0070698_100030199 3300005471 Bacteria 5621
62 Ga0070698_100523663 3300005471 Bacteria 1124
63 Ga0070679_100081618 3300005530 Bacteria 3223
64 Ga0070684_100023758 3300005535 Bacteria 5133
65 Ga0070697_100195898 3300005536 Bacteria 1716
66 Ga0070697_100256363 3300005536 Bacteria 1497
67 Ga0070672_100061746 3300005543 Bacteria 2955
68 Ga0070672_100251554 3300005543 Bacteria 1488
69 Ga0070695_100022759 3300005545 Bacteria 3846
70 Ga0070695_100043827 3300005545 Bacteria 2846
71 Ga0070695_100220547 3300005545 Bacteria 1366
72 Ga0070696_100031360 3300005546 Bacteria 3642
73 Ga0070693_100277200 3300005547 Bacteria 1122
74 Ga0070704_100045989 3300005549 Bacteria 3040
75 Ga0070704_100133080 3300005549 Bacteria 1930
76 Ga0070704_100358610 3300005549 Unclassified 1233
77 Ga0068855_100112078 3300005563 Bacteria 3131
78 Ga0068855_100315928 3300005563 Bacteria 1728
79 Ga0068857_100005781 3300005577 Bacteria 10572
80 Ga0068857_100062678 3300005577 Bacteria 3306
81 Ga0068857_100576012 3300005577 Unclassified 1062
82 Ga0068854_100393815 3300005578 Bacteria 1144
83 Ga0068856_100648497 3300005614 Bacteria 1076
84 Ga0068852_100016361 3300005616 Bacteria 5780
85 Ga0068852_100533553 3300005616 Bacteria 1172
86 Ga0068859_100000096 3300005617 Bacteria 81199
87 Ga0068864_100000214 3300005618 Bacteria 52286
88 Ga0068861_100001020 3300005719 Bacteria 17114
89 Ga0068861_100120852 3300005719 Bacteria 2113
90 Ga0068870_10040098 3300005840 Bacteria 2426
91 Ga0068863_100002420 3300005841 Bacteria 18520
92 Ga0068858_100003194 3300005842 Bacteria 16375
93 Ga0068858_100268888 3300005842 Bacteria 1622
94 Ga0068860_100000735 3300005843 Bacteria 37305
95 Ga0068862_100003360 3300005844 Bacteria 13810
96 Ga0068862_100087757 3300005844 Bacteria 2705
97 Ga0081539_10000596 3300005985 Bacteria 73813
98 Ga0081539_10066619 3300005985 Unclassified 1951
99 Ga0097621_100048096 3300006237 Bacteria 3459
100 Ga0068871_100447456 3300006358 Bacteria 1157
101 Ga0075428_100003951 3300006844 Bacteria 16265
102 Ga0075428_100063031 3300006844 Bacteria 4058
103 Ga0075428_100096644 3300006844 Unclassified 3220
104 Ga0075428_100112019 3300006844 Bacteria 2972
105 Ga0075428_100448597 3300006844 Bacteria 1382
106 Ga0075430_100006745 3300006846 Bacteria 9684
107 Ga0075430_100016886 3300006846 Bacteria 6217
108 Ga0075430_100046765 3300006846 Bacteria 3654
109 Ga0075430_100097913 3300006846 Bacteria 2450
110 Ga0075430_100109517 3300006846 Bacteria 2304
111 Ga0075431_100011558 3300006847 Bacteria 8906
112 Ga0075431_100030579 3300006847 Bacteria 5548
113 Ga0075431_100187788 3300006847 Unclassified 2118
114 Ga0075431_100194617 3300006847 Bacteria 2076
115 Ga0075431_100195065 3300006847 Bacteria 2073
116 Ga0075433_10000267 3300006852 Bacteria 30611
117 Ga0075433_10124579 3300006852 Bacteria 2289
118 Ga0075433_10124963 3300006852 Bacteria 2285
119 Ga0075434_100398451 3300006871 Bacteria 1397
