F413372

General Info

Members Datasets Scaffolds Average Seq Length
338 191 676 112

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100013446|Ga0068869_1000134462
Length 127
Sequence MPVFFLQLHLQPKRESMYKLKINFEEKGVAPVTFENLEPNQTLLEICLKNDIELHHNCGGVCACTTCHLYIDKGMDSIDEITDKEEDFIDRAVNPRLSSRLGCQSLLLDGDGEIEITLPDQTQFLGE

Samples

Sample ID Description Type Environment
1 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
137 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
138 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
139 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
140 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
143 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
144 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
145 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
146 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
147 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
148 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
184 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
187 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 2839989709 Pontibacter arcticus 2b14 Isolate Unclassified
191 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0
Isolates 0.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 0.59
Rhizosphere 95.27
Stem 0
Stem Tuber 0
Unclassified 24.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068869_100013446 3300005334 Bacteria 5445
2 JGI24751J29686_10004241 3300002459 Bacteria 2909
3 JGI25157J39369_1014248 3300002741 Bacteria 990
4 Ga0065714_10303813 3300005288 Bacteria 690
5 Ga0065704_10388427 3300005289 Unclassified 765
6 Ga0065712_10084512 3300005290 Unclassified 2758
7 Ga0065715_10039073 3300005293 Bacteria 1100
8 Ga0065715_10468693 3300005293 Bacteria 808
9 Ga0070683_100670415 3300005329 Bacteria 993
10 Ga0070690_100686952 3300005330 Bacteria 785
11 Ga0070670_100037560 3300005331 Bacteria 4167
12 Ga0070670_100489105 3300005331 Bacteria 1093
13 Ga0070670_101258709 3300005331 Bacteria 677
14 Ga0070670_101783565 3300005331 Bacteria 566
15 Ga0070670_101829273 3300005331 Bacteria 559
16 Ga0068869_100846781 3300005334 Bacteria 789
17 Ga0068869_101132704 3300005334 Bacteria 685
18 Ga0070666_10494516 3300005335 Bacteria 886
19 Ga0068868_100152036 3300005338 Bacteria 1906
20 Ga0070689_100044909 3300005340 Bacteria 3400
21 Ga0070689_100153792 3300005340 Bacteria 1856
22 Ga0070687_100280320 3300005343 Unclassified 1049
23 Ga0070687_101342622 3300005343 Unclassified 532
24 Ga0070661_101776071 3300005344 Bacteria 523
25 Ga0070668_100169244 3300005347 Bacteria 1778
26 Ga0070668_100412062 3300005347 Bacteria 1156
27 Ga0070668_100608273 3300005347 Unclassified 957
28 Ga0070669_100046507 3300005353 Bacteria 3165
29 Ga0070669_100469571 3300005353 Bacteria 1039
30 Ga0070669_101339046 3300005353 Unclassified 620
31 Ga0070675_101400897 3300005354 Bacteria 644
32 Ga0070675_101452117 3300005354 Bacteria 632
33 Ga0070671_101244359 3300005355 Bacteria 656
34 Ga0070674_100856747 3300005356 Bacteria 788
35 Ga0070673_100078786 3300005364 Bacteria 2666
36 Ga0070673_100552612 3300005364 Bacteria 1046
37 Ga0070688_100049396 3300005365 Bacteria 2617
38 Ga0070667_101976847 3300005367 Bacteria 549
39 Ga0070700_100128366 3300005441 Bacteria 1708
40 Ga0070694_101697218 3300005444 Unclassified 537
41 Ga0070678_100593199 3300005456 Bacteria 988
42 Ga0070678_101538095 3300005456 Bacteria 624
