F413298

General Info

Members Datasets Scaffolds Average Seq Length
337 234 674 301

Family's Representative Sequence

Representative Sequence 3300053158|Ga0500627_0053887|Ga0500627_0053887_505_1575
Length 356
Sequence MAARRSVKHFVQFAAFLSGLAERYVVQYCYLQLLVSSDPSKAIFQESSVQKVISAVVALFVVLSSLPAFAQASPPSEASRKAELVAAWQAASAAGAAGPKDVSLIDQAALKLPAGYFFVPQAEGARVLRALGNVVNDTSIVGLVVGTGPNDGWIVVIRYIKEGYIKDDDAKNWNADDLLKNLKDGVEESNKDRVARGFPEMQVIGWVQPPNYDAATHRLVWSLLAKDKDEADNAAKSINYNTYALGRDGYFSLNLLSNSERIAGDKSVAHELLGDLAYNTGKRYEDFSASTDRIAEYGLMALVGGVAAKKLGLFALAAAFVLKFAKIILIGLGVFGAGVLNFFRRKPRSDAADGPA

Samples

Sample ID Description Type Environment
1 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
45 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
46 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
117 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
131 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
132 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
133 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
139 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
149 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
150 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
151 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
152 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
155 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
156 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
157 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
173 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
174 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
178 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
183 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
184 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
185 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
186 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
187 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
188 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
189 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
190 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
191 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
194 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
195 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
196 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
197 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
198 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
199 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
200 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
201 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
202 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
203 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
204 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
205 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
206 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
207 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
208 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
209 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
210 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
211 2858950400 Achromobacter sp. K91 Isolate Unclassified
212 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
213 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
214 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
215 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
216 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
217 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
218 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
219 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
220 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