120 Ga0075429_100002122 3300006880 Bacteria 16544
121 Ga0075429_100010227 3300006880 Bacteria 8122
122 Ga0075429_100016849 3300006880 Bacteria 6323
123 Ga0075429_100037695 3300006880 Bacteria 4208
124 Ga0075429_100111338 3300006880 Bacteria 2393
125 Ga0075429_100160617 3300006880 Bacteria 1968
126 Ga0075429_100163366 3300006880 Bacteria 1950
127 Ga0075429_100222802 3300006880 Bacteria 1652
128 Ga0068865_100123963 3300006881 Bacteria 1926
129 Ga0068865_100173272 3300006881 Bacteria 1656
130 Ga0097620_100000096 3300006931 Bacteria 81199
131 Ga0105251_10097905 3300009011 Bacteria 1343
132 Ga0111539_10000040 3300009094 Bacteria 136085
133 Ga0111539_10035179 3300009094 Bacteria 6065
134 Ga0111539_10085771 3300009094 Bacteria 3700
135 Ga0111539_10210378 3300009094 Bacteria 2266
136 Ga0105245_10069455 3300009098 Bacteria 3194
137 Ga0105245_10071892 3300009098 Bacteria 3142
138 Ga0105245_10251907 3300009098 Bacteria 1716
139 Ga0105247_10029380 3300009101 Bacteria 3330
140 Ga0114129_10001121 3300009147 Bacteria 35352
141 Ga0114129_10011532 3300009147 Bacteria 12587
142 Ga0114129_10023422 3300009147 Bacteria 8755
143 Ga0114129_10053340 3300009147 Bacteria 5671
144 Ga0114129_10081196 3300009147 Unclassified 4507
145 Ga0114129_10244340 3300009147 Bacteria 2412
146 Ga0114129_10343414 3300009147 Bacteria 1979
147 Ga0114129_10355074 3300009147 Bacteria 1941
148 Ga0114129_10436568 3300009147 Bacteria 1720
149 Ga0114129_10641559 3300009147 Bacteria 1372
150 Ga0114129_10965125 3300009147 Bacteria 1076
151 Ga0105243_10157754 3300009148 Unclassified 1953
152 Ga0105243_10327262 3300009148 Bacteria 1399
153 Ga0105243_10395553 3300009148 Bacteria 1282
154 Ga0105242_10566930 3300009176 Bacteria 1091
155 Ga0105248_10012733 3300009177 Bacteria 9279
156 Ga0105238_10543877 3300009551 Bacteria 1165
157 Ga0105238_10746730 3300009551 Viruses 992
158 Ga0105249_10062373 3300009553 Bacteria 3423
159 Ga0105249_10343045 3300009553 Bacteria 1511
160 Ga0105246_10050363 3300011119 Unclassified 2857
161 Ga0105246_10067506 3300011119 Bacteria 2506
162 Ga0105246_10131342 3300011119 Bacteria 1871
163 Ga0157378_10024461 3300013297 Bacteria 5315
164 Ga0157378_10407452 3300013297 Bacteria 1341
165 Ga0163162_10137191 3300013306 Bacteria 2558
166 Ga0157372_10679164 3300013307 Bacteria 1199
167 Ga0157375_10027356 3300013308 Bacteria 5330
168 Ga0157375_10602807 3300013308 Bacteria 1257
169 Ga0163163_10002637 3300014325 Bacteria 15176
170 Ga0163163_10041820 3300014325 Plasmid 4484
171 Ga0157380_10156671 3300014326 Bacteria 1975
172 Ga0207697_10050110 3300025315 Bacteria 1724
173 Ga0207653_10000317 3300025885 Bacteria 26858
174 Ga0207653_10023233 3300025885 Bacteria 1974
175 Ga0207682_10071361 3300025893 Bacteria 1472
176 Ga0207710_10012999 3300025900 Bacteria 3506
177 Ga0207643_10060271 3300025908 Bacteria 2166
178 Ga0207684_10057784 3300025910 Bacteria 3291