43 Ga0068867_100434284 3300005459 Bacteria 1115
44 Ga0068867_100843090 3300005459 Bacteria 821
45 Ga0068867_100849793 3300005459 Unclassified 818
46 Ga0068867_101039610 3300005459 Bacteria 745
47 Ga0068867_101522298 3300005459 Unclassified 623
48 Ga0070685_10137649 3300005466 Bacteria 1533
49 Ga0070685_10282194 3300005466 Bacteria 1112
50 Ga0070685_10330224 3300005466 Bacteria 1036
51 Ga0070706_101531506 3300005467 Bacteria 609
52 Ga0070698_100001455 3300005471 Bacteria 26296
53 Ga0070698_100002086 3300005471 Bacteria 22201
54 Ga0068853_100008858 3300005539 Bacteria 8097
55 Ga0068853_100700424 3300005539 Bacteria 966
56 Ga0070672_100150532 3300005543 Bacteria 1925
57 Ga0070672_100330906 3300005543 Unclassified 1296
58 Ga0070672_101314866 3300005543 Unclassified 646
59 Ga0070686_100346008 3300005544 Bacteria 1115
60 Ga0070695_100885563 3300005545 Bacteria 720
61 Ga0070693_100297682 3300005547 Bacteria 1086
62 Ga0070664_101810890 3300005564 Unclassified 579
63 Ga0070664_102203168 3300005564 Bacteria 523
64 Ga0068857_100045001 3300005577 Bacteria 3915
65 Ga0070702_100958872 3300005615 Bacteria 674
66 Ga0068852_100406273 3300005616 Bacteria 1340
67 Ga0068859_100097843 3300005617 Unclassified 2988
68 Ga0068859_100172006 3300005617 Unclassified 2247
69 Ga0068859_100323343 3300005617 Unclassified 1636
70 Ga0068859_100383627 3300005617 Bacteria 1501
71 Ga0068864_100135085 3300005618 Bacteria 2220
72 Ga0068864_100216431 3300005618 Bacteria 1766
73 Ga0068864_100385192 3300005618 Bacteria 1329
74 Ga0068864_101497575 3300005618 Unclassified 678
75 Ga0068864_102458130 3300005618 Bacteria 527
76 Ga0068861_100062234 3300005719 Bacteria 2866
77 Ga0068861_100143337 3300005719 Bacteria 1952
78 Ga0068861_100838284 3300005719 Unclassified 866
79 Ga0068851_10047674 3300005834 Bacteria 2170
80 Ga0068870_10011641 3300005840 Unclassified 4087
81 Ga0068870_10897803 3300005840 Bacteria 626
82 Ga0068863_100258983 3300005841 Bacteria 1681
83 Ga0068863_100262375 3300005841 Bacteria 1670
84 Ga0068863_101136145 3300005841 Bacteria 786
85 Ga0068863_101385571 3300005841 Archaea 711
86 Ga0068863_102318613 3300005841 Bacteria 546
87 Ga0068858_100116672 3300005842 Bacteria 2495
88 Ga0068860_100206522 3300005843 Bacteria 1905
89 Ga0068860_100610493 3300005843 Unclassified 1097
90 Ga0068860_100698687 3300005843 Unclassified 1024
91 Ga0068862_101132194 3300005844 Bacteria 779
92 Ga0075366_10567027 3300006195 Unclassified 703
93 Ga0097621_100324629 3300006237 Bacteria 1364
94 Ga0068871_100171713 3300006358 Bacteria 1859
95 Ga0068871_100280120 3300006358 Bacteria 1458
96 Ga0075428_100001878 3300006844 Bacteria 22540
97 Ga0075428_100061237 3300006844 Bacteria 4121
98 Ga0075430_100095144 3300006846 Bacteria 2490
99 Ga0075431_100307378 3300006847 Bacteria 1601
100 Ga0075429_100001931 3300006880 Bacteria 17186
101 Ga0075429_100052501 3300006880 Bacteria 3547
102 Ga0068865_101577525 3300006881 Unclassified 590
103 Ga0068865_101747389 3300006881 Bacteria 561
104 Ga0097620_100097845 3300006931 Unclassified 2988
105 Ga0097620_100172008 3300006931 Unclassified 2247
106 Ga0097620_100323345 3300006931 Unclassified 1636
107 Ga0097620_100383630 3300006931 Bacteria 1501
108 Ga0111539_10167394 3300009094 Bacteria 2569
109 Ga0111539_10579674 3300009094 Unclassified 1307
110 Ga0111539_10930513 3300009094 Unclassified 1011
111 Ga0105245_10418825 3300009098 Bacteria 1342
112 Ga0105247_10009905 3300009101 Bacteria 5774