221 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
222 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
223 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
224 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
225 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
226 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
227 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
228 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
229 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
230 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
231 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
232 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
233 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
234 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.1
Metatranscriptomes 0
Isolates 8.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.95
Nodule 5.93
Rhizoplane 5.34
Rhizosphere 62.61
Stem 0
Stem Tuber 0
Unclassified 2.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500627_0053887 3300053158 Bacteria 1758
2 JGI24739J22299_10036733 3300001989 Bacteria 1653
3 JGI24735J21928_10007772 3300002067 Bacteria 3486
4 JGI25153J46596_10014208 3300003215 Bacteria 3323
5 rootH1_10010499 3300003323 Bacteria 1784
6 JGI25404J52841_10004205 3300003659 Bacteria 2897
7 JGI25404J52841_10025189 3300003659 Bacteria 1281
8 Ga0065165_1002068 3300005262 Bacteria 18536
9 Ga0065704_10175112 3300005289 Unclassified 1268
10 Ga0070658_10093109 3300005327 Bacteria 2486
11 Ga0070676_10073739 3300005328 Bacteria 2054
12 Ga0070690_100030534 3300005330 Bacteria 3350
13 Ga0068869_100065640 3300005334 Bacteria 2672
14 Ga0068869_100077412 3300005334 Bacteria 2474
15 Ga0068868_100036714 3300005338 Bacteria 3795
16 Ga0070660_100236141 3300005339 Bacteria 1488
17 Ga0070661_100144869 3300005344 Unclassified 1792
18 Ga0070692_10000276 3300005345 Bacteria 14447
19 Ga0070692_10216796 3300005345 Bacteria 1129
20 Ga0070668_100064035 3300005347 Bacteria 2850
21 Ga0070668_100533793 3300005347 Eukaryota 1019
22 Ga0070669_100070574 3300005353 Bacteria 2583
23 Ga0070663_100004564 3300005455 Bacteria 8157
24 Ga0070663_100014875 3300005455 Bacteria 5004
25 Ga0070663_100032647 3300005455 Bacteria 3590
26 Ga0070678_100372494 3300005456 Bacteria 1233
27 Ga0068867_100001106 3300005459 Bacteria 18425
28 Ga0068867_100217809 3300005459 Bacteria 1537
29 Ga0068853_100215810 3300005539 Unclassified 1750
30 Ga0068853_100433754 3300005539 Bacteria 1234
31 Ga0070672_100032353 3300005543 Bacteria 3946
32 Ga0070665_100024005 3300005548 Bacteria 6140
33 Ga0070665_100127843 3300005548 Bacteria 2544
34 Ga0070665_100362663 3300005548 Bacteria 1455
35 Ga0068855_100046398 3300005563 Bacteria 5137
36 Ga0070664_100015713 3300005564 Bacteria 6196
37 Ga0070664_100122906 3300005564 Bacteria 2274
38 Ga0068854_100046952 3300005578 Bacteria 3077
39 Ga0068856_100029657 3300005614 Bacteria 5344
40 Ga0070702_100182405 3300005615 Bacteria 1375
41 Ga0068852_100345134 3300005616 Bacteria 1452
42 Ga0068852_100356680 3300005616 Unclassified 1429
43 Ga0068859_100049893 3300005617 Bacteria 4204
44 Ga0068859_100099495 3300005617 Bacteria 2963
45 Ga0068859_100304008 3300005617 Bacteria 1688
46 Ga0068859_100325254 3300005617 Bacteria 1631
47 Ga0068864_100040427 3300005618 Bacteria 3990
48 Ga0068861_100026757 3300005719 Bacteria 4196
49 Ga0068861_100191761 3300005719 Bacteria 1709
50 Ga0068863_100045198 3300005841 Bacteria 4179
51 Ga0068863_100069765 3300005841 Bacteria 3323
52 Ga0068858_100063209 3300005842 Bacteria 3425
53 Ga0068858_100205185 3300005842 Bacteria 1865
54 Ga0068860_100000323 3300005843 Bacteria 64975
55 Ga0068860_100078625 3300005843 Bacteria 3136
56 Ga0068860_100257883 3300005843 Bacteria 1699
