F413375

General Info

Members Datasets Scaffolds Average Seq Length
338 157 335 287

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100514941|Ga0068869_1005149411
Length 286
Sequence MRSLFLLAAAALLVGAAPAKKPLTPTDVVTAAPPGAWKTISSDDLLVLDLKSGGRVVVQLAPEFAPVHVANIQALARGKYWDGATIYRVQDNYVAQWGLNESDKPWPAGVTAKPPAEYTRALKGLAVKPLGFADPYAPAAGFVNGWPVAANLAHCYGSVGVGRDLSPDTGTGGELYAAIAPIRHLDRNIAVVGRVIDGIDKLSSLPRGTEALGFYKDKSAFVPIASIRIASNIPAAERPAYEYLDTASASFATYLRVRANRKDDFYIRPAGGVDLCNVNVPVRKKA

Samples

Sample ID Description Type Environment
1 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
132 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
135 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
136 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
137 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
143 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
146 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
152 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
153 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
154 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
157 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.82
Metatranscriptomes 0.3
Isolates 0.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 2.07
Rhizosphere 96.45
Stem 0
Stem Tuber 0
Unclassified 0.89

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1012569 3300001915 Bacteria 1451
2 JGI24740J21852_10004688 3300001979 Bacteria 5857
3 JGI24739J22299_10009698 3300001989 Bacteria 3583
4 JGI24737J22298_10005831 3300001990 Bacteria 4242
5 JGI24735J21928_10003684 3300002067 Bacteria 5194
6 JGI24738J21930_10004159 3300002075 Bacteria 3567
7 Ga0070658_10056657 3300005327 Bacteria 3186
8 Ga0070658_10155074 3300005327 Bacteria 1919
9 Ga0070676_10006376 3300005328 Bacteria 6303
10 Ga0070676_10030317 3300005328 Bacteria 3084
11 Ga0070683_100007370 3300005329 Bacteria 9295
12 Ga0070683_100024323 3300005329 Bacteria 5424
13 Ga0070683_100030853 3300005329 Bacteria 4869
14 Ga0070683_100072446 3300005329 Bacteria 3216
15 Ga0070670_100003949 3300005331 Bacteria 12373
16 Ga0070670_100100967 3300005331 Bacteria 2484
17 Ga0070670_100191117 3300005331 Bacteria 1778
18 Ga0068869_100055312 3300005334 Bacteria 2892
19 Ga0068869_100514941 3300005334 Bacteria 1001
20 Ga0070666_10274861 3300005335 Bacteria 1196
21 Ga0070680_100191149 3300005336 Bacteria 1725
22 Ga0070682_100145648 3300005337 Bacteria 1620
23 Ga0070660_100003053 3300005339 Bacteria 11523
24 Ga0070660_100022523 3300005339 Bacteria 4659
25 Ga0070660_100122881 3300005339 Bacteria 2072
26 Ga0070660_100135697 3300005339 Bacteria 1971
27 Ga0070691_10100255 3300005341 Bacteria 1437
28 Ga0070661_100043365 3300005344 Bacteria 3286
29 Ga0070661_100131164 3300005344 Bacteria 1882
30 Ga0070661_100263234 3300005344 Bacteria 1334
31 Ga0070668_100484529 3300005347 Bacteria 1068
32 Ga0070669_100018965 3300005353 Bacteria 4917
33 Ga0070669_100060853 3300005353 Bacteria 2774
34 Ga0070671_100000866 3300005355 Bacteria 22123
35 Ga0070671_100016707 3300005355 Bacteria 5934
36 Ga0070671_100034633 3300005355 Bacteria 4181
37 Ga0070671_100359566 3300005355 Bacteria 1243
38 Ga0070674_100026410 3300005356 Bacteria 3793
39 Ga0070673_100005428 3300005364 Bacteria 8157