113 Ga0105247_10941546 3300009101 Unclassified 670
114 Ga0114129_10062503 3300009147 Bacteria 5201
115 Ga0114129_10263410 3300009147 Unclassified 2309
116 Ga0105243_10440189 3300009148 Unclassified 1220
117 Ga0105242_10008224 3300009176 Bacteria 8016
118 Ga0105242_10014405 3300009176 Bacteria 6127
119 Ga0105242_10016179 3300009176 Bacteria 5794
120 Ga0105242_11232207 3300009176 Bacteria 769
121 Ga0105248_10164302 3300009177 Bacteria 2503
122 Ga0105249_10000611 3300009553 Bacteria 32583
123 Ga0105249_10001393 3300009553 Bacteria 21161
124 Ga0105249_10031748 3300009553 Unclassified 4778
125 Ga0105249_10075099 3300009553 Bacteria 3130
126 Ga0105249_10100046 3300009553 Unclassified 2726
127 Ga0105249_10397091 3300009553 Unclassified 1408
128 Ga0105249_10756917 3300009553 Bacteria 1034
129 Ga0105249_10944751 3300009553 Unclassified 930
130 Ga0105249_11381858 3300009553 Bacteria 776
131 Ga0105246_10408702 3300011119 Unclassified 1129
132 Ga0157373_10666629 3300013100 Bacteria 760
133 Ga0157371_10039559 3300013102 Bacteria 3372
134 Ga0157371_10314641 3300013102 Unclassified 1135
135 Ga0157370_10387087 3300013104 Bacteria 1288
136 Ga0157369_10126651 3300013105 Unclassified 2707
137 Ga0157369_11424192 3300013105 Unclassified 705
138 Ga0157369_12392917 3300013105 Unclassified 535
139 Ga0157374_12380073 3300013296 Unclassified 557
140 Ga0157378_10425351 3300013297 Bacteria 1313
141 Ga0157378_12234622 3300013297 Bacteria 598
142 Ga0157378_12650583 3300013297 Unclassified 554
143 Ga0157378_12822782 3300013297 Unclassified 538
144 Ga0163162_11360414 3300013306 Bacteria 807
145 Ga0163162_12109917 3300013306 Unclassified 646
146 Ga0163162_12469828 3300013306 Unclassified 597
147 Ga0157372_10233696 3300013307 Bacteria 2132
148 Ga0157372_10538220 3300013307 Bacteria 1362
149 Ga0157372_11701141 3300013307 Bacteria 726
150 Ga0157375_10390972 3300013308 Bacteria 1557
151 Ga0157375_10964309 3300013308 Bacteria 994
152 Ga0157375_11988280 3300013308 Bacteria 691
153 Ga0157375_12370902 3300013308 Unclassified 633
154 Ga0163163_10244122 3300014325 Unclassified 1846
155 Ga0163163_10250732 3300014325 Unclassified 1821
156 Ga0163163_10639108 3300014325 Bacteria 1128
157 Ga0163163_11860881 3300014325 Bacteria 662
158 Ga0163163_12423628 3300014325 Bacteria 583
159 Ga0163163_13349801 3300014325 Bacteria 500
160 Ga0157380_10026841 3300014326 Bacteria 4375
161 Ga0157380_10513970 3300014326 Bacteria 1166
162 Ga0157380_10727187 3300014326 Bacteria 1001
163 Ga0157380_10826314 3300014326 Bacteria 946
164 Ga0157380_11937091 3300014326 Bacteria 650
165 Ga0157380_13120171 3300014326 Bacteria 529
166 Ga0157377_11326385 3300014745 Bacteria 564
167 Ga0157377_11669254 3300014745 Unclassified 513
168 Ga0157377_11756348 3300014745 Bacteria 502
169 Ga0157379_10295644 3300014968 Bacteria 1475
170 Ga0157376_10684397 3300014969 Unclassified 1029
171 Ga0163161_10199530 3300017792 Bacteria 1541
172 Ga0163161_10235991 3300017792 Unclassified 1421
173 Ga0163161_10834315 3300017792 Bacteria 777
174 Ga0207666_1040998 3300025271 Bacteria 724
175 Ga0209455_1019102 3300025272 Bacteria 1392
176 Ga0207697_10030666 3300025315 Bacteria 2200
177 Ga0207682_10040074 3300025893 Bacteria 1907
178 Ga0207710_10009414 3300025900 Bacteria 4111
179 Ga0207680_10610229 3300025903 Bacteria 780
180 Ga0207685_10041275 3300025905 Unclassified 1725
181 Ga0207645_10131578 3300025907 Bacteria 1628