179 Ga0207707_10034603 3300025912 Bacteria 4420
180 Ga0207662_10107354 3300025918 Bacteria 1737
181 Ga0207662_10406112 3300025918 Bacteria 924
182 Ga0207652_10276924 3300025921 Bacteria 1513
183 Ga0207652_10668509 3300025921 Bacteria 928
184 Ga0207681_10032922 3300025923 Unclassified 3397
185 Ga0207681_10033379 3300025923 Bacteria 3374
186 Ga0207681_10578997 3300025923 Unclassified 926
187 Ga0207650_10007429 3300025925 Bacteria 7467
188 Ga0207687_10023470 3300025927 Bacteria 4112
189 Ga0207687_10164630 3300025927 Bacteria 1705
190 Ga0207706_10036516 3300025933 Bacteria 4365
191 Ga0207706_10607951 3300025933 Bacteria 939
192 Ga0207709_10014048 3300025935 Bacteria 4421
193 Ga0207709_10047347 3300025935 Unclassified 2613
194 Ga0207670_10159804 3300025936 Unclassified 1681
195 Ga0207670_10524995 3300025936 Bacteria 964
196 Ga0207670_10565950 3300025936 Bacteria 930
197 Ga0207704_10126683 3300025938 Bacteria 1760
198 Ga0207704_10494613 3300025938 Bacteria 984
199 Ga0207691_10078122 3300025940 Bacteria 2980
200 Ga0207691_10287115 3300025940 Bacteria 1415
201 Ga0207711_10014327 3300025941 Bacteria 6585
202 Ga0207689_10000334 3300025942 Bacteria 43862
203 Ga0207689_10195792 3300025942 Bacteria 1668
204 Ga0207689_10217511 3300025942 Bacteria 1579
205 Ga0207661_10515313 3300025944 Bacteria 1093
206 Ga0207679_10485615 3300025945 Bacteria 1100
207 Ga0207667_10237693 3300025949 Bacteria 1865
208 Ga0207651_10039092 3300025960 Bacteria 3125
209 Ga0207712_10203841 3300025961 Bacteria 1570
210 Ga0207668_10002532 3300025972 Bacteria 10674
211 Ga0207640_10325540 3300025981 Bacteria 1225
212 Ga0207658_10008515 3300025986 Bacteria 6978
213 Ga0207703_10000206 3300026035 Bacteria 68955
214 Ga0207708_10154178 3300026075 Bacteria 1811
215 Ga0207648_10002856 3300026089 Bacteria 18283
216 Ga0207676_10002625 3300026095 Bacteria 12814
217 Ga0207674_10006160 3300026116 Bacteria 14165
218 Ga0207674_10010099 3300026116 Bacteria 10735
219 Ga0207674_10359007 3300026116 Bacteria 1408
220 Ga0207674_10591921 3300026116 Unclassified 1071
221 Ga0207675_100002403 3300026118 Bacteria 18543
222 Ga0207675_100541999 3300026118 Bacteria 1162
223 Ga0207683_10005942 3300026121 Bacteria 10463
224 Ga0207683_10465479 3300026121 Bacteria 1166
225 Ga0207698_10284288 3300026142 Bacteria 1532
226 Ga0207698_10507452 3300026142 Bacteria 1175
227 Ga0207428_10001798 3300027907 Bacteria 21966
228 Ga0207428_10002045 3300027907 Bacteria 20377
229 Ga0207428_10003662 3300027907 Bacteria 14809
230 Ga0207428_10099677 3300027907 Bacteria 2246
231 Ga0268266_10346191 3300028379 Bacteria 1396
232 Ga0268265_10046143 3300028380 Bacteria 3255
233 Ga0268264_10001364 3300028381 Bacteria 22890
234 Ga0307408_100130610 3300031548 Bacteria 1959
235 Ga0316576_10043867 3300031727 Unclassified 3229
236 Ga0316578_10036540 3300031728 Bacteria 2827
