F413348

General Info

Members Datasets Scaffolds Average Seq Length
338 236 676 212

Family's Representative Sequence

Representative Sequence 3300003781|Ga0055536_1030821|Ga0055536_10308211
Length 252
Sequence MPXGVVTPAVCIPHSQLILRTAQPMDKESPLDAGPRDISPLETRVSRRKVLIAGTVSAAAGALPAMATLAHEATSPAEARPVVKSKVTFEVNGSARSLELDTRTTLLDALREHLRLTGTKKGCDHGQCGACTVIVDGRRINSCLTLAVMHEGSRVTTIEGLGTPERLHPMQAAFVKHDGYQCGYCTPGQICSAVAMLEEIKAGIPSHVTGDLTARLQPNAAEVRERMSGNICRCGAYSNILDAIDEVAGGLA

Samples

Sample ID Description Type Environment
1 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
32 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
39 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
40 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
41 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
42 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
43 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
44 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
45 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
46 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
49 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
50 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
51 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
85 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
86 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
87 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
88 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
89 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
93 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
103 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
104 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
105 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
106 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
111 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
112 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
113 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
114 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
115 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
116 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
119 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
120 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
121 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
122 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
123 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
124 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
125 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
126 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
127 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
128 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
133 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
134 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
141 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
142 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
143 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
144 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
154 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
155 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
156 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
157 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
158 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
159 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
160 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
161 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
162 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
163 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
166 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
167 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
168 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
169 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
170 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
171 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
172 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
173 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
174 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
175 2643221556 Massilia sp. Root1485 Isolate Unclassified
176 2643221559 Lysobacter sp. Root559 Isolate Unclassified
177 2643221584 Caulobacter sp. Root656 Isolate Unclassified
178 2643221586 Lysobacter sp. Root667 Isolate Unclassified