182 Ga0207645_10212616 3300025907 Bacteria 1274
183 Ga0207645_10500300 3300025907 Bacteria 823
184 Ga0207643_10003695 3300025908 Bacteria 8233
185 Ga0207705_10382712 3300025909 Unclassified 1087
186 Ga0207684_11435056 3300025910 Bacteria 564
187 Ga0207662_10309557 3300025918 Bacteria 1052
188 Ga0207650_10006365 3300025925 Bacteria 8040
189 Ga0207650_10062814 3300025925 Bacteria 2775
190 Ga0207650_10583032 3300025925 Bacteria 939
191 Ga0207650_10595219 3300025925 Unclassified 930
192 Ga0207650_10954049 3300025925 Bacteria 729
193 Ga0207659_11384262 3300025926 Unclassified 603
194 Ga0207686_10002249 3300025934 Bacteria 10600
195 Ga0207686_10053869 3300025934 Bacteria 2517
196 Ga0207686_10147419 3300025934 Bacteria 1634
197 Ga0207709_10146280 3300025935 Unclassified 1631
198 Ga0207670_10081086 3300025936 Bacteria 2270
199 Ga0207669_10259144 3300025937 Bacteria 1300
200 Ga0207704_10018696 3300025938 Bacteria 3624
201 Ga0207691_10116141 3300025940 Bacteria 2375
202 Ga0207691_10421549 3300025940 Unclassified 1137
203 Ga0207689_10032640 3300025942 Bacteria 4329
204 Ga0207689_10063754 3300025942 Bacteria 3032
205 Ga0207689_11158559 3300025942 Unclassified 651
206 Ga0207661_11472060 3300025944 Bacteria 624
207 Ga0207661_11674333 3300025944 Bacteria 581
208 Ga0207679_11310999 3300025945 Bacteria 664
209 Ga0207651_10154937 3300025960 Bacteria 1788
210 Ga0207712_10003748 3300025961 Bacteria 9593
211 Ga0207712_10003945 3300025961 Bacteria 9373
212 Ga0207712_10247327 3300025961 Bacteria 1440
213 Ga0207712_10562743 3300025961 Bacteria 982
214 Ga0207712_10739269 3300025961 Unclassified 861
215 Ga0207712_11114452 3300025961 Bacteria 703
216 Ga0207712_11515870 3300025961 Unclassified 601
217 Ga0207712_11914947 3300025961 Bacteria 531
218 Ga0207668_10222044 3300025972 Bacteria 1518
219 Ga0207640_10847197 3300025981 Bacteria 795
220 Ga0207658_10905451 3300025986 Bacteria 803
221 Ga0207658_11144237 3300025986 Bacteria 711
222 Ga0207658_11708259 3300025986 Unclassified 575
223 Ga0207658_11954433 3300025986 Bacteria 534
224 Ga0207677_10425680 3300026023 Unclassified 1132
225 Ga0207677_10632819 3300026023 Bacteria 942
226 Ga0207703_10174992 3300026035 Bacteria 1890
227 Ga0207639_10419971 3300026041 Bacteria 1209
228 Ga0207708_10036076 3300026075 Bacteria 3763
229 Ga0207708_11064616 3300026075 Bacteria 704
230 Ga0207641_10000873 3300026088 Bacteria 31566
231 Ga0207641_10055829 3300026088 Bacteria 3354
232 Ga0207641_10240867 3300026088 Bacteria 1685
233 Ga0207641_10766910 3300026088 Bacteria 953
234 Ga0207641_11566667 3300026088 Unclassified 661
235 Ga0207641_11587473 3300026088 Bacteria 656
236 Ga0207648_10034852 3300026089 Bacteria 4437
237 Ga0207648_10058604 3300026089 Bacteria 3358
238 Ga0207648_10094820 3300026089 Bacteria 2610
239 Ga0207648_10513027 3300026089 Unclassified 1098
240 Ga0207648_11961674 3300026089 Bacteria 547
241 Ga0207676_10014462 3300026095 Bacteria 5680
242 Ga0207676_10426119 3300026095 Bacteria 1245
243 Ga0207674_10150353 3300026116 Bacteria 2286
244 Ga0207675_100017141 3300026118 Bacteria 6764
245 Ga0207675_100097037 3300026118 Bacteria 2775
246 Ga0207675_100800013 3300026118 Bacteria 956
247 Ga0207675_102746717 3300026118 Bacteria 500
248 Ga0207683_10098563 3300026121 Unclassified 2608
249 Ga0207698_10466460 3300026142 Bacteria 1222
250 Ga0207428_10085039 3300027907 Unclassified 2464
251 Ga0268265_10485013 3300028380 Unclassified 1162
252 Ga0268265_10845262 3300028380 Bacteria 895