237 Ga0316578_10129324 3300031728 Bacteria 1519
238 Ga0307410_10055347 3300031852 Unclassified 2693
239 Ga0307406_10012114 3300031901 Bacteria 4908
240 Ga0307407_10038915 3300031903 Unclassified 2640
241 Ga0307409_100000783 3300031995 Bacteria 14426
242 Ga0307416_100033495 3300032002 Bacteria 3895
243 Ga0307415_100000032 3300032126 Bacteria 59889
244 Ga0307415_100104430 3300032126 Unclassified 2087
245 Ga0316583_10069587 3300032133 Bacteria 1231
246 Ga0316593_10033854 3300032168 Bacteria 1674
247 Ga0316592_1028714 3300033524 Bacteria 1205
248 Ga0316586_1018279 3300033527 Bacteria 1136
249 Ga0316588_1033631 3300033528 Bacteria 1209
250 Ga0316588_1073247 3300033528 Unclassified 843
251 Ga0316596_1038222 3300033541 Bacteria 1257
252 Ga0373953_0042152 3300035117 Unclassified 1818
253 Ga0373956_0123303 3300035119 Unclassified 1211
254 Ga0316574_0070572 3300035398 Bacteria 2206
255 Ga0316574_0094671 3300035398 Bacteria 1908
256 Ga0316574_0366311 3300035398 Bacteria 910
257 Ga0373927_0129510 3300035695 Unclassified 1648
258 Ga0316584_0003943 3300036712 Bacteria 9751
259 Ga0316584_0053330 3300036712 Unclassified 3026
260 Ga0316584_0182924 3300036712 Bacteria 1551
261 Ga0373925_0063459 3300037068 Bacteria 2779
262 Ga0395900_0291064 3300037418 Bacteria 1622
263 Ga0395898_0038070 3300037466 Bacteria 4769
264 Ga0400485_07613 3300038735 Bacteria 4342
265 Ga0439441_032260 3300042001 Bacteria 1020
266 Ga0451577_0005285 3300042876 Bacteria 13272
267 Ga0451577_0715434 3300042876 Unclassified 906
268 Ga0453683_0003060 3300044673 Bacteria 12524
269 Ga0453683_0046325 3300044673 Unclassified 2726
270 Ga0453683_0054601 3300044673 Bacteria 2500
271 Ga0453683_0247861 3300044673 Bacteria 1135
272 Ga0453683_0259141 3300044673 Unclassified 1109
273 Ga0453684_0194350 3300044712 Bacteria 2371
274 Ga0453684_0734966 3300044712 Unclassified 1069
275 Ga0451576_0029480 3300045051 Bacteria 5871
276 Ga0451576_0390408 3300045051 Unclassified 1459
277 Ga0495665_0078715 3300046531 Unclassified 1734
278 Ga0495656_0026868 3300046615 Bacteria 2295
279 Ga0495647_0056331 3300046681 Bacteria 1541
280 Ga0496101_0497912 3300048904 Bacteria 963
281 Ga0496107_0270425 3300048910 Bacteria 1265
282 Ga0496109_0009899 3300048912 Bacteria 8139
283 Ga0496110_0454249 3300048913 Bacteria 1168
284 Ga0496112_0032328 3300048915 Bacteria 5080
285 Ga0496112_0179252 3300048915 Bacteria 2083
286 Ga0496113_0005098 3300048916 Bacteria 8161
287 Ga0501040_0352691 3300049576 Bacteria 1054
288 Ga0501071_0049073 3300049587 Bacteria 3038
289 Ga0501071_0777431 3300049587 Bacteria 738
290 Ga0501075_0100395 3300049591 Bacteria 2198
291 Ga0501230_019960 3300049667 Bacteria 1161
292 Ga0501080_0551837 3300049742 Unclassified 1026
293 nmdc:mga05p37_123208_c1 3300050507 Unclassified 3184
294 nmdc:mga05p37_252463_c1 3300050507 Bacteria 2115
295 nmdc:mga05p37_36335_c1 3300050507 Bacteria 6044