57 Ga0068862_100315492 3300005844 Bacteria 1442
58 Ga0081455_10017797 3300005937 Bacteria 6795
59 Ga0081455_10032598 3300005937 Bacteria 4693
60 Ga0081540_1000430 3300005983 Bacteria 41337
61 Ga0081540_1000979 3300005983 Bacteria 25757
62 Ga0081540_1001476 3300005983 Bacteria 20290
63 Ga0081540_1058747 3300005983 Bacteria 1850
64 Ga0081539_10016359 3300005985 Bacteria 5304
65 Ga0075365_10059669 3300006038 Bacteria 2543
66 Ga0075368_10032834 3300006042 Bacteria 2017
67 Ga0075363_100109188 3300006048 Bacteria 1537
68 Ga0075364_10010761 3300006051 Bacteria 5534
69 Ga0075367_10049903 3300006178 Bacteria 2468
70 Ga0075367_10122589 3300006178 Bacteria 1602
71 Ga0075366_10001132 3300006195 Bacteria 13148
72 Ga0075366_10011727 3300006195 Bacteria 4954
73 Ga0075366_10052627 3300006195 Bacteria 2419
74 Ga0075366_10208621 3300006195 Bacteria 1189
75 Ga0097621_100051751 3300006237 Bacteria 3343
76 Ga0075370_10070484 3300006353 Bacteria 1999
77 Ga0075370_10134133 3300006353 Bacteria 1446
78 Ga0075428_100566937 3300006844 Bacteria 1213
79 Ga0075434_100292186 3300006871 Bacteria 1650
80 Ga0068865_100211395 3300006881 Bacteria 1512
81 Ga0097620_100049893 3300006931 Bacteria 4204
82 Ga0097620_100099488 3300006931 Bacteria 2963
83 Ga0097620_100303992 3300006931 Bacteria 1688
84 Ga0097620_100325246 3300006931 Bacteria 1631
85 Ga0075435_100002041 3300007076 Bacteria 13227
86 Ga0105251_10002058 3300009011 Bacteria 16260
87 Ga0105240_10028529 3300009093 Bacteria 7289
88 Ga0105240_10262998 3300009093 Bacteria 1989
89 Ga0105240_10381900 3300009093 Bacteria 1591
90 Ga0105245_10003627 3300009098 Bacteria 13778
91 Ga0105245_10071250 3300009098 Bacteria 3156
92 Ga0105247_10007717 3300009101 Bacteria 6584
93 Ga0105247_10101747 3300009101 Bacteria 1838
94 Ga0105247_10131195 3300009101 Bacteria 1633
95 Ga0105243_10007836 3300009148 Bacteria 8211
96 Ga0105241_10030194 3300009174 Bacteria 4048
97 Ga0105241_10092226 3300009174 Bacteria 2391
98 Ga0105242_10307673 3300009176 Bacteria 1449
99 Ga0105248_10048415 3300009177 Bacteria 4768
100 Ga0105248_10225539 3300009177 Bacteria 2109
101 Ga0105237_10000862 3300009545 Bacteria 41239
102 Ga0105237_10060299 3300009545 Bacteria 3796
103 Ga0105237_10172043 3300009545 Bacteria 2166
104 Ga0105238_10048100 3300009551 Bacteria 4299
105 Ga0105238_10139965 3300009551 Bacteria 2397
106 Ga0105238_10140598 3300009551 Unclassified 2391
107 Ga0105249_10187453 3300009553 Bacteria 2017
108 Ga0105249_10219525 3300009553 Bacteria 1870
109 Ga0105239_10000075 3300010375 Bacteria 140531
110 Ga0105239_10024398 3300010375 Bacteria 6663
111 Ga0105239_10177208 3300010375 Bacteria 2384
112 Ga0105246_10008855 3300011119 Bacteria 6193
113 Ga0105246_10057501 3300011119 Bacteria 2691
114 Ga0157374_10020152 3300013296 Bacteria 5912
115 Ga0157374_10194819 3300013296 Bacteria 1983
116 Ga0157378_10063384 3300013297 Bacteria 3303
117 Ga0163162_10130547 3300013306 Bacteria 2621
118 Ga0157375_10124042 3300013308 Bacteria 2696
119 Ga0163163_10066269 3300014325 Bacteria 3586
120 Ga0157377_10000091 3300014745 Bacteria 66087
121 Ga0157379_10054486 3300014968 Bacteria 3573
122 Ga0157379_10112793 3300014968 Bacteria 2443
123 Ga0157376_10009148 3300014969 Bacteria 7183
124 Ga0209758_1014223 3300025297 Bacteria 4254
125 Ga0209758_1047694 3300025297 Bacteria 1530
126 Ga0207426_1005640 3300025302 Bacteria 5662
127 Ga0207642_10023052 3300025899 Bacteria 2481
128 Ga0207688_10009910 3300025901 Bacteria 5187
129 Ga0207647_10052164 3300025904 Bacteria 2525
130 Ga0207647_10068775 3300025904 Bacteria 2142
131 Ga0207645_10119608 3300025907 Bacteria 1709
132 Ga0207643_10170801 3300025908 Bacteria 1312
133 Ga0207705_10139440 3300025909 Unclassified 1810
134 Ga0207654_10029561 3300025911 Bacteria 3002