179 2643221612 Lysobacter sp. Root76 Isolate Unclassified
180 2643221684 Massilia sp. Root133 Isolate Unclassified
181 2643221727 Lysobacter sp. Root96 Isolate Unclassified
182 2734482264 Dyella sp. AD052 Isolate Unclassified
183 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
184 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
185 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
186 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
187 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
188 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
189 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
190 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
191 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
192 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
193 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
194 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
195 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
196 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
197 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
198 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
199 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
200 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
201 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
202 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
203 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
204 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
205 2849560528 Caulobacter zeae 410 Isolate Unclassified
206 2851153111 Caulobacter radicis 736 Isolate Unclassified
207 2855767633 Achromobacter sp. HZ34 Isolate Nodule
208 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
209 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
210 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
211 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
212 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
213 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
214 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
215 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
216 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
217 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
218 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
219 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
220 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
221 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
222 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
223 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
224 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
225 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
226 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
227 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
228 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
229 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
230 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
231 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
232 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
233 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
234 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
235 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
236 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.18
Metatranscriptomes 0
Isolates 19.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.34
Nodule 12.13
Rhizoplane 1.78
Rhizosphere 54.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1030821 3300003781 Bacteria 1414
2 SwRhRL2b_contig_351495 2162886007 Bacteria 17555
3 JGI24739J22299_10001789 3300001989 Bacteria 8182
4 JGI25152J39213_1000041 3300002773 Bacteria 88071
5 JGI25150J39212_1000399 3300002774 Bacteria 20346
6 JGI25151J46595_10000141 3300003187 Bacteria 95351
7 JGI25151J46595_10016352 3300003187 Bacteria 3247
8 JGI25153J46596_10000106 3300003215 Bacteria 95351
9 JGI25153J46596_10000560 3300003215 Bacteria 23047
10 JGI25153J46596_10000694 3300003215 Bacteria 20570
11 Ga0055536_1000456 3300003781 Bacteria 28748
12 Ga0055531_10000852 3300003794 Bacteria 25159
13 Ga0055531_10003523 3300003794 Bacteria 9955
14 Ga0055531_10003731 3300003794 Bacteria 9573
15 Ga0055531_10012031 3300003794 Bacteria 4107
16 Ga0065165_1000864 3300005262 Bacteria 39604
17 Ga0065165_1004598 3300005262 Bacteria 8400