296 nmdc:mga05p37_37448_c1 3300050507 Bacteria 5946
297 nmdc:mga05p37_56372_c1 3300050507 Unclassified 4838
298 nmdc:mga05p37_785_c1 3300050507 Bacteria 35316
299 nmdc:mga09592_121851_c1 3300050508 Bacteria 2240
300 nmdc:mga09592_123424_c1 3300050508 Bacteria 2225
301 nmdc:mga09592_16849_c1 3300050508 Bacteria 5981
302 nmdc:mga09592_21571_c1 3300050508 Bacteria 5308
303 nmdc:mga09592_41003_c1 3300050508 Bacteria 3892
304 nmdc:mga09592_42906_c1 3300050508 Bacteria 3805
305 nmdc:mga09592_44241_c1 3300050508 Bacteria 3748
306 nmdc:mga0qj67_15160_c1 3300050509 Bacteria 5832
307 nmdc:mga0qj67_365217_c1 3300050509 Bacteria 1166
308 nmdc:mga0qj67_6844_c1 3300050509 Bacteria 8381
309 nmdc:mga0qj67_6965_c1 3300050509 Bacteria 8324
310 nmdc:mga0qj67_7445_c1 3300050509 Bacteria 8085
311 nmdc:mga06r32_138338_c1 3300050510 Bacteria 2410
312 nmdc:mga06r32_170887_c1 3300050510 Bacteria 2158
313 nmdc:mga06r32_260388_c1 3300050510 Bacteria 1722
314 nmdc:mga06r32_291496_c1 3300050510 Bacteria 1619
315 nmdc:mga06r32_3651_c1 3300050510 Bacteria 13750
316 nmdc:mga06r32_3948_c2 3300050510 Bacteria 8202
317 nmdc:mga06r32_539745_c1 3300050510 Unclassified 1141
318 nmdc:mga06r32_91997_c1 3300050510 Unclassified 2965
319 nmdc:mga08y16_114443_c1 3300050511 Bacteria 2808
320 nmdc:mga08y16_14090_c1 3300050511 Bacteria 8417
321 nmdc:mga08y16_2004_c1 3300050511 Bacteria 20828
322 nmdc:mga08y16_27192_c1 3300050511 Bacteria 6027
323 nmdc:mga08y16_724616_c1 3300050511 Bacteria 992
324 nmdc:mga08y16_83_c1 3300050511 Bacteria 80182
325 nmdc:mga0n895_28491_c1 3300050512 Bacteria 5312
326 nmdc:mga0n895_30340_c1 3300050512 Bacteria 5166
327 nmdc:mga0n895_54850_c1 3300050512 Bacteria 3921
328 nmdc:mga0a205_43614_c1 3300050515 Bacteria 4324
329 nmdc:mga0a205_49332_c1 3300050515 Bacteria 4063
330 nmdc:mga0a205_848_c1 3300050515 Bacteria 25049
331 2644609836 2643221711 Bacteria 4865335
332 2819668042 2818991458 Bacteria 4794049
333 2833712706 2833709550 Bacteria 4008291
334 nmdc:mga06r32_94541_c1
335 MBSR1b_contig_9553136
336 JGI24738J21930_10017077
337 JGI25406J46586_10009980
338 Ga0006562J51391_1132900
339 Ga0065707_10089189
340 Ga0065707_10228287
341 Ga0070683_100151790
342 Ga0070683_100373252
343 Ga0070690_100156709
344 Ga0070690_100220651
345 Ga0070670_100005923
346 Ga0070677_10068163
347 Ga0070677_10084574
348 Ga0068869_100000028
349 Ga0068869_100090510
350 Ga0068869_100194873
351 Ga0068869_100239973
352 Ga0068869_100610080
353 Ga0070680_100430092
354 Ga0070682_100191419
355 Ga0070660_100201914
356 Ga0070689_100078408
357 Ga0070689_100304033
358 Ga0070689_100438522
359 Ga0070689_100521612
360 Ga0070687_100109946
361 Ga0070661_100391327
362 Ga0070692_10017278
363 Ga0070692_10032679
364 Ga0070692_10083159
365 Ga0070668_100011258
366 Ga0070669_100031209
367 Ga0070669_100083418
368 Ga0070669_100402401
369 Ga0070669_100577114
370 Ga0070671_100262810