135 Ga0207654_10108697 3300025911 Bacteria 1721
136 Ga0207654_10159954 3300025911 Bacteria 1454
137 Ga0207695_10024306 3300025913 Bacteria 6820
138 Ga0207695_10212345 3300025913 Bacteria 1845
139 Ga0207695_10235305 3300025913 Unclassified 1734
140 Ga0207671_10006436 3300025914 Bacteria 10455
141 Ga0207657_10206817 3300025919 Bacteria 1576
142 Ga0207681_10047692 3300025923 Bacteria 2888
143 Ga0207694_10077843 3300025924 Bacteria 2599
144 Ga0207659_10178256 3300025926 Bacteria 1681
145 Ga0207687_10017629 3300025927 Bacteria 4704
146 Ga0207706_10029762 3300025933 Bacteria 4873
147 Ga0207706_10047133 3300025933 Bacteria 3814
148 Ga0207709_10173853 3300025935 Bacteria 1514
149 Ga0207704_10186803 3300025938 Bacteria 1503
150 Ga0207691_10005526 3300025940 Bacteria 12209
151 Ga0207691_10330047 3300025940 Bacteria 1307
152 Ga0207711_10034475 3300025941 Bacteria 4286
153 Ga0207711_10113128 3300025941 Bacteria 2416
154 Ga0207689_10048875 3300025942 Bacteria 3489
155 Ga0207689_10106963 3300025942 Bacteria 2299
156 Ga0207712_10222639 3300025961 Bacteria 1509
157 Ga0207668_10069733 3300025972 Bacteria 2504
158 Ga0207640_10180880 3300025981 Bacteria 1581
159 Ga0207640_10265845 3300025981 Bacteria 1339
160 Ga0207640_10306247 3300025981 Bacteria 1259
161 Ga0207658_10479684 3300025986 Bacteria 1105
162 Ga0207677_10051334 3300026023 Bacteria 2796
163 Ga0207677_10065941 3300026023 Bacteria 2529
164 Ga0207639_10211212 3300026041 Bacteria 1671
165 Ga0207639_10382950 3300026041 Bacteria 1264
166 Ga0207678_10003138 3300026067 Bacteria 14954
167 Ga0207678_10015753 3300026067 Bacteria 6645
168 Ga0207678_10043997 3300026067 Bacteria 3864
169 Ga0207678_10077234 3300026067 Bacteria 2852
170 Ga0207641_10052507 3300026088 Bacteria 3453
171 Ga0207641_10087726 3300026088 Bacteria 2715
172 Ga0207641_10334521 3300026088 Bacteria 1439
173 Ga0207648_10002366 3300026089 Bacteria 20335
174 Ga0207648_10332041 3300026089 Bacteria 1368
175 Ga0207676_10121183 3300026095 Bacteria 2206
176 Ga0207676_10330452 3300026095 Bacteria 1403
177 Ga0207674_10146900 3300026116 Bacteria 2316
178 Ga0207675_100037577 3300026118 Bacteria 4516
179 Ga0207675_100233848 3300026118 Bacteria 1774
180 Ga0207683_10405927 3300026121 Bacteria 1254
181 Ga0207698_10213443 3300026142 Bacteria 1738
182 Ga0207428_10310786 3300027907 Unclassified 1165
183 Ga0268266_10060423 3300028379 Bacteria 3267
184 Ga0268266_10165190 3300028379 Bacteria 2005
185 Ga0268265_10158283 3300028380 Bacteria 1920
186 Ga0268265_10452371 3300028380 Bacteria 1200
187 Ga0268264_10000149 3300028381 Bacteria 163972
188 Ga0268264_10060037 3300028381 Bacteria 3187
189 Ga0268264_10196128 3300028381 Bacteria 1844
190 Ga0307517_10000249 3300028786 Bacteria 91911
191 Ga0307511_10110202 3300030521 Bacteria 1756
192 Ga0265328_10000169 3300031239 Bacteria 30144
193 Ga0265328_10009214 3300031239 Bacteria 4028
194 Ga0265316_10000026 3300031344 Bacteria 165508
195 Ga0307513_10211562 3300031456 Bacteria 1770
196 Ga0307508_10000009 3300031616 Bacteria 256966
197 Ga0307405_10036597 3300031731 Bacteria 2942
198 Ga0307412_10476251 3300031911 Bacteria 1034
199 Ga0307510_10002529 3300033180 Bacteria 20856
200 Ga0307510_10023638 3300033180 Bacteria 7120
201 Ga0373955_0016821 3300035172 Bacteria 3606
202 Ga0373942_0053740 3300035207 Bacteria 1136
203 Ga0373937_0009243 3300036401 Bacteria 8556
204 Ga0395900_0322925 3300037418 Bacteria 1523
205 Ga0395905_0000110 3300037471 Bacteria 137078
206 Ga0395905_0214280 3300037471 Bacteria 1804
207 Ga0395901_0130177 3300038443 Bacteria 2644
208 Ga0436365_0898899 3300039437 Bacteria 4001
209 Ga0436360_0513617 3300039438 Bacteria 4457
210 Ga0439455_0014685 3300042012 Bacteria 1791
211 Ga0450911_000104 3300042115 Bacteria 34662
212 Ga0466957_0143501 3300044842 Bacteria 1540