40 Ga0070673_100143669 3300005364 Bacteria 2015
41 Ga0070659_100016115 3300005366 Bacteria 5608
42 Ga0070659_100110658 3300005366 Bacteria 2217
43 Ga0070667_100003813 3300005367 Bacteria 12811
44 Ga0070667_100013654 3300005367 Bacteria 6710
45 Ga0070667_100042585 3300005367 Bacteria 3809
46 Ga0070667_100209559 3300005367 Bacteria 1732
47 Ga0070667_100264343 3300005367 Bacteria 1541
48 Ga0070705_100105385 3300005440 Bacteria 1790
49 Ga0070694_100036881 3300005444 Bacteria 3240
50 Ga0070663_100017986 3300005455 Bacteria 4624
51 Ga0070663_100064637 3300005455 Bacteria 2645
52 Ga0070663_100145911 3300005455 Bacteria 1811
53 Ga0070678_100042409 3300005456 Bacteria 3233
54 Ga0070662_100041923 3300005457 Bacteria 3268
55 Ga0070662_100135304 3300005457 Bacteria 1905
56 Ga0070681_10020408 3300005458 Bacteria 6641
57 Ga0070681_10089236 3300005458 Bacteria 3034
58 Ga0068867_100006896 3300005459 Bacteria 8039
59 Ga0068867_100082832 3300005459 Bacteria 2421
60 Ga0068867_100107757 3300005459 Bacteria 2136
61 Ga0068867_100112099 3300005459 Bacteria 2097
62 Ga0068867_100524900 3300005459 Bacteria 1022
63 Ga0070679_100015769 3300005530 Bacteria 7269
64 Ga0070679_100153712 3300005530 Bacteria 2277
65 Ga0070684_100002671 3300005535 Bacteria 13167
66 Ga0070684_100007613 3300005535 Bacteria 8441
67 Ga0068853_100116509 3300005539 Bacteria 2379
68 Ga0068853_100208835 3300005539 Bacteria 1779
69 Ga0068853_100282443 3300005539 Bacteria 1530
70 Ga0068853_100693859 3300005539 Bacteria 971
71 Ga0070696_100002969 3300005546 Bacteria 11259
72 Ga0070693_100000995 3300005547 Bacteria 12639
73 Ga0070693_100107930 3300005547 Bacteria 1707
74 Ga0070665_100008330 3300005548 Bacteria 10484
75 Ga0068855_100070606 3300005563 Bacteria 4063
76 Ga0068855_100200509 3300005563 Bacteria 2246
77 Ga0070664_100003263 3300005564 Bacteria 13103
78 Ga0070664_100041421 3300005564 Bacteria 3886
79 Ga0070664_100213626 3300005564 Bacteria 1724
80 Ga0070664_100240422 3300005564 Bacteria 1625
81 Ga0070664_100339574 3300005564 Unclassified 1364
82 Ga0068857_100000489 3300005577 Bacteria 28341
83 Ga0068857_100011147 3300005577 Bacteria 7818
84 Ga0068857_100046265 3300005577 Bacteria 3861
85 Ga0068857_100055724 3300005577 Bacteria 3508
86 Ga0068854_100002116 3300005578 Bacteria 12177
87 Ga0068854_100013400 3300005578 Bacteria 5380
88 Ga0068854_100023845 3300005578 Bacteria 4182
89 Ga0068854_100210139 3300005578 Bacteria 1534
90 Ga0068856_100014742 3300005614 Bacteria 7544
91 Ga0068852_100005093 3300005616 Bacteria 9355
92 Ga0068852_100109232 3300005616 Bacteria 2511
93 Ga0068852_100183006 3300005616 Bacteria 1972
94 Ga0068859_100002392 3300005617 Bacteria 19100
95 Ga0068859_100013237 3300005617 Bacteria 8277
96 Ga0068859_100031971 3300005617 Bacteria 5287
97 Ga0068864_100001110 3300005618 Bacteria 22495
98 Ga0068864_100307540 3300005618 Bacteria 1485
99 Ga0068861_100058259 3300005719 Bacteria 2953
100 Ga0068870_10114449 3300005840 Bacteria 1545
101 Ga0068863_100001056 3300005841 Bacteria 27521
102 Ga0068863_100015881 3300005841 Bacteria 7222
103 Ga0068863_100024403 3300005841 Bacteria 5767
104 Ga0068863_100040743 3300005841 Bacteria 4416
105 Ga0068863_100073550 3300005841 Bacteria 3233