371 Ga0070673_100079103
372 Ga0070688_100271960
373 Ga0070659_100451430
374 Ga0070667_100001790
375 Ga0070703_10013762
376 Ga0070703_10018916
377 Ga0070701_10236766
378 Ga0070700_100284965
379 Ga0070694_100011227
380 Ga0070694_100041097
381 Ga0070694_100085037
382 Ga0070694_100428417
383 Ga0070708_100001354
384 Ga0070663_100017434
385 Ga0070663_100107007
386 Ga0070678_100058393
387 Ga0070662_100037326
388 Ga0070681_10065550
389 Ga0068867_100031053
390 Ga0068867_100619042
391 Ga0070706_100179119
392 Ga0070707_100024316
393 Ga0070707_100179831
394 Ga0070698_100030199
395 Ga0070698_100523663
396 Ga0070679_100081618
397 Ga0070684_100023758
398 Ga0070697_100195898
399 Ga0070697_100256363
400 Ga0070672_100061746
401 Ga0070672_100251554
402 Ga0070695_100022759
403 Ga0070695_100043827
404 Ga0070695_100220547
405 Ga0070696_100031360
406 Ga0070693_100277200
407 Ga0070704_100045989
408 Ga0070704_100133080
409 Ga0070704_100358610
410 Ga0068855_100112078
411 Ga0068855_100315928
412 Ga0068857_100005781
413 Ga0068857_100062678
414 Ga0068857_100576012
415 Ga0068854_100393815
416 Ga0068856_100648497
417 Ga0068852_100016361
418 Ga0068852_100533553
419 Ga0068859_100000096
420 Ga0068864_100000214
421 Ga0068861_100001020
422 Ga0068861_100120852
423 Ga0068870_10040098
424 Ga0068863_100002420
425 Ga0068858_100003194
426 Ga0068858_100268888
427 Ga0068860_100000735
428 Ga0068862_100003360
429 Ga0068862_100087757
430 Ga0081539_10000596
431 Ga0081539_10066619
432 Ga0097621_100048096
433 Ga0068871_100447456
434 Ga0075428_100003951
435 Ga0075428_100063031
436 Ga0075428_100096644
437 Ga0075428_100112019
438 Ga0075428_100448597
439 Ga0075430_100006745
440 Ga0075430_100016886
441 Ga0075430_100046765
442 Ga0075430_100097913
443 Ga0075430_100109517
444 Ga0075431_100011558
445 Ga0075431_100030579
446 Ga0075431_100187788
447 Ga0075431_100194617
448 Ga0075431_100195065
449 Ga0075433_10000267
450 Ga0075433_10124579
451 Ga0075433_10124963
452 Ga0075434_100398451
453 Ga0075429_100002122
454 Ga0075429_100010227
455 Ga0075429_100016849
456 Ga0075429_100037695
457 Ga0075429_100111338
458 Ga0075429_100160617
459 Ga0075429_100163366
460 Ga0075429_100222802
461 Ga0068865_100123963
462 Ga0068865_100173272
463 Ga0097620_100000096
464 Ga0105251_10097905
465 Ga0111539_10000040
466 Ga0111539_10035179
467 Ga0111539_10085771
468 Ga0111539_10210378
469 Ga0105245_10069455
470 Ga0105245_10071892
471 Ga0105245_10251907
472 Ga0105247_10029380
473 Ga0114129_10001121
474 Ga0114129_10011532
475 Ga0114129_10023422
476 Ga0114129_10053340
477 Ga0114129_10081196
478 Ga0114129_10244340
479 Ga0114129_10343414
480 Ga0114129_10355074
481 Ga0114129_10436568
482 Ga0114129_10641559
483 Ga0114129_10965125
484 Ga0105243_10157754
485 Ga0105243_10327262
486 Ga0105243_10395553
487 Ga0105242_10566930
488 Ga0105248_10012733
489 Ga0105238_10543877
490 Ga0105238_10746730
491 Ga0105249_10062373