18 Ga0065165_1011293 3300005262 Bacteria 3747
19 Ga0065704_10092405 3300005289 Bacteria 2656
20 Ga0065707_10089354 3300005295 Bacteria 4393
21 Ga0070676_10328929 3300005328 Bacteria 1044
22 Ga0070668_100007720 3300005347 Bacteria 7983
23 Ga0070668_100037908 3300005347 Bacteria 3683
24 Ga0070668_100049941 3300005347 Bacteria 3219
25 Ga0070669_100043761 3300005353 Bacteria 3262
26 Ga0070667_100000112 3300005367 Bacteria 104843
27 Ga0070667_100001643 3300005367 Bacteria 19988
28 Ga0070667_100036898 3300005367 Bacteria 4098
29 Ga0070663_100255254 3300005455 Bacteria 1389
30 Ga0070662_100006066 3300005457 Bacteria 7759
31 Ga0070662_100055672 3300005457 Bacteria 2870
32 Ga0068867_100365110 3300005459 Bacteria 1208
33 Ga0068853_100005904 3300005539 Bacteria 9659
34 Ga0068853_100702205 3300005539 Bacteria 965
35 Ga0070665_100001353 3300005548 Bacteria 29032
36 Ga0068857_100072892 3300005577 Bacteria 3059
37 Ga0068854_100093128 3300005578 Bacteria 2245
38 Ga0068854_100141812 3300005578 Bacteria 1845
39 Ga0068859_100001917 3300005617 Bacteria 21221
40 Ga0068859_100762634 3300005617 Bacteria 1056
41 Ga0068864_100004466 3300005618 Bacteria 11500
42 Ga0068863_100000400 3300005841 Bacteria 44170
43 Ga0068863_100020630 3300005841 Bacteria 6297
44 Ga0068863_100404250 3300005841 Bacteria 1336
45 Ga0068860_100025171 3300005843 Bacteria 5743
46 Ga0068860_100055883 3300005843 Bacteria 3753
47 Ga0081455_10000121 3300005937 Bacteria 89580
48 Ga0081455_10025329 3300005937 Bacteria 5477
49 Ga0081540_1023941 3300005983 Bacteria 3555
50 Ga0075365_10118995 3300006038 Bacteria 1821
51 Ga0075365_10289302 3300006038 Bacteria 1153
52 Ga0075432_10008461 3300006058 Bacteria 3510
53 Ga0075362_10030152 3300006177 Bacteria 2341
54 Ga0075369_10067009 3300006186 Bacteria 1576
55 Ga0075370_10026084 3300006353 Bacteria 3234
56 Ga0097620_100001917 3300006931 Bacteria 21221
57 Ga0097620_100762601 3300006931 Bacteria 1056
58 Ga0105248_10002303 3300009177 Bacteria 21145
59 Ga0105248_10376366 3300009177 Bacteria 1598
60 Ga0105248_11025467 3300009177 Bacteria 932
61 Ga0105238_10047797 3300009551 Bacteria 4313
62 Ga0105238_10190234 3300009551 Bacteria 2029
63 Ga0105246_10647049 3300011119 Bacteria 920
64 Ga0157373_10374856 3300013100 Bacteria 1017
65 Ga0157375_10351893 3300013308 Bacteria 1639
66 Ga0157375_11672591 3300013308 Bacteria 753
67 Ga0163163_10115567 3300014325 Bacteria 2714
68 Ga0157379_10080190 3300014968 Bacteria 2924
69 Ga0157376_10816822 3300014969 Bacteria 946
70 Ga0214544_1000053 3300021320 Bacteria 133908
71 Ga0214542_1000058 3300021321 Bacteria 133923
72 Ga0214545_1000026 3300021324 Bacteria 133811
73 Ga0214543_1002325 3300021327 Bacteria 37311
74 Ga0214543_1031901 3300021327 Bacteria 2049
75 Ga0213875_10000277 3300021388 Bacteria 50402
76 Ga0213875_10006066 3300021388 Bacteria 6392
77 Ga0207425_1000084 3300025245 Bacteria 95660
78 Ga0209026_1000810 3300025250 Bacteria 16835
79 Ga0209129_1000057 3300025258 Bacteria 253632
80 Ga0209675_1004241 3300025291 Bacteria 6461
81 Ga0209676_1001450 3300025292 Bacteria 22321
82 Ga0209676_1001542 3300025292 Bacteria 20780
83 Ga0209676_1001683 3300025292 Bacteria 19166
84 Ga0209676_1010153 3300025292 Bacteria 3964
85 Ga0209025_1000013 3300025294 Bacteria 871757
86 Ga0209025_1001430 3300025294 Bacteria 31500
87 Ga0209025_1052138 3300025294 Bacteria 1618
88 Ga0209564_1005701 3300025295 Bacteria 6979
89 Ga0209758_1000011 3300025297 Bacteria 1049685
90 Ga0209758_1000014 3300025297 Bacteria 871757
91 Ga0209758_1001336 3300025297 Bacteria 29877
92 Ga0209758_1055820 3300025297 Bacteria 1338
93 Ga0209050_1004674 3300025298 Bacteria 9100
94 Ga0209256_1000390 3300025299 Bacteria 69705
95 Ga0209256_1006774 3300025299 Bacteria 5918
96 Ga0209257_1000158 3300025304 Bacteria 180079
97 Ga0209257_1000261 3300025304 Bacteria 121357
98 Ga0209257_1000548 3300025304 Bacteria 64548
99 Ga0209257_1000722 3300025304 Bacteria 50449
100 Ga0209257_1000992 3300025304 Bacteria 38512
101 Ga0207656_10109585 3300025321 Bacteria 1274
102 Ga0207645_10043646 3300025907 Bacteria 2870
103 Ga0207645_10098089 3300025907 Bacteria 1889
104 Ga0207671_10001342 3300025914 Bacteria 28767
105 Ga0207681_10007519 3300025923 Bacteria 6675
106 Ga0207694_10118655 3300025924 Bacteria 2111
107 Ga0207650_10255655 3300025925 Bacteria 1420
108 Ga0207706_10001826 3300025933 Bacteria 20905
109 Ga0207706_10017815 3300025933 Bacteria 6398
110 Ga0207706_10155708 3300025933 Bacteria 2010