253 Ga0268264_10533310 3300028381 Unclassified 1149
254 Ga0268264_11143985 3300028381 Unclassified 787
255 Ga0268264_11352695 3300028381 Bacteria 722
256 Ga0307515_10000001 3300028794 Bacteria 4259510
257 Ga0265327_10000906 3300031251 Bacteria 43527
258 Ga0307408_101535249 3300031548 Bacteria 631
259 Ga0307410_10828363 3300031852 Bacteria 789
260 Ga0307416_101508214 3300032002 Bacteria 778
261 Ga0307414_10204524 3300032004 Bacteria 1609
262 Ga0307414_10589533 3300032004 Bacteria 996
263 Ga0307415_100220637 3300032126 Bacteria 1520
264 Ga0307507_10345259 3300033179 Unclassified 879
265 Ga0373957_0433847 3300035120 Bacteria 568
266 Ga0395900_0045533 3300037418 Unclassified 4519
267 Ga0395905_0000527 3300037471 Bacteria 52435
268 Ga0395905_0127684 3300037471 Bacteria 2391
269 Ga0439439_0027945 3300041406 Bacteria 1427
270 Ga0439453_0139578 3300041408 Bacteria 568
271 Ga0451793_1365790 3300041452 Bacteria 836
272 Ga0451804_0685085 3300041463 Unclassified 735
273 Ga0451835_0610908 3300041492 Bacteria 1056
274 Ga0451837_0308600 3300041494 Unclassified 612
275 Ga0451841_0075618 3300041498 Bacteria 513
276 Ga0451853_1725440 3300041512 Bacteria 502
277 Ga0439431_0014969 3300041997 Bacteria 1802
278 Ga0439441_027666 3300042001 Bacteria 1083
279 Ga0439442_019238 3300042002 Bacteria 1413
280 Ga0439454_065522 3300042011 Bacteria 637
281 Ga0450898_025533 3300042134 Bacteria 1060
282 Ga0439434_0170207 3300042435 Bacteria 726
283 Ga0439435_0049992 3300042436 Bacteria 1194
284 Ga0453683_0664787 3300044673 Bacteria 681
285 Ga0453684_0092803 3300044712 Bacteria 3720
286 Ga0453684_0147846 3300044712 Bacteria 2796
287 Ga0453684_0258773 3300044712 Bacteria 1995
288 Ga0453684_1237266 3300044712 Bacteria 782
289 Ga0453684_1847344 3300044712 Bacteria 613
290 Ga0495594_0176498 3300046499 Bacteria 1216
291 Ga0495643_0129766 3300046522 Bacteria 1266
292 Ga0495644_0466099 3300046523 Bacteria 504
293 Ga0495598_0128848 3300046537 Bacteria 865
294 Ga0495621_0091681 3300046539 Unclassified 1146
295 Ga0495668_0000863 3300046616 Bacteria 34191
296 Ga0495670_0292630 3300046691 Bacteria 872
297 Ga0495670_0526529 3300046691 Unclassified 643
298 Ga0495600_0417188 3300046809 Bacteria 833
299 Ga0495672_0069425 3300047320 Unclassified 2000
300 Ga0495676_0996909 3300047321 Bacteria 535
301 Ga0495686_0021166 3300047472 Bacteria 4325
302 Ga0495686_0028441 3300047472 Bacteria 3641
303 Ga0501032_0017004 3300049569 Bacteria 5110
304 Ga0501034_0062889 3300049571 Bacteria 3726
305 Ga0501036_0006877 3300049572 Bacteria 9244
306 Ga0501037_0059366 3300049573 Bacteria 2791
307 Ga0501038_0054670 3300049574 Bacteria 3433
308 Ga0501039_0041440 3300049575 Bacteria 3557
309 Ga0501043_0009419 3300049579 Bacteria 7667
310 Ga0501046_0374348 3300049580 Unclassified 1031
311 Ga0501047_0073517 3300049581 Bacteria 3291
312 Ga0501048_0042214 3300049582 Bacteria 3266
313 Ga0501070_0039093 3300049586 Bacteria 3958
314 Ga0501072_0809356 3300049588 Bacteria 734
315 Ga0501074_0010801 3300049590 Bacteria 6631
316 Ga0501079_0135959 3300049741 Bacteria 1914
317 Ga0501083_0014203 3300049744 Bacteria 5570
318 Ga0501035_0102294 3300049822 Unclassified 2513
319 Ga0501044_0181951 3300049823 Unclassified 2068
320 nmdc:mga0k408_488862_c1 3300050493 Unclassified 730
321 nmdc:mga05p37_359854_c1 3300050507 Bacteria 1711
322 nmdc:mga05p37_568354_c1 3300050507 Bacteria 1287
323 nmdc:mga05p37_782713_c1 3300050507 Bacteria 1046