492 Ga0105249_10343045
493 Ga0105246_10050363
494 Ga0105246_10067506
495 Ga0105246_10131342
496 Ga0157378_10024461
497 Ga0157378_10407452
498 Ga0163162_10137191
499 Ga0157372_10679164
500 Ga0157375_10027356
501 Ga0157375_10602807
502 Ga0163163_10002637
503 Ga0163163_10041820
504 Ga0157380_10156671
505 Ga0207697_10050110
506 Ga0207653_10000317
507 Ga0207653_10023233
508 Ga0207682_10071361
509 Ga0207710_10012999
510 Ga0207643_10060271
511 Ga0207684_10057784
512 Ga0207707_10034603
513 Ga0207662_10107354
514 Ga0207662_10406112
515 Ga0207652_10276924
516 Ga0207652_10668509
517 Ga0207681_10032922
518 Ga0207681_10033379
519 Ga0207681_10578997
520 Ga0207650_10007429
521 Ga0207687_10023470
522 Ga0207687_10164630
523 Ga0207706_10036516
524 Ga0207706_10607951
525 Ga0207709_10014048
526 Ga0207709_10047347
527 Ga0207670_10159804
528 Ga0207670_10524995
529 Ga0207670_10565950
530 Ga0207704_10126683
531 Ga0207704_10494613
532 Ga0207691_10078122
533 Ga0207691_10287115
534 Ga0207711_10014327
535 Ga0207689_10000334
536 Ga0207689_10195792
537 Ga0207689_10217511
538 Ga0207661_10515313
539 Ga0207679_10485615
540 Ga0207667_10237693
541 Ga0207651_10039092
542 Ga0207712_10203841
543 Ga0207668_10002532
544 Ga0207640_10325540
545 Ga0207658_10008515
546 Ga0207703_10000206
547 Ga0207708_10154178
548 Ga0207648_10002856
549 Ga0207676_10002625
550 Ga0207674_10006160
551 Ga0207674_10010099
552 Ga0207674_10359007
553 Ga0207674_10591921
554 Ga0207675_100002403
555 Ga0207675_100541999
556 Ga0207683_10005942
557 Ga0207683_10465479
558 Ga0207698_10284288
559 Ga0207698_10507452
560 Ga0207428_10001798
561 Ga0207428_10002045
562 Ga0207428_10003662
563 Ga0207428_10099677
564 Ga0268266_10346191
565 Ga0268265_10046143
566 Ga0268264_10001364
567 Ga0307408_100130610
568 Ga0316576_10043867
569 Ga0316578_10036540
570 Ga0316578_10129324
571 Ga0307410_10055347
572 Ga0307406_10012114
573 Ga0307407_10038915
574 Ga0307409_100000783
575 Ga0307416_100033495
576 Ga0307415_100000032
577 Ga0307415_100104430
578 Ga0316583_10069587
579 Ga0316593_10033854
580 Ga0316592_1028714
581 Ga0316586_1018279
582 Ga0316588_1033631
583 Ga0316588_1073247
584 Ga0316596_1038222
585 Ga0373953_0042152
586 Ga0373956_0123303
587 Ga0316574_0070572
588 Ga0316574_0094671
589 Ga0316574_0366311
590 Ga0373927_0129510
591 Ga0316584_0003943
592 Ga0316584_0053330
593 Ga0316584_0182924
594 Ga0373925_0063459
595 Ga0395900_0291064
596 Ga0395898_0038070
597 Ga0400485_07613
598 Ga0439441_032260
599 Ga0451577_0005285
600 Ga0451577_0715434
601 Ga0453683_0003060
602 Ga0453683_0046325
603 Ga0453683_0054601
604 Ga0453683_0247861
605 Ga0453683_0259141
606 Ga0453684_0194350
607 Ga0453684_0734966
608 Ga0451576_0029480
609 Ga0451576_0390408
610 Ga0495665_0078715
611 Ga0495656_0026868
612 Ga0495647_0056331
613 Ga0496101_0497912
614 Ga0496107_0270425
615 Ga0496109_0009899
616 Ga0496110_0454249