111 Ga0207668_10000003 3300025972 Bacteria 206959
112 Ga0207668_10027251 3300025972 Bacteria 3721
113 Ga0207640_10169495 3300025981 Bacteria 1625
114 Ga0207658_10000461 3300025986 Bacteria 38068
115 Ga0207658_10117312 3300025986 Bacteria 2115
116 Ga0207639_10008346 3300026041 Bacteria 7099
117 Ga0207641_10001168 3300026088 Bacteria 26436
118 Ga0207641_10007038 3300026088 Bacteria 9399
119 Ga0207641_10366217 3300026088 Bacteria 1377
120 Ga0207648_10145298 3300026089 Bacteria 2092
121 Ga0207676_10009707 3300026095 Bacteria 6843
122 Ga0207674_10004358 3300026116 Bacteria 17072
123 Ga0268266_10000221 3300028379 Bacteria 99332
124 Ga0268265_10002993 3300028380 Bacteria 12341
125 Ga0268264_10215714 3300028381 Bacteria 1764
126 Ga0307515_10527577 3300028794 Bacteria 790
127 Ga0307511_10021213 3300030521 Bacteria 6128
128 Ga0307513_10114043 3300031456 Bacteria 2689
129 Ga0307405_10141528 3300031731 Bacteria 1678
130 Ga0307413_10650261 3300031824 Bacteria 869
131 Ga0307412_10138753 3300031911 Bacteria 1777
132 Ga0307409_100037953 3300031995 Bacteria 3557
133 Ga0307409_100128201 3300031995 Bacteria 2163
134 Ga0307414_10002365 3300032004 Bacteria 9861
135 Ga0307510_10006520 3300033180 Bacteria 13915
136 Ga0395899_0192330 3300037312 Bacteria 1427
137 Ga0395900_0433349 3300037418 Bacteria 1273
138 Ga0395900_0569581 3300037418 Bacteria 1075
139 Ga0395898_0061086 3300037466 Bacteria 3661
140 Ga0395898_0163618 3300037466 Bacteria 2128
141 Ga0395898_0171156 3300037466 Bacteria 2076
142 Ga0395898_0216384 3300037466 Bacteria 1827
143 Ga0395905_0011368 3300037471 Bacteria 8606
144 Ga0395905_0019366 3300037471 Bacteria 6451
145 Ga0395905_0035869 3300037471 Bacteria 4657
146 Ga0395905_0046819 3300037471 Bacteria 4055
147 Ga0395905_0090109 3300037471 Bacteria 2875
148 Ga0395905_0276696 3300037471 Bacteria 1564
149 Ga0436364_0540325 3300037853 Bacteria 24736
150 Ga0395901_0081658 3300038443 Bacteria 3376
151 Ga0395901_0105604 3300038443 Bacteria 2956
152 Ga0395901_0236849 3300038443 Bacteria 1905
153 Ga0395901_0539631 3300038443 Bacteria 1183
154 Ga0395901_0857851 3300038443 Bacteria 893
155 Ga0237819_00879 3300038705 Bacteria 9403
156 Ga0439439_0000979 3300041406 Bacteria 5349
157 Ga0439449_0003855 3300042007 Bacteria 5814
158 Ga0439455_0022623 3300042012 Bacteria 1508
159 Ga0466972_0083447 3300044658 Bacteria 1520
160 Ga0466965_0009568 3300044683 Bacteria 4505
161 Ga0466965_0112654 3300044683 Bacteria 1399
162 Ga0466964_0039895 3300044706 Bacteria 1893
163 Ga0466968_0027209 3300044735 Bacteria 2352
164 Ga0466970_0123600 3300044765 Bacteria 1418
165 Ga0466957_0061364 3300044842 Bacteria 2307
166 Ga0495590_0001116 3300046457 Bacteria 11761
167 Ga0495638_0063037 3300046460 Bacteria 2287
168 Ga0495605_0000262 3300046474 Bacteria 61506
169 Ga0495605_0049649 3300046474 Bacteria 2049
170 Ga0495584_0002723 3300046491 Bacteria 9914
171 Ga0495585_0147874 3300046492 Bacteria 1227
172 Ga0495607_0000755 3300046501 Bacteria 30989
173 Ga0495607_0002324 3300046501 Bacteria 15582
174 Ga0495607_0004034 3300046501 Bacteria 11007
175 Ga0495583_0018478 3300046506 Bacteria 3669
176 Ga0495606_0000755 3300046507 Bacteria 49730
177 Ga0495606_0041394 3300046507 Bacteria 3090
178 Ga0495606_0046636 3300046507 Bacteria 2863
179 Ga0495610_0000044 3300046512 Bacteria 156847
180 Ga0495610_0105988 3300046512 Bacteria 1252
181 Ga0495616_0044807 3300046513 Bacteria 2242
182 Ga0495631_0000736 3300046518 Bacteria 21044
183 Ga0495631_0099465 3300046518 Bacteria 1252
184 Ga0495637_0016688 3300046520 Bacteria 3431
185 Ga0495643_0000829 3300046522 Bacteria 33683
186 Ga0495643_0084625 3300046522 Bacteria 1645
187 Ga0495663_0033626 3300046525 Bacteria 1532
188 Ga0495642_0016888 3300046528 Bacteria 2848
189 Ga0495654_0121336 3300046530 Bacteria 1183
190 Ga0495609_0000001 3300046538 Bacteria 1060094
191 Ga0495609_0012117 3300046538 Bacteria 4094
192 Ga0495609_0089277 3300046538 Bacteria 1341
193 Ga0495609_0102105 3300046538 Bacteria 1242
194 Ga0495609_0228162 3300046538 Bacteria 772
195 Ga0495656_0035209 3300046615 Bacteria 2056
196 Ga0495656_0374330 3300046615 Bacteria 741
197 Ga0495668_0000105 3300046616 Bacteria 133981
198 Ga0495668_0004064 3300046616 Bacteria 10622
199 Ga0495625_0030959 3300046660 Bacteria 3985
200 Ga0495661_0000063 3300046665 Bacteria 129706
201 Ga0495661_0005421 3300046665 Bacteria 9062
202 Ga0495661_0015535 3300046665 Bacteria 5080
203 Ga0495661_0020543 3300046665 Bacteria 4309