213 Ga0495603_0002761 3300046455 Bacteria 10347
214 Ga0495590_0001609 3300046457 Bacteria 9655
215 Ga0495596_0049333 3300046500 Bacteria 1650
216 Ga0495606_0070452 3300046507 Bacteria 2205
217 Ga0495606_0085677 3300046507 Bacteria 1949
218 Ga0495616_0043645 3300046513 Bacteria 2277
219 Ga0495654_0042485 3300046530 Bacteria 2257
220 Ga0495640_0148779 3300046533 Bacteria 1506
221 Ga0495597_0006814 3300046542 Bacteria 5872
222 Ga0495668_0049743 3300046616 Bacteria 2324
223 Ga0495611_0094231 3300046648 Bacteria 1385
224 Ga0495625_0159942 3300046660 Bacteria 1510
225 Ga0495670_0051011 3300046691 Bacteria 2071
226 Ga0495671_0007932 3300046692 Bacteria 6007
227 Ga0495683_0003748 3300047323 Bacteria 8784
228 Ga0495687_030603 3300047443 Bacteria 2477
229 Ga0495686_0032801 3300047472 Bacteria 3359
230 Ga0496100_0037523 3300048903 Bacteria 3063
231 Ga0496101_0000747 3300048904 Bacteria 19270
232 Ga0496101_0091922 3300048904 Bacteria 2259
233 Ga0496102_0011573 3300048905 Bacteria 7611
234 Ga0496102_0179557 3300048905 Bacteria 1994
235 Ga0496103_0023786 3300048906 Bacteria 3694
236 Ga0496104_0149253 3300048907 Bacteria 2245
237 Ga0496105_0204888 3300048908 Bacteria 1609
238 Ga0496106_0002372 3300048909 Bacteria 14021
239 Ga0496106_0110275 3300048909 Bacteria 2142
240 Ga0496107_0030109 3300048910 Bacteria 3867
241 Ga0496107_0078223 3300048910 Bacteria 2410
242 Ga0496107_0213019 3300048910 Bacteria 1437
243 Ga0496109_0061405 3300048912 Bacteria 3436
244 Ga0496110_0030201 3300048913 Bacteria 4669
245 Ga0496111_0003505 3300048914 Bacteria 9705
246 Ga0496112_0075547 3300048915 Bacteria 3332
247 Ga0496113_0050290 3300048916 Bacteria 3107
248 Ga0496116_0003366 3300048919 Bacteria 15870
249 Ga0496118_0037519 3300048921 Bacteria 3898
250 Ga0496118_0112823 3300048921 Bacteria 1798
251 Ga0496119_0088606 3300048922 Bacteria 1764
252 Ga0496121_0000247 3300048924 Bacteria 114839
253 Ga0496121_0003540 3300048924 Bacteria 22123
254 Ga0496121_0010446 3300048924 Bacteria 10474
255 Ga0496121_0029113 3300048924 Bacteria 5119
256 Ga0496121_0034530 3300048924 Bacteria 4551
257 Ga0496121_0045202 3300048924 Bacteria 3786
258 Ga0496121_0075293 3300048924 Bacteria 2697
259 Ga0496122_0014041 3300048925 Bacteria 7777
260 Ga0496124_0009536 3300048927 Bacteria 9980
261 Ga0496124_0112742 3300048927 Bacteria 2186
262 Ga0496125_0002393 3300048928 Bacteria 24439
263 Ga0496125_0008704 3300048928 Bacteria 10562
264 Ga0496125_0041412 3300048928 Bacteria 3938
265 Ga0496125_0046305 3300048928 Bacteria 3649
266 Ga0496125_0203022 3300048928 Bacteria 1295
267 Ga0496126_0012491 3300048929 Bacteria 8696
268 Ga0496126_0067897 3300048929 Bacteria 3185
269 Ga0496126_0139834 3300048929 Bacteria 2085
270 Ga0496126_0168375 3300048929 Bacteria 1868
271 Ga0496126_0200602 3300048929 Bacteria 1685
272 Ga0496126_0273984 3300048929 Bacteria 1400
273 Ga0495678_037999 3300049459 Bacteria 1952
274 Ga0495682_0056413 3300049460 Bacteria 1424
275 Ga0501249_000370 3300049679 Bacteria 11828
276 nmdc:mga0yw44_41853_c1 3300050492 Bacteria 2729
277 nmdc:mga0k408_16850_c1 3300050493 Bacteria 4062
278 nmdc:mga0k408_49787_c1 3300050493 Bacteria 2425
279 nmdc:mga06z11_82532_c1 3300050494 Bacteria 1728
280 nmdc:mga07m45_59504_c1 3300050496 Bacteria 2161
281 nmdc:mga08y16_212021_c1 3300050511 Bacteria 2006
282 nmdc:mga0n895_277271_c1 3300050512 Bacteria 1700
283 nmdc:mga0rr50_8040_c1 3300050513 Bacteria 6541
284 nmdc:mga0sz30_53935_c1 3300050516 Bacteria 1709
285 Ga0500578_0116947 3300053086 Bacteria 1678
286 Ga0500578_0131572 3300053086 Bacteria 1569
287 Ga0500643_026314 3300053087 Bacteria 1823
288 Ga0500647_0069392 3300053091 Bacteria 1695
289 Ga0500640_011050 3300053095 Bacteria 3668
290 Ga0500650_0093955 3300053098 Bacteria 1404
291 Ga0500555_024307 3300053103 Bacteria 1737