106 Ga0068863_100079639 3300005841 Bacteria 3102
107 Ga0068858_100003145 3300005842 Bacteria 16530
108 Ga0068858_100258040 3300005842 Unclassified 1656
109 Ga0068860_100002768 3300005843 Bacteria 18241
110 Ga0068860_100003557 3300005843 Bacteria 16020
111 Ga0068862_100010067 3300005844 Bacteria 7806
112 Ga0068862_100016753 3300005844 Bacteria 6101
113 Ga0068862_100180236 3300005844 Bacteria 1895
114 Ga0068862_100311638 3300005844 Bacteria 1450
115 Ga0075366_10054612 3300006195 Bacteria 2372
116 Ga0075429_100522044 3300006880 Bacteria 1041
117 Ga0097620_100002392 3300006931 Bacteria 19100
118 Ga0097620_100013239 3300006931 Bacteria 8277
119 Ga0097620_100031972 3300006931 Bacteria 5287
120 Ga0075435_100184925 3300007076 Bacteria 1762
121 Ga0105250_10035676 3300009092 Bacteria 1995
122 Ga0105240_10123343 3300009093 Bacteria 3117
123 Ga0111539_10127387 3300009094 Bacteria 2982
124 Ga0105241_10035723 3300009174 Bacteria 3738
125 Ga0105242_10412671 3300009176 Bacteria 1263
126 Ga0105248_10001320 3300009177 Bacteria 27621
127 Ga0105248_10062053 3300009177 Bacteria 4198
128 Ga0105248_10269472 3300009177 Bacteria 1917
129 Ga0105237_10087706 3300009545 Bacteria 3101
130 Ga0105249_10021461 3300009553 Bacteria 5781
131 Ga0105249_10026708 3300009553 Bacteria 5205
132 Ga0157315_1002197 3300012508 Bacteria 1192
133 Ga0157373_10014198 3300013100 Bacteria 5842
134 Ga0157373_10075054 3300013100 Bacteria 2385
135 Ga0157373_10110842 3300013100 Bacteria 1929
136 Ga0157371_10014319 3300013102 Bacteria 5990
137 Ga0157370_10112664 3300013104 Bacteria 2542
138 Ga0157369_10063577 3300013105 Bacteria 3975
139 Ga0157369_10080955 3300013105 Bacteria 3476
140 Ga0157369_10648884 3300013105 Bacteria 1088
141 Ga0163162_10182809 3300013306 Bacteria 2223
142 Ga0163162_10554062 3300013306 Bacteria 1278
143 Ga0157372_10344688 3300013307 Bacteria 1736
144 Ga0157375_10858565 3300013308 Bacteria 1054
145 Ga0163163_10006151 3300014325 Bacteria 10461
146 Ga0163163_10020987 3300014325 Bacteria 6159
147 Ga0182008_10017531 3300014497 Bacteria 3714
148 Ga0157379_10057778 3300014968 Bacteria 3467
149 Ga0157379_10437572 3300014968 Bacteria 1206
150 Ga0206356_11523657 3300020070 Bacteria 1931
151 Ga0207696_1030327 3300025711 Bacteria 1644
152 Ga0207642_10008791 3300025899 Bacteria 3486
153 Ga0207688_10028788 3300025901 Bacteria 3055
154 Ga0207688_10036293 3300025901 Bacteria 2732
155 Ga0207647_10007000 3300025904 Bacteria 8179
156 Ga0207647_10035461 3300025904 Bacteria 3179
157 Ga0207647_10080105 3300025904 Bacteria 1959
158 Ga0207645_10007607 3300025907 Bacteria 7636
159 Ga0207645_10015089 3300025907 Bacteria 5145
160 Ga0207705_10000493 3300025909 Bacteria 33656
161 Ga0207705_10005317 3300025909 Bacteria 9634
162 Ga0207705_10049343 3300025909 Bacteria 3029
163 Ga0207705_10102955 3300025909 Bacteria 2102
164 Ga0207705_10313509 3300025909 Bacteria 1204
165 Ga0207654_10143157 3300025911 Bacteria 1527
166 Ga0207707_10025551 3300025912 Bacteria 5167
167 Ga0207707_10134697 3300025912 Bacteria 2160
168 Ga0207707_10411219 3300025912 Bacteria 1161
169 Ga0207695_10008855 3300025913 Bacteria 12532
170 Ga0207671_10064244 3300025914 Bacteria 2728
171 Ga0207660_10000770 3300025917 Bacteria 21320
172 Ga0207660_10003208 3300025917 Bacteria 10700