204 Ga0495661_0024159 3300046665 Bacteria 3935
205 Ga0495661_0041944 3300046665 Bacteria 2826
206 Ga0495661_0104814 3300046665 Bacteria 1585
207 Ga0495588_0000052 3300046674 Bacteria 304493
208 Ga0495671_0101254 3300046692 Bacteria 1408
209 Ga0495649_0161217 3300046694 Bacteria 1176
210 Ga0495589_0000015 3300046794 Bacteria 224112
211 Ga0495589_0000116 3300046794 Bacteria 75640
212 Ga0495660_0000053 3300046810 Bacteria 137479
213 Ga0495660_0000145 3300046810 Bacteria 76912
214 Ga0495636_0007520 3300047318 Bacteria 4287
215 Ga0495636_0017558 3300047318 Bacteria 2865
216 Ga0495672_0045268 3300047320 Bacteria 2634
217 Ga0495683_0191904 3300047323 Bacteria 926
218 Ga0495687_000003 3300047443 Bacteria 859509
219 Ga0495687_000073 3300047443 Bacteria 155429
220 Ga0495687_000635 3300047443 Bacteria 40213
221 Ga0495677_0000001 3300047445 Bacteria 715000
222 Ga0495677_0049742 3300047445 Bacteria 1541
223 Ga0495681_0000014 3300047470 Bacteria 184395
224 Ga0495681_0007140 3300047470 Bacteria 7192
225 Ga0495686_0000360 3300047472 Bacteria 73639
226 Ga0495686_0009007 3300047472 Bacteria 7242
227 Ga0495686_0010477 3300047472 Bacteria 6589
228 Ga0495626_0000128 3300048091 Bacteria 96772
229 Ga0495626_0000171 3300048091 Bacteria 80200
230 Ga0495626_0002167 3300048091 Bacteria 14138
231 Ga0496100_0556147 3300048903 Bacteria 888
232 Ga0496102_0179032 3300048905 Bacteria 1997
233 Ga0496106_0012069 3300048909 Bacteria 6375
234 Ga0496110_0852329 3300048913 Bacteria 817
235 Ga0496113_0185506 3300048916 Bacteria 1650
236 Ga0496113_0397828 3300048916 Bacteria 1106
237 Ga0496121_0097509 3300048924 Bacteria 2278
238 Ga0496122_0005139 3300048925 Bacteria 15785
239 Ga0496123_0005726 3300048926 Bacteria 12379
240 Ga0496124_0060902 3300048927 Bacteria 3165
241 Ga0496124_0062230 3300048927 Bacteria 3124
242 Ga0496124_0227535 3300048927 Bacteria 1397
243 Ga0496126_0018554 3300048929 Bacteria 6888
244 Ga0496126_0091169 3300048929 Bacteria 2680
245 Ga0495682_0042057 3300049460 Bacteria 1675
246 Ga0501033_0014464 3300049570 Bacteria 5991
247 Ga0501034_0057373 3300049571 Bacteria 3915
248 Ga0501034_0081475 3300049571 Bacteria 3239
249 Ga0501037_0196568 3300049573 Bacteria 1426
250 Ga0501043_0018080 3300049579 Bacteria 5528
251 Ga0501047_0050004 3300049581 Bacteria 4036
252 Ga0501035_0457819 3300049822 Bacteria 1055
253 Ga0501044_0041926 3300049823 Bacteria 4764
254 nmdc:mga03683_81178_c1 3300050489 Bacteria 1400
255 nmdc:mga07m45_76591_c1 3300050496 Bacteria 1907
256 nmdc:mga0sz30_65543_c1 3300050516 Bacteria 1557
257 Ga0500643_000200 3300053087 Bacteria 57070
258 Ga0500644_0134690 3300053088 Bacteria 976
259 Ga0500566_0024157 3300053094 Bacteria 3570
260 Ga0500641_0215806 3300053096 Bacteria 815
261 Ga0500557_000106 3300053105 Bacteria 25501
262 Ga0500562_003110 3300053108 Bacteria 4142
263 Ga0500592_000841 3300053116 Bacteria 5013
264 Ga0500592_038495 3300053116 Bacteria 773
265 Ga0500618_001016 3300053125 Bacteria 14104
266 Ga0500642_0000068 3300053130 Bacteria 56277
267 Ga0500568_0014887 3300053139 Bacteria 3497
268 Ga0500622_0008671 3300053156 Bacteria 5672
269 Ga0500627_0000008 3300053158 Bacteria 161914
270 Ga0500636_0150972 3300053177 Bacteria 1276
271 Ga0500625_032863 3300053729 Bacteria 2463
272 2513876814 2513237139 Bacteria 8737671
273 2514012148 2513237161 Bacteria 8871253
274 2517107407 2517093001 Bacteria 9002274
275 2547499905 2547132130 Bacteria 4660562
276 2547501663 2547132130 Bacteria 4660562
277 2643797291 2643221556 Bacteria 7251154
278 2643815927 2643221559 Bacteria 4424915
279 2643929370 2643221584 Bacteria 5511711
280 2643940616 2643221586 Bacteria 4446529
281 2644076835 2643221612 Bacteria 4361984
282 2644474167 2643221684 Bacteria 7145183
283 2644695149 2643221727 Bacteria 4415595
284 2735834995 2734482264 Unclassified 5014763
285 2792459214 2791355048 Bacteria 5832535
286 2793064399 2791355196 Bacteria 7323613
287 2805918794 2802429603 Bacteria 8777136
288 2824673954 2824671348 Bacteria 8369588
289 2824681703 2824679649 Bacteria 8248951
290 2824690598 2824687955 Bacteria 8360029
291 2824698119 2824696289 Bacteria 8335049
292 2824736653 2824732956 Bacteria 7810675
293 2824746393 2824746037 Bacteria 7911610
294 2824776170 2824773399 Bacteria 8360218
295 2838126972 2838122688 Bacteria 8803140
296 2841945548 2841941048 Bacteria 8688029
297 2841954764 2841949485 Bacteria 8680857
298 2841965858 2841957949 Bacteria 8652217
299 2841972451 2841966195 Bacteria 8673214