324 nmdc:mga09592_81361_c1 3300050508 Bacteria 2760
325 nmdc:mga09592_823_c1 3300050508 Bacteria 24005
326 nmdc:mga0qj67_257108_c1 3300050509 Bacteria 1417
327 nmdc:mga0qj67_43430_c1 3300050509 Bacteria 3540
328 nmdc:mga06r32_289786_c1 3300050510 Bacteria 1624
329 nmdc:mga06r32_316572_c1 3300050510 Unclassified 1546
330 nmdc:mga08y16_1015400_c1 3300050511 Unclassified 809
331 nmdc:mga08y16_116351_c1 3300050511 Bacteria 2783
332 nmdc:mga08y16_1749003_c1 3300050511 Bacteria 576
333 Ga0500646_0115726 3300053090 Unclassified 857
334 Ga0500568_0070675 3300053139 Bacteria 1337
335 Ga0501084_0138728 3300054114 Bacteria 2047
336 Ga0501082_0286227 3300060353 Bacteria 1435
337 2839990244 2839989709 Bacteria 3773432
338 2977236866 2977232053 Bacteria 5485925
339 Ga0068869_100013446
340 JGI24751J29686_10004241
341 JGI25157J39369_1014248
342 Ga0065714_10303813
343 Ga0065704_10388427
344 Ga0065712_10084512
345 Ga0065715_10039073
346 Ga0065715_10468693
347 Ga0070683_100670415
348 Ga0070690_100686952
349 Ga0070670_100037560
350 Ga0070670_100489105
351 Ga0070670_101258709
352 Ga0070670_101783565
353 Ga0070670_101829273
354 Ga0068869_100846781
355 Ga0068869_101132704
356 Ga0070666_10494516
357 Ga0068868_100152036
358 Ga0070689_100044909
359 Ga0070689_100153792
360 Ga0070687_100280320
361 Ga0070687_101342622
362 Ga0070661_101776071
363 Ga0070668_100169244
364 Ga0070668_100412062
365 Ga0070668_100608273
366 Ga0070669_100046507
367 Ga0070669_100469571
368 Ga0070669_101339046
369 Ga0070675_101400897
370 Ga0070675_101452117
371 Ga0070671_101244359
372 Ga0070674_100856747
373 Ga0070673_100078786
374 Ga0070673_100552612
375 Ga0070688_100049396
376 Ga0070667_101976847
377 Ga0070700_100128366
378 Ga0070694_101697218
379 Ga0070678_100593199
380 Ga0070678_101538095
381 Ga0068867_100434284
382 Ga0068867_100843090
383 Ga0068867_100849793
384 Ga0068867_101039610
385 Ga0068867_101522298
386 Ga0070685_10137649
387 Ga0070685_10282194
388 Ga0070685_10330224
389 Ga0070706_101531506
390 Ga0070698_100001455
391 Ga0070698_100002086
392 Ga0068853_100008858
393 Ga0068853_100700424
394 Ga0070672_100150532
395 Ga0070672_100330906
396 Ga0070672_101314866
397 Ga0070686_100346008
398 Ga0070695_100885563
399 Ga0070693_100297682
400 Ga0070664_101810890
401 Ga0070664_102203168
402 Ga0068857_100045001
403 Ga0070702_100958872
404 Ga0068852_100406273
405 Ga0068859_100097843
406 Ga0068859_100172006
407 Ga0068859_100323343
408 Ga0068859_100383627
409 Ga0068864_100135085
410 Ga0068864_100216431
411 Ga0068864_100385192
412 Ga0068864_101497575
413 Ga0068864_102458130
414 Ga0068861_100062234
415 Ga0068861_100143337
416 Ga0068861_100838284
417 Ga0068851_10047674
418 Ga0068870_10011641
419 Ga0068870_10897803
420 Ga0068863_100258983
421 Ga0068863_100262375
422 Ga0068863_101136145
423 Ga0068863_101385571
424 Ga0068863_102318613
425 Ga0068858_100116672
426 Ga0068860_100206522
427 Ga0068860_100610493
428 Ga0068860_100698687
429 Ga0068862_101132194
430 Ga0075366_10567027
431 Ga0097621_100324629
432 Ga0068871_100171713
433 Ga0068871_100280120
434 Ga0075428_100001878
435 Ga0075428_100061237
436 Ga0075430_100095144
437 Ga0075431_100307378
438 Ga0075429_100001931
439 Ga0075429_100052501
440 Ga0068865_101577525
441 Ga0068865_101747389
442 Ga0097620_100097845
443 Ga0097620_100172008
444 Ga0097620_100323345
445 Ga0097620_100383630
446 Ga0111539_10167394
447 Ga0111539_10579674
448 Ga0111539_10930513