292 Ga0500569_002669 3300053109 Bacteria 3553
293 Ga0500572_037149 3300053111 Bacteria 1394
294 Ga0500595_008325 3300053119 Bacteria 4243
295 Ga0500608_016820 3300053122 Bacteria 3311
296 Ga0500617_064525 3300053124 Bacteria 1616
297 Ga0500564_091024 3300053138 Bacteria 1357
298 Ga0500588_0004407 3300053146 Bacteria 3051
299 Ga0500616_0000002 3300053153 Bacteria 1611257
300 Ga0500619_002762 3300053154 Bacteria 3453
301 Ga0500620_054519 3300053155 Bacteria 1348
302 Ga0500622_0069500 3300053156 Bacteria 1784
303 Ga0500638_037204 3300053162 Bacteria 2361
304 Ga0500636_0001005 3300053177 Bacteria 15085
305 Ga0500637_0082296 3300053178 Bacteria 1860
306 Ga0500609_005513 3300053731 Bacteria 1730
307 Ga0500601_000855 3300053737 Bacteria 3702
308 2511400958 2511231028 Bacteria 8046582
309 2517105658 2517093001 Bacteria 9002274
310 2824709625 2824704595 Bacteria 9667483
311 2824755358 2824753945 Bacteria 9787441
312 2824771133 2824763712 Bacteria 9792355
313 2841959192 2841957949 Bacteria 8652217
314 2858955667 2858950400 Bacteria 6783797
315 2876769520 2876761206 Bacteria 10111113
316 2876809938 2876808645 Bacteria 8824342
317 2879110231 2879110137 Bacteria 8907982
318 2904694657 2904690495 Bacteria 9412302
319 2904718776 2904711408 Bacteria 9771557
320 2908760207 2908756301 Bacteria 8864324
321 2935683718 2935675223 Bacteria 9928132
322 2935691983 2935684952 Bacteria 9590419
323 2935721822 2935713505 Bacteria 9608509
324 2935731180 2935722832 Bacteria 9608746
325 2935738958 2935732158 Bacteria 9706831
326 2935747857 2935741537 Bacteria 9707219
327 2935756441 2935750917 Bacteria 9590372
328 2935761577 2935760218 Bacteria 9817913
329 2935812107 2935810662 Bacteria 9401221
330 2936038701 2936037263 Bacteria 9446081
331 2940562355 2940556831 Bacteria 9590747
332 8006940469 8006933436 Bacteria 10410654
333 8006980158 8006973647 Bacteria 10679141
334 8006986604 8006984368 Bacteria 9651211
335 8019556541 8019555841 Bacteria 9642137
336 8019568768 8019565922 Bacteria 9639779
337 8057104565 8057101203 Bacteria 5034064
338 Ga0500627_0053887
339 JGI24739J22299_10036733
340 JGI24735J21928_10007772
341 JGI25153J46596_10014208
342 rootH1_10010499
343 JGI25404J52841_10004205
344 JGI25404J52841_10025189
345 Ga0065165_1002068
346 Ga0065704_10175112
347 Ga0070658_10093109
348 Ga0070676_10073739
349 Ga0070690_100030534
350 Ga0068869_100065640
351 Ga0068869_100077412
352 Ga0068868_100036714
353 Ga0070660_100236141
354 Ga0070661_100144869
355 Ga0070692_10000276
356 Ga0070692_10216796
357 Ga0070668_100064035
358 Ga0070668_100533793
359 Ga0070669_100070574
360 Ga0070663_100004564
361 Ga0070663_100014875
362 Ga0070663_100032647
363 Ga0070678_100372494
364 Ga0068867_100001106
365 Ga0068867_100217809
366 Ga0068853_100215810
367 Ga0068853_100433754
368 Ga0070672_100032353
369 Ga0070665_100024005
370 Ga0070665_100127843
371 Ga0070665_100362663
372 Ga0068855_100046398
373 Ga0070664_100015713
374 Ga0070664_100122906
375 Ga0068854_100046952
376 Ga0068856_100029657
377 Ga0070702_100182405
378 Ga0068852_100345134
379 Ga0068852_100356680
380 Ga0068859_100049893
381 Ga0068859_100099495
382 Ga0068859_100304008
383 Ga0068859_100325254
384 Ga0068864_100040427
385 Ga0068861_100026757
386 Ga0068861_100191761
387 Ga0068863_100045198
388 Ga0068863_100069765
389 Ga0068858_100063209
390 Ga0068858_100205185
391 Ga0068860_100000323
392 Ga0068860_100078625
393 Ga0068860_100257883
394 Ga0068862_100315492
395 Ga0081455_10017797
396 Ga0081455_10032598
397 Ga0081540_1000430
398 Ga0081540_1000979
399 Ga0081540_1001476
400 Ga0081540_1058747
401 Ga0081539_10016359
402 Ga0075365_10059669
403 Ga0075368_10032834
404 Ga0075363_100109188
405 Ga0075364_10010761
406 Ga0075367_10049903
407 Ga0075367_10122589
408 Ga0075366_10001132