300 2841980535 2841974524 Bacteria 8931498
301 2841988706 2841983080 Bacteria 8395090
302 2842044995 2842038055 Bacteria 8002051
303 2842052819 2842045827 Bacteria 8006841
304 2842392241 2842391507 Bacteria 4486072
305 2843744863 2843744320 Bacteria 5659202
306 2847940023 2847939898 Bacteria 8606328
307 2849563614 2849560528 Bacteria 5393480
308 2851154668 2851153111 Bacteria 5542585
309 2855769799 2855767633 Bacteria 7049357
310 2857507782 2857504554 Bacteria 5369913
311 2874625893 2874620515 Bacteria 8290088
312 2885368500 2885366525 Bacteria 8326213
313 2904673747 2904666416 Bacteria 8226587
314 2908782247 2908775508 Bacteria 8092255
315 2919135972 2919134579 Bacteria 4480386
316 2922364692 2922361189 Bacteria 7436256
317 2922399898 2922393267 Bacteria 8285685
318 2935770974 2935769743 Bacteria 7878163
319 2935781141 2935777560 Bacteria 8077691
320 2935786325 2935785616 Bacteria 7962367
321 2935793878 2935793552 Bacteria 8012592
322 2935823658 2935819856 Bacteria 8261050
323 2989776660 2989771324 Bacteria 5605128
324 3005488379 3005483717 Bacteria 7877331
325 3005512607 3005506211 Bacteria 6943378
326 8016527942 8016522445 Bacteria 8156687
327 8016533065 8016530956 Bacteria 8155261
328 8016555830 8016548790 Bacteria 8155074
329 8016571376 8016566248 Bacteria 8158151
330 8016583849 8016575299 Bacteria 8154085
331 8016601879 8016595262 Bacteria 8149947
332 8016608367 8016603502 Bacteria 8731218
333 8016616496 8016613128 Bacteria 8794220
334 8016624641 8016622563 Bacteria 7999408
335 8019532864 8019530166 Bacteria 8155624
336 8019546986 8019538911 Bacteria 7872763
337 8019551682 8019547302 Bacteria 7996444
338 8019667757 8019659431 Bacteria 8577854
339 Ga0055536_1030821
340 SwRhRL2b_contig_351495
341 JGI24739J22299_10001789
342 JGI25152J39213_1000041
343 JGI25150J39212_1000399
344 JGI25151J46595_10000141
345 JGI25151J46595_10016352
346 JGI25153J46596_10000106
347 JGI25153J46596_10000560
348 JGI25153J46596_10000694
349 Ga0055536_1000456
350 Ga0055531_10000852
351 Ga0055531_10003523
352 Ga0055531_10003731
353 Ga0055531_10012031
354 Ga0065165_1000864
355 Ga0065165_1004598
356 Ga0065165_1011293
357 Ga0065704_10092405
358 Ga0065707_10089354
359 Ga0070676_10328929
360 Ga0070668_100007720
361 Ga0070668_100037908
362 Ga0070668_100049941
363 Ga0070669_100043761
364 Ga0070667_100000112
365 Ga0070667_100001643
366 Ga0070667_100036898
367 Ga0070663_100255254
368 Ga0070662_100006066
369 Ga0070662_100055672
370 Ga0068867_100365110
371 Ga0068853_100005904
372 Ga0068853_100702205
373 Ga0070665_100001353
374 Ga0068857_100072892
375 Ga0068854_100093128
376 Ga0068854_100141812
377 Ga0068859_100001917
378 Ga0068859_100762634
379 Ga0068864_100004466
380 Ga0068863_100000400
381 Ga0068863_100020630
382 Ga0068863_100404250
383 Ga0068860_100025171
384 Ga0068860_100055883
385 Ga0081455_10000121
386 Ga0081455_10025329
387 Ga0081540_1023941
388 Ga0075365_10118995
389 Ga0075365_10289302
390 Ga0075432_10008461
391 Ga0075362_10030152
392 Ga0075369_10067009
393 Ga0075370_10026084
394 Ga0097620_100001917
395 Ga0097620_100762601
396 Ga0105248_10002303
397 Ga0105248_10376366
398 Ga0105248_11025467
399 Ga0105238_10047797
400 Ga0105238_10190234
401 Ga0105246_10647049
402 Ga0157373_10374856
403 Ga0157375_10351893
404 Ga0157375_11672591
405 Ga0163163_10115567
406 Ga0157379_10080190
407 Ga0157376_10816822
408 Ga0214544_1000053
409 Ga0214542_1000058
410 Ga0214545_1000026
411 Ga0214543_1002325
412 Ga0214543_1031901
413 Ga0213875_10000277
414 Ga0213875_10006066
415 Ga0207425_1000084
416 Ga0209026_1000810
417 Ga0209129_1000057
418 Ga0209675_1004241
419 Ga0209676_1001450
420 Ga0209676_1001542
421 Ga0209676_1001683
422 Ga0209676_1010153
423 Ga0209025_1000013
424 Ga0209025_1001430
425 Ga0209025_1052138
426 Ga0209564_1005701
427 Ga0209758_1000011
428 Ga0209758_1000014
429 Ga0209758_1001336
430 Ga0209758_1055820
431 Ga0209050_1004674
432 Ga0209256_1000390
433 Ga0209256_1006774
434 Ga0209257_1000158
435 Ga0209257_1000261
436 Ga0209257_1000548
437 Ga0209257_1000722
438 Ga0209257_1000992
439 Ga0207656_10109585
440 Ga0207645_10043646
441 Ga0207645_10098089
442 Ga0207671_10001342
443 Ga0207681_10007519
444 Ga0207694_10118655
445 Ga0207650_10255655
446 Ga0207706_10001826
447 Ga0207706_10017815
448 Ga0207706_10155708
449 Ga0207668_10000003
450 Ga0207668_10027251
451 Ga0207640_10169495
452 Ga0207658_10000461
453 Ga0207658_10117312
454 Ga0207639_10008346
455 Ga0207641_10001168