449 Ga0105245_10418825
450 Ga0105247_10009905
451 Ga0105247_10941546
452 Ga0114129_10062503
453 Ga0114129_10263410
454 Ga0105243_10440189
455 Ga0105242_10008224
456 Ga0105242_10014405
457 Ga0105242_10016179
458 Ga0105242_11232207
459 Ga0105248_10164302
460 Ga0105249_10000611
461 Ga0105249_10001393
462 Ga0105249_10031748
463 Ga0105249_10075099
464 Ga0105249_10100046
465 Ga0105249_10397091
466 Ga0105249_10756917
467 Ga0105249_10944751
468 Ga0105249_11381858
469 Ga0105246_10408702
470 Ga0157373_10666629
471 Ga0157371_10039559
472 Ga0157371_10314641
473 Ga0157370_10387087
474 Ga0157369_10126651
475 Ga0157369_11424192
476 Ga0157369_12392917
477 Ga0157374_12380073
478 Ga0157378_10425351
479 Ga0157378_12234622
480 Ga0157378_12650583
481 Ga0157378_12822782
482 Ga0163162_11360414
483 Ga0163162_12109917
484 Ga0163162_12469828
485 Ga0157372_10233696
486 Ga0157372_10538220
487 Ga0157372_11701141
488 Ga0157375_10390972
489 Ga0157375_10964309
490 Ga0157375_11988280
491 Ga0157375_12370902
492 Ga0163163_10244122
493 Ga0163163_10250732
494 Ga0163163_10639108
495 Ga0163163_11860881
496 Ga0163163_12423628
497 Ga0163163_13349801
498 Ga0157380_10026841
499 Ga0157380_10513970
500 Ga0157380_10727187
501 Ga0157380_10826314
502 Ga0157380_11937091
503 Ga0157380_13120171
504 Ga0157377_11326385
505 Ga0157377_11669254
506 Ga0157377_11756348
507 Ga0157379_10295644
508 Ga0157376_10684397
509 Ga0163161_10199530
510 Ga0163161_10235991
511 Ga0163161_10834315
512 Ga0207666_1040998
513 Ga0209455_1019102
514 Ga0207697_10030666
515 Ga0207682_10040074
516 Ga0207710_10009414
517 Ga0207680_10610229
518 Ga0207685_10041275
519 Ga0207645_10131578
520 Ga0207645_10212616
521 Ga0207645_10500300
522 Ga0207643_10003695
523 Ga0207705_10382712
524 Ga0207684_11435056
525 Ga0207662_10309557
526 Ga0207650_10006365
527 Ga0207650_10062814
528 Ga0207650_10583032
529 Ga0207650_10595219
530 Ga0207650_10954049
531 Ga0207659_11384262
532 Ga0207686_10002249
533 Ga0207686_10053869
534 Ga0207686_10147419
535 Ga0207709_10146280
536 Ga0207670_10081086
537 Ga0207669_10259144
538 Ga0207704_10018696
539 Ga0207691_10116141
540 Ga0207691_10421549
541 Ga0207689_10032640
542 Ga0207689_10063754
543 Ga0207689_11158559
544 Ga0207661_11472060
545 Ga0207661_11674333
546 Ga0207679_11310999
547 Ga0207651_10154937
548 Ga0207712_10003748
549 Ga0207712_10003945
550 Ga0207712_10247327
551 Ga0207712_10562743
552 Ga0207712_10739269
553 Ga0207712_11114452
554 Ga0207712_11515870
555 Ga0207712_11914947
556 Ga0207668_10222044
557 Ga0207640_10847197
558 Ga0207658_10905451
559 Ga0207658_11144237
560 Ga0207658_11708259
561 Ga0207658_11954433
562 Ga0207677_10425680
563 Ga0207677_10632819
564 Ga0207703_10174992
565 Ga0207639_10419971
566 Ga0207708_10036076
567 Ga0207708_11064616
568 Ga0207641_10000873
569 Ga0207641_10055829
570 Ga0207641_10240867
571 Ga0207641_10766910
572 Ga0207641_11566667
573 Ga0207641_11587473
574 Ga0207648_10034852
575 Ga0207648_10058604
576 Ga0207648_10094820
577 Ga0207648_10513027
578 Ga0207648_11961674
579 Ga0207676_10014462
580 Ga0207676_10426119
581 Ga0207674_10150353
582 Ga0207675_100017141
583 Ga0207675_100097037
584 Ga0207675_100800013
585 Ga0207675_102746717
586 Ga0207683_10098563
587 Ga0207698_10466460
588 Ga0207428_10085039
589 Ga0268265_10485013
590 Ga0268265_10845262
591 Ga0268264_10533310
592 Ga0268264_11143985
593 Ga0268264_11352695
594 Ga0307515_10000001
595 Ga0265327_10000906
596 Ga0307408_101535249
597 Ga0307410_10828363