409 Ga0075366_10011727
410 Ga0075366_10052627
411 Ga0075366_10208621
412 Ga0097621_100051751
413 Ga0075370_10070484
414 Ga0075370_10134133
415 Ga0075428_100566937
416 Ga0075434_100292186
417 Ga0068865_100211395
418 Ga0097620_100049893
419 Ga0097620_100099488
420 Ga0097620_100303992
421 Ga0097620_100325246
422 Ga0075435_100002041
423 Ga0105251_10002058
424 Ga0105240_10028529
425 Ga0105240_10262998
426 Ga0105240_10381900
427 Ga0105245_10003627
428 Ga0105245_10071250
429 Ga0105247_10007717
430 Ga0105247_10101747
431 Ga0105247_10131195
432 Ga0105243_10007836
433 Ga0105241_10030194
434 Ga0105241_10092226
435 Ga0105242_10307673
436 Ga0105248_10048415
437 Ga0105248_10225539
438 Ga0105237_10000862
439 Ga0105237_10060299
440 Ga0105237_10172043
441 Ga0105238_10048100
442 Ga0105238_10139965
443 Ga0105238_10140598
444 Ga0105249_10187453
445 Ga0105249_10219525
446 Ga0105239_10000075
447 Ga0105239_10024398
448 Ga0105239_10177208
449 Ga0105246_10008855
450 Ga0105246_10057501
451 Ga0157374_10020152
452 Ga0157374_10194819
453 Ga0157378_10063384
454 Ga0163162_10130547
455 Ga0157375_10124042
456 Ga0163163_10066269
457 Ga0157377_10000091
458 Ga0157379_10054486
459 Ga0157379_10112793
460 Ga0157376_10009148
461 Ga0209758_1014223
462 Ga0209758_1047694
463 Ga0207426_1005640
464 Ga0207642_10023052
465 Ga0207688_10009910
466 Ga0207647_10052164
467 Ga0207647_10068775
468 Ga0207645_10119608
469 Ga0207643_10170801
470 Ga0207705_10139440
471 Ga0207654_10029561
472 Ga0207654_10108697
473 Ga0207654_10159954
474 Ga0207695_10024306
475 Ga0207695_10212345
476 Ga0207695_10235305
477 Ga0207671_10006436
478 Ga0207657_10206817
479 Ga0207681_10047692
480 Ga0207694_10077843
481 Ga0207659_10178256
482 Ga0207687_10017629
483 Ga0207706_10029762
484 Ga0207706_10047133
485 Ga0207709_10173853
486 Ga0207704_10186803
487 Ga0207691_10005526
488 Ga0207691_10330047
489 Ga0207711_10034475
490 Ga0207711_10113128
491 Ga0207689_10048875
492 Ga0207689_10106963
493 Ga0207712_10222639
494 Ga0207668_10069733
495 Ga0207640_10180880
496 Ga0207640_10265845
497 Ga0207640_10306247
498 Ga0207658_10479684
499 Ga0207677_10051334
500 Ga0207677_10065941
501 Ga0207639_10211212
502 Ga0207639_10382950
503 Ga0207678_10003138
504 Ga0207678_10015753
505 Ga0207678_10043997
506 Ga0207678_10077234
507 Ga0207641_10052507
508 Ga0207641_10087726
509 Ga0207641_10334521
510 Ga0207648_10002366
511 Ga0207648_10332041
512 Ga0207676_10121183
513 Ga0207676_10330452
514 Ga0207674_10146900
515 Ga0207675_100037577
516 Ga0207675_100233848
517 Ga0207683_10405927
518 Ga0207698_10213443
519 Ga0207428_10310786
520 Ga0268266_10060423
521 Ga0268266_10165190
522 Ga0268265_10158283
523 Ga0268265_10452371
524 Ga0268264_10000149
525 Ga0268264_10060037
526 Ga0268264_10196128
527 Ga0307517_10000249
528 Ga0307511_10110202
529 Ga0265328_10000169
530 Ga0265328_10009214
531 Ga0265316_10000026
532 Ga0307513_10211562
533 Ga0307508_10000009
534 Ga0307405_10036597
535 Ga0307412_10476251
536 Ga0307510_10002529
537 Ga0307510_10023638
538 Ga0373955_0016821
539 Ga0373942_0053740
540 Ga0373937_0009243
541 Ga0395900_0322925
542 Ga0395905_0000110
543 Ga0395905_0214280
544 Ga0395901_0130177
545 Ga0436365_0898899
546 Ga0436360_0513617
547 Ga0439455_0014685
548 Ga0450911_000104
549 Ga0466957_0143501
550 Ga0495603_0002761
551 Ga0495590_0001609
552 Ga0495596_0049333
553 Ga0495606_0070452
554 Ga0495606_0085677
555 Ga0495616_0043645
556 Ga0495654_0042485
557 Ga0495640_0148779
558 Ga0495597_0006814
559 Ga0495668_0049743
560 Ga0495611_0094231
561 Ga0495625_0159942
562 Ga0495670_0051011
563 Ga0495671_0007932
564 Ga0495683_0003748
565 Ga0495687_030603
566 Ga0495686_0032801
567 Ga0496100_0037523
568 Ga0496101_0000747
569 Ga0496101_0091922
570 Ga0496102_0011573
571 Ga0496102_0179557
572 Ga0496103_0023786