617 Ga0496112_0032328
618 Ga0496112_0179252
619 Ga0496113_0005098
620 Ga0501040_0352691
621 Ga0501071_0049073
622 Ga0501071_0777431
623 Ga0501075_0100395
624 Ga0501230_019960
625 Ga0501080_0551837
626 nmdc:mga05p37_123208_c1
627 nmdc:mga05p37_252463_c1
628 nmdc:mga05p37_36335_c1
629 nmdc:mga05p37_37448_c1
630 nmdc:mga05p37_56372_c1
631 nmdc:mga05p37_785_c1
632 nmdc:mga09592_121851_c1
633 nmdc:mga09592_123424_c1
634 nmdc:mga09592_16849_c1
635 nmdc:mga09592_21571_c1
636 nmdc:mga09592_41003_c1
637 nmdc:mga09592_42906_c1
638 nmdc:mga09592_44241_c1
639 nmdc:mga0qj67_15160_c1
640 nmdc:mga0qj67_365217_c1
641 nmdc:mga0qj67_6844_c1
642 nmdc:mga0qj67_6965_c1
643 nmdc:mga0qj67_7445_c1
644 nmdc:mga06r32_138338_c1
645 nmdc:mga06r32_170887_c1
646 nmdc:mga06r32_260388_c1
647 nmdc:mga06r32_291496_c1
648 nmdc:mga06r32_3651_c1
649 nmdc:mga06r32_3948_c2
650 nmdc:mga06r32_539745_c1
651 nmdc:mga06r32_91997_c1
652 nmdc:mga08y16_114443_c1
653 nmdc:mga08y16_14090_c1
654 nmdc:mga08y16_2004_c1
655 nmdc:mga08y16_27192_c1
656 nmdc:mga08y16_724616_c1
657 nmdc:mga08y16_83_c1
658 nmdc:mga0n895_28491_c1
659 nmdc:mga0n895_30340_c1
660 nmdc:mga0n895_54850_c1
661 nmdc:mga0a205_43614_c1
662 nmdc:mga0a205_49332_c1
663 nmdc:mga0a205_848_c1
664 2644609836
665 2819668042
666 2833712706

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00089

Trypsin

Trypsin

63

291

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4afz-assembly2.cif.gz_B human chymase - fynomer complex 0.7674 28 269
1fuj-assembly1.cif.gz_D pr3 (myeloblastin) 0.766 25 266
1fi8-assembly1.cif.gz_A rat granzyme b [n66q] complexed to ecotin [81-84 iepd] 0.766 36 267
1fi8-assembly1.cif.gz_B rat granzyme b [n66q] complexed to ecotin [81-84 iepd] 0.7644 36 267
4niv-assembly1.cif.gz_A crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) trigonal form 0.7607 29 269
ID Description Score Start End Superfamily
af_P17207_42_140_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.79 26 136 2.40.10.10
af_P17207_42_140_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7829 26 136 2.40.10.10
af_Q9VRS6_31_271_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7768 25 268 2.40.10.10
af_P32822_32_130_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7755 36 141 2.40.10.10
af_G3V8K8_195_280_2.40.10.10 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.7736 36 134 2.40.10.10
ID Description Score Start End GO Terms
AF-A0A7S1YI27-F1-model_v4 Peptidase S1 domain-containing protein 0.9036 33 80 GO:0004252
GO:0006508
AF-A0A7J9Y0U8-F1-model_v4 Trypsin-like serine protease 0.8879 19 270 GO:0004252
GO:0006508
AF-A0A511R174-F1-model_v4 Peptidase S1 domain-containing protein 0.8765 79 266 GO:0004252
GO:0006508
AF-A0A2V7L301-F1-model_v4 Serine protease 0.8677 25 266 GO:0004252
GO:0006508
AF-A0A6J4VVH0-F1-model_v4 Peptidase S1 domain-containing protein 0.8634 19 267 GO:0004252
GO:0006508

Map