173 Ga0207660_10139716 3300025917 Bacteria 1851
174 Ga0207660_10335891 3300025917 Bacteria 1209
175 Ga0207657_10002261 3300025919 Bacteria 20877
176 Ga0207657_10006107 3300025919 Bacteria 12524
177 Ga0207657_10008107 3300025919 Bacteria 10711
178 Ga0207657_10011972 3300025919 Bacteria 8582
179 Ga0207649_10006255 3300025920 Bacteria 6468
180 Ga0207649_10031507 3300025920 Bacteria 3152
181 Ga0207652_10000034 3300025921 Bacteria 138571
182 Ga0207652_10255489 3300025921 Bacteria 1580
183 Ga0207681_10010745 3300025923 Bacteria 5620
184 Ga0207681_10195736 3300025923 Bacteria 1549
185 Ga0207681_10247056 3300025923 Bacteria 1391
186 Ga0207694_10080870 3300025924 Bacteria 2551
187 Ga0207650_10029644 3300025925 Bacteria 3935
188 Ga0207650_10291548 3300025925 Bacteria 1331
189 Ga0207650_10328852 3300025925 Bacteria 1253
190 Ga0207659_10134720 3300025926 Bacteria 1911
191 Ga0207644_10001103 3300025931 Bacteria 17326
192 Ga0207644_10250443 3300025931 Bacteria 1413
193 Ga0207644_10449031 3300025931 Bacteria 1059
194 Ga0207690_10003375 3300025932 Bacteria 9543
195 Ga0207690_10019381 3300025932 Bacteria 4188
196 Ga0207690_10024712 3300025932 Bacteria 3765
197 Ga0207690_10069942 3300025932 Bacteria 2416
198 Ga0207690_10098763 3300025932 Bacteria 2080
199 Ga0207690_10265970 3300025932 Bacteria 1330
200 Ga0207706_10027073 3300025933 Bacteria 5128
201 Ga0207706_10031454 3300025933 Bacteria 4728
202 Ga0207706_10037177 3300025933 Bacteria 4323
203 Ga0207706_10056735 3300025933 Bacteria 3452
204 Ga0207706_10122387 3300025933 Bacteria 2288
205 Ga0207669_10007101 3300025937 Bacteria 5157
206 Ga0207691_10012151 3300025940 Bacteria 8255
207 Ga0207691_10062014 3300025940 Bacteria 3394
208 Ga0207711_10000869 3300025941 Bacteria 29230
209 Ga0207711_10036302 3300025941 Bacteria 4182
210 Ga0207711_10363898 3300025941 Bacteria 1340
211 Ga0207689_10003432 3300025942 Bacteria 14472
212 Ga0207689_10033527 3300025942 Bacteria 4267
213 Ga0207689_10280410 3300025942 Bacteria 1380
214 Ga0207661_10002378 3300025944 Bacteria 12950
215 Ga0207661_10002726 3300025944 Bacteria 12149
216 Ga0207661_10012640 3300025944 Bacteria 6145
217 Ga0207661_10145612 3300025944 Bacteria 2043
218 Ga0207679_10002993 3300025945 Bacteria 10483
219 Ga0207679_10010992 3300025945 Bacteria 5841
220 Ga0207667_10004710 3300025949 Bacteria 16697
221 Ga0207667_10069541 3300025949 Bacteria 3664
222 Ga0207651_10009471 3300025960 Bacteria 5337
223 Ga0207651_10010482 3300025960 Bacteria 5139
224 Ga0207651_10073328 3300025960 Bacteria 2434
225 Ga0207651_10191089 3300025960 Bacteria 1633
226 Ga0207668_10000072 3300025972 Bacteria 77023
227 Ga0207668_10026318 3300025972 Bacteria 3776
228 Ga0207640_10008254 3300025981 Bacteria 5777
229 Ga0207640_10065894 3300025981 Bacteria 2418
230 Ga0207640_10186219 3300025981 Bacteria 1561
231 Ga0207640_10196299 3300025981 Bacteria 1525
232 Ga0207658_10009361 3300025986 Bacteria 6645
233 Ga0207658_10029662 3300025986 Bacteria 3866
234 Ga0207658_10172171 3300025986 Bacteria 1784
235 Ga0207658_10467827 3300025986 Bacteria 1118
236 Ga0207703_10004152 3300026035 Bacteria 11945
237 Ga0207703_10010752 3300026035 Bacteria 7143
238 Ga0207703_10014765 3300026035 Bacteria 6096
239 Ga0207703_10376282 3300026035 Bacteria 1313