573 Ga0496104_0149253
574 Ga0496105_0204888
575 Ga0496106_0002372
576 Ga0496106_0110275
577 Ga0496107_0030109
578 Ga0496107_0078223
579 Ga0496107_0213019
580 Ga0496109_0061405
581 Ga0496110_0030201
582 Ga0496111_0003505
583 Ga0496112_0075547
584 Ga0496113_0050290
585 Ga0496116_0003366
586 Ga0496118_0037519
587 Ga0496118_0112823
588 Ga0496119_0088606
589 Ga0496121_0000247
590 Ga0496121_0003540
591 Ga0496121_0010446
592 Ga0496121_0029113
593 Ga0496121_0034530
594 Ga0496121_0045202
595 Ga0496121_0075293
596 Ga0496122_0014041
597 Ga0496124_0009536
598 Ga0496124_0112742
599 Ga0496125_0002393
600 Ga0496125_0008704
601 Ga0496125_0041412
602 Ga0496125_0046305
603 Ga0496125_0203022
604 Ga0496126_0012491
605 Ga0496126_0067897
606 Ga0496126_0139834
607 Ga0496126_0168375
608 Ga0496126_0200602
609 Ga0496126_0273984
610 Ga0495678_037999
611 Ga0495682_0056413
612 Ga0501249_000370
613 nmdc:mga0yw44_41853_c1
614 nmdc:mga0k408_16850_c1
615 nmdc:mga0k408_49787_c1
616 nmdc:mga06z11_82532_c1
617 nmdc:mga07m45_59504_c1
618 nmdc:mga08y16_212021_c1
619 nmdc:mga0n895_277271_c1
620 nmdc:mga0rr50_8040_c1
621 nmdc:mga0sz30_53935_c1
622 Ga0500578_0116947
623 Ga0500578_0131572
624 Ga0500643_026314
625 Ga0500647_0069392
626 Ga0500640_011050
627 Ga0500650_0093955
628 Ga0500555_024307
629 Ga0500569_002669
630 Ga0500572_037149
631 Ga0500595_008325
632 Ga0500608_016820
633 Ga0500617_064525
634 Ga0500564_091024
635 Ga0500588_0004407
636 Ga0500616_0000002
637 Ga0500619_002762
638 Ga0500620_054519
639 Ga0500622_0069500
640 Ga0500638_037204
641 Ga0500636_0001005
642 Ga0500637_0082296
643 Ga0500609_005513
644 Ga0500601_000855
645 2511400958
646 2517105658
647 2824709625
648 2824755358
649 2824771133
650 2841959192
651 2858955667
652 2876769520
653 2876809938
654 2879110231
655 2904694657
656 2904718776
657 2908760207
658 2935683718
659 2935691983
660 2935721822
661 2935731180
662 2935738958
663 2935747857
664 2935756441
665 2935761577
666 2935812107
667 2936038701
668 2940562355
669 8006940469
670 8006980158
671 8006986604
672 8019556541
673 8019568768
674 8057104565

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09935

DUF2167

Protein of unknown function (DUF2167)

96

333

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7onx-assembly1.cif.gz_A crystal structure of pbp3 from p. aeruginosa 0.6398 152 197
7rcz-assembly1.cif.gz_A crystal structure of c. difficile spovd in complex with ampicillin 0.6264 150 196
5tsh-assembly1.cif.gz_E pilb from geobacter metallireducens bound to amp-pnp 0.6153 156 200
7kiv-assembly1.cif.gz_A crystal structure of pseudomonas aeruginosa pbp3 in complex with avibactam 0.6099 152 212
4n7s-assembly2.cif.gz_D crystal structure of tse3-tsi3 complex with zinc ion 0.6042 41 194
ID Description Score Start End Superfamily
af_A0A0R0I2J7_57_237_2.40.128.20 Mainly Beta;Beta Barrel;Lipocalin;Calycin beta-barrel core domain 0.6857 137 182 2.40.128.20
af_P32074_820_932_3.30.310.10 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;TATA-Binding Protein 0.6429 91 197 3.30.310.10
af_A0A0R0EKI7_78_225_3.40.1000.10 Alpha Beta;3-Layer(aba) Sandwich;Protein Transport Mog1p; Chain A;Mog1/PsbP, alpha/beta/alpha sandwich 0.6352 76 204 3.40.1000.10
af_F4JED3_2_127_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6282 139 197 3.10.450.50
4n7sD00 Mainly Beta;Sandwich;Jelly Rolls; 0.6042 41 194 2.60.120.1690
ID Description Score Start End GO Terms
AF-B2UB77-F1-model_v4 Putative transmembrane protein 0.9643 12 198
AF-A0A660MD38-F1-model_v4 DUF2167 domain-containing protein 0.9571 25 205
AF-A0A659R7I8-F1-model_v4 DUF2167 domain-containing protein 0.9461 19 217
AF-A0A2V7VN44-F1-model_v4 DUF2167 domain-containing protein 0.9448 36 241
AF-A0A4Q2X1K4-F1-model_v4 DUF2167 domain-containing protein 0.916 41 198

Map