456 Ga0207641_10007038
457 Ga0207641_10366217
458 Ga0207648_10145298
459 Ga0207676_10009707
460 Ga0207674_10004358
461 Ga0268266_10000221
462 Ga0268265_10002993
463 Ga0268264_10215714
464 Ga0307515_10527577
465 Ga0307511_10021213
466 Ga0307513_10114043
467 Ga0307405_10141528
468 Ga0307413_10650261
469 Ga0307412_10138753
470 Ga0307409_100037953
471 Ga0307409_100128201
472 Ga0307414_10002365
473 Ga0307510_10006520
474 Ga0395899_0192330
475 Ga0395900_0433349
476 Ga0395900_0569581
477 Ga0395898_0061086
478 Ga0395898_0163618
479 Ga0395898_0171156
480 Ga0395898_0216384
481 Ga0395905_0011368
482 Ga0395905_0019366
483 Ga0395905_0035869
484 Ga0395905_0046819
485 Ga0395905_0090109
486 Ga0395905_0276696
487 Ga0436364_0540325
488 Ga0395901_0081658
489 Ga0395901_0105604
490 Ga0395901_0236849
491 Ga0395901_0539631
492 Ga0395901_0857851
493 Ga0237819_00879
494 Ga0439439_0000979
495 Ga0439449_0003855
496 Ga0439455_0022623
497 Ga0466972_0083447
498 Ga0466965_0009568
499 Ga0466965_0112654
500 Ga0466964_0039895
501 Ga0466968_0027209
502 Ga0466970_0123600
503 Ga0466957_0061364
504 Ga0495590_0001116
505 Ga0495638_0063037
506 Ga0495605_0000262
507 Ga0495605_0049649
508 Ga0495584_0002723
509 Ga0495585_0147874
510 Ga0495607_0000755
511 Ga0495607_0002324
512 Ga0495607_0004034
513 Ga0495583_0018478
514 Ga0495606_0000755
515 Ga0495606_0041394
516 Ga0495606_0046636
517 Ga0495610_0000044
518 Ga0495610_0105988
519 Ga0495616_0044807
520 Ga0495631_0000736
521 Ga0495631_0099465
522 Ga0495637_0016688
523 Ga0495643_0000829
524 Ga0495643_0084625
525 Ga0495663_0033626
526 Ga0495642_0016888
527 Ga0495654_0121336
528 Ga0495609_0000001
529 Ga0495609_0012117
530 Ga0495609_0089277
531 Ga0495609_0102105
532 Ga0495609_0228162
533 Ga0495656_0035209
534 Ga0495656_0374330
535 Ga0495668_0000105
536 Ga0495668_0004064
537 Ga0495625_0030959
538 Ga0495661_0000063
539 Ga0495661_0005421
540 Ga0495661_0015535
541 Ga0495661_0020543
542 Ga0495661_0024159
543 Ga0495661_0041944
544 Ga0495661_0104814
545 Ga0495588_0000052
546 Ga0495671_0101254
547 Ga0495649_0161217
548 Ga0495589_0000015
549 Ga0495589_0000116
550 Ga0495660_0000053
551 Ga0495660_0000145
552 Ga0495636_0007520
553 Ga0495636_0017558
554 Ga0495672_0045268
555 Ga0495683_0191904
556 Ga0495687_000003
557 Ga0495687_000073
558 Ga0495687_000635
559 Ga0495677_0000001
560 Ga0495677_0049742
561 Ga0495681_0000014
562 Ga0495681_0007140
563 Ga0495686_0000360
564 Ga0495686_0009007
565 Ga0495686_0010477
566 Ga0495626_0000128
567 Ga0495626_0000171
568 Ga0495626_0002167
569 Ga0496100_0556147
570 Ga0496102_0179032
571 Ga0496106_0012069
572 Ga0496110_0852329
573 Ga0496113_0185506
574 Ga0496113_0397828
575 Ga0496121_0097509
576 Ga0496122_0005139
577 Ga0496123_0005726
578 Ga0496124_0060902
579 Ga0496124_0062230
580 Ga0496124_0227535
581 Ga0496126_0018554
582 Ga0496126_0091169
583 Ga0495682_0042057
584 Ga0501033_0014464
585 Ga0501034_0057373
586 Ga0501034_0081475
587 Ga0501037_0196568
588 Ga0501043_0018080
589 Ga0501047_0050004
590 Ga0501035_0457819
591 Ga0501044_0041926
592 nmdc:mga03683_81178_c1
593 nmdc:mga07m45_76591_c1
594 nmdc:mga0sz30_65543_c1
595 Ga0500643_000200
596 Ga0500644_0134690
597 Ga0500566_0024157
598 Ga0500641_0215806
599 Ga0500557_000106
600 Ga0500562_003110
601 Ga0500592_000841
602 Ga0500592_038495
603 Ga0500618_001016
604 Ga0500642_0000068
605 Ga0500568_0014887
606 Ga0500622_0008671
607 Ga0500627_0000008
608 Ga0500636_0150972
609 Ga0500625_032863
610 2513876814
611 2514012148
612 2517107407
613 2547499905
614 2547501663
615 2643797291
616 2643815927
617 2643929370
618 2643940616
619 2644076835
620 2644474167
621 2644695149
622 2735834995
623 2792459214
624 2793064399
625 2805918794
626 2824673954
627 2824681703
628 2824690598
629 2824698119
630 2824736653
631 2824746393
632 2824776170
633 2838126972
634 2841945548
635 2841954764
636 2841965858
637 2841972451
638 2841980535
639 2841988706
640 2842044995
641 2842052819
642 2842392241
643 2843744863
644 2847940023
645 2849563614
646 2851154668
647 2855769799
648 2857507782
649 2874625893
650 2885368500
651 2904673747
652 2908782247
653 2919135972
654 2922364692
655 2922399898
656 2935770974
657 2935781141
658 2935786325
659 2935793878
660 2935823658
661 2989776660
662 3005488379
663 3005512607
664 8016527942
665 8016533065
666 8016555830
667 8016571376
668 8016583849
669 8016601879
670 8016608367
671 8016616496
672 8016624641
673 8019532864
674 8019546986
675 8019551682
676 8019667757