598 Ga0307416_101508214
599 Ga0307414_10204524
600 Ga0307414_10589533
601 Ga0307415_100220637
602 Ga0307507_10345259
603 Ga0373957_0433847
604 Ga0395900_0045533
605 Ga0395905_0000527
606 Ga0395905_0127684
607 Ga0439439_0027945
608 Ga0439453_0139578
609 Ga0451793_1365790
610 Ga0451804_0685085
611 Ga0451835_0610908
612 Ga0451837_0308600
613 Ga0451841_0075618
614 Ga0451853_1725440
615 Ga0439431_0014969
616 Ga0439441_027666
617 Ga0439442_019238
618 Ga0439454_065522
619 Ga0450898_025533
620 Ga0439434_0170207
621 Ga0439435_0049992
622 Ga0453683_0664787
623 Ga0453684_0092803
624 Ga0453684_0147846
625 Ga0453684_0258773
626 Ga0453684_1237266
627 Ga0453684_1847344
628 Ga0495594_0176498
629 Ga0495643_0129766
630 Ga0495644_0466099
631 Ga0495598_0128848
632 Ga0495621_0091681
633 Ga0495668_0000863
634 Ga0495670_0292630
635 Ga0495670_0526529
636 Ga0495600_0417188
637 Ga0495672_0069425
638 Ga0495676_0996909
639 Ga0495686_0021166
640 Ga0495686_0028441
641 Ga0501032_0017004
642 Ga0501034_0062889
643 Ga0501036_0006877
644 Ga0501037_0059366
645 Ga0501038_0054670
646 Ga0501039_0041440
647 Ga0501043_0009419
648 Ga0501046_0374348
649 Ga0501047_0073517
650 Ga0501048_0042214
651 Ga0501070_0039093
652 Ga0501072_0809356
653 Ga0501074_0010801
654 Ga0501079_0135959
655 Ga0501083_0014203
656 Ga0501035_0102294
657 Ga0501044_0181951
658 nmdc:mga0k408_488862_c1
659 nmdc:mga05p37_359854_c1
660 nmdc:mga05p37_568354_c1
661 nmdc:mga05p37_782713_c1
662 nmdc:mga09592_81361_c1
663 nmdc:mga09592_823_c1
664 nmdc:mga0qj67_257108_c1
665 nmdc:mga0qj67_43430_c1
666 nmdc:mga06r32_289786_c1
667 nmdc:mga06r32_316572_c1
668 nmdc:mga08y16_1015400_c1
669 nmdc:mga08y16_116351_c1
670 nmdc:mga08y16_1749003_c1
671 Ga0500646_0115726
672 Ga0500568_0070675
673 Ga0501084_0138728
674 Ga0501082_0286227
675 2839990244
676 2977236866

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

24

108

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1i7h-assembly3.cif.gz_C crystal sturcuture of fdx 0.8825 3 103
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.8662 1 111
3ah7-assembly1.cif.gz_A-2 crystal structure of the isc-like [2fe-2s] ferredoxin (fdxb) from pseudomonas putida jcm 20004 0.8516 1 111
4ltu-assembly2.cif.gz_B crystal structure of ferredoxin from rhodopseudomonas palustris haa2 0.8383 3 105
1l5p-assembly3.cif.gz_C crystal structure of trichomonas vaginalis ferredoxin 0.83 3 102
ID Description Score Start End Superfamily
1i7hA00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8806 3 103 3.10.20.30
4ltuB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8383 3 105 3.10.20.30
1l5pC00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.83 3 102 3.10.20.30
3lxfB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8202 3 102 3.10.20.30
2wlbB00 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.8187 3 103 3.10.20.30
ID Description Score Start End GO Terms
AF-A0A838TPU9-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9627 1 111 GO:0005829
GO:0009055
GO:0051537
GO:0140647
AF-A0A520BWA8-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.9593 3 92 GO:0009055
GO:0051537
GO:0140647
AF-A0A3M1YKU4-F1-model_v4 Ferredoxin 0.9547 1 111 GO:0009055
GO:0051537
GO:0140647
AF-A0A2G0CF15-F1-model_v4 Ferredoxin 0.9514 1 111 GO:0009055
GO:0051537
GO:0140647
AF-A0A4Q5RI28-F1-model_v4 2Fe-2S iron-sulfur cluster binding domain-containing protein 0.949 2 106 GO:0009055
GO:0051537
GO:0140647

Map