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

157

245

0.96

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

89

156

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9759 43 208
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.9437 42 208
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9424 44 208
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.939 44 208
5g5h-assembly1.cif.gz_A escherichia coli periplasmic aldehyde oxidase r440h mutant 0.9318 43 208
ID Description Score Start End Superfamily
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9787 120 208 1.10.150.120
5g5hA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9681 120 208 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9489 43 118 3.10.20.30
1n5wA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9383 44 118 3.10.20.30
1sb3F01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9359 43 118 3.10.20.30
ID Description Score Start End GO Terms
AF-G1Y0K1-F1-model_v4 deleted 0.983 43 211
AF-K2Q1H9-F1-model_v4 Oxidoreductase with iron-sulfur subunit 0.9812 43 208 GO:0016903
GO:0042597
GO:0046872
GO:0051537
AF-G9ZZ75-F1-model_v4 2Fe-2S iron-sulfur cluster-binding domain protein 0.9799 44 208 GO:0016903
GO:0042597
GO:0046872
GO:0051537
AF-A0A504TQJ7-F1-model_v4 Aldehyde dehydrogenase iron-sulfur subunit (EC 1.2.99.6) 0.9797 42 211 GO:0042597
GO:0046872
GO:0047770
GO:0051537
AF-A0A7W3ECA7-F1-model_v4 Aldehyde dehydrogenase iron-sulfur subunit (EC 1.2.99.6) 0.9789 43 208 GO:0042597
GO:0046872
GO:0047770
GO:0051537

Map