240 Ga0207639_10001159 3300026041 Bacteria 17877
241 Ga0207639_10059967 3300026041 Bacteria 2934
242 Ga0207639_10245655 3300026041 Bacteria 1559
243 Ga0207678_10003768 3300026067 Bacteria 13635
244 Ga0207678_10017937 3300026067 Bacteria 6218
245 Ga0207678_10189956 3300026067 Bacteria 1755
246 Ga0207702_10002063 3300026078 Bacteria 19455
247 Ga0207702_10228530 3300026078 Bacteria 1738
248 Ga0207641_10001513 3300026088 Bacteria 22775
249 Ga0207641_10011421 3300026088 Bacteria 7289
250 Ga0207641_10201211 3300026088 Bacteria 1836
251 Ga0207648_10002300 3300026089 Bacteria 20648
252 Ga0207648_10032350 3300026089 Bacteria 4618
253 Ga0207648_10111854 3300026089 Bacteria 2397
254 Ga0207648_10157193 3300026089 Bacteria 2007
255 Ga0207676_10006150 3300026095 Bacteria 8475
256 Ga0207676_10037183 3300026095 Bacteria 3709
257 Ga0207674_10001507 3300026116 Bacteria 30052
258 Ga0207674_10003678 3300026116 Bacteria 18711
259 Ga0207674_10006843 3300026116 Bacteria 13372
260 Ga0207674_10012374 3300026116 Bacteria 9538
261 Ga0207675_100028535 3300026118 Bacteria 5196
262 Ga0207683_10048901 3300026121 Bacteria 3700
263 Ga0207698_10000896 3300026142 Bacteria 17309
264 Ga0207698_10038595 3300026142 Bacteria 3530
265 Ga0207698_10526523 3300026142 Unclassified 1154
266 Ga0268265_10003724 3300028380 Bacteria 10841
267 Ga0268265_10006112 3300028380 Bacteria 8171
268 Ga0268265_10016734 3300028380 Bacteria 5045
269 Ga0268265_10072644 3300028380 Bacteria 2684
270 Ga0268265_10185815 3300028380 Bacteria 1790
271 Ga0268264_10005781 3300028381 Bacteria 10486
272 Ga0268264_10090619 3300028381 Bacteria 2635
273 Ga0268264_10470999 3300028381 Bacteria 1220
274 Ga0307410_10008560 3300031852 Bacteria 5683
275 Ga0307406_10410673 3300031901 Bacteria 1076
276 Ga0307407_10034029 3300031903 Bacteria 2786
277 Ga0307409_100022858 3300031995 Bacteria 4318
278 Ga0307416_100009695 3300032002 Bacteria 6323
279 Ga0307416_100047833 3300032002 Bacteria 3389
280 Ga0307411_10327743 3300032005 Bacteria 1239
281 Ga0307415_100001082 3300032126 Bacteria 12655
282 Ga0307415_100100797 3300032126 Bacteria 2117
283 Ga0307415_100107385 3300032126 Bacteria 2062
284 Ga0395899_0112850 3300037312 Bacteria 1952
285 Ga0395900_0003123 3300037418 Bacteria 17982
286 Ga0395900_0030498 3300037418 Bacteria 5536
287 Ga0395900_0086807 3300037418 Bacteria 3216
288 Ga0395900_0115619 3300037418 Bacteria 2753
289 Ga0395900_0263493 3300037418 Bacteria 1720
290 Ga0395898_0028414 3300037466 Bacteria 5603
291 Ga0395898_0392483 3300037466 Bacteria 1323
292 Ga0395905_0023571 3300037471 Bacteria 5815
293 Ga0395905_0056589 3300037471 Bacteria 3668
294 Ga0395905_0064126 3300037471 Bacteria 3437
295 Ga0395905_0064478 3300037471 Bacteria 3428
296 Ga0395905_0104259 3300037471 Bacteria 2662
297 Ga0395905_0106386 3300037471 Bacteria 2634
298 Ga0395905_0119565 3300037471 Bacteria 2476
299 Ga0395905_0134598 3300037471 Bacteria 2324
300 Ga0395905_0213936 3300037471 Bacteria 1805
301 Ga0395905_0513932 3300037471 Bacteria 1098
302 Ga0395901_0055690 3300038443 Bacteria 4112
303 Ga0395901_0095192 3300038443 Bacteria 3120
304 Ga0395901_0115481 3300038443 Bacteria 2819
305 Ga0395901_0562931 3300038443 Bacteria 1154
306 Ga0450917_002309 3300042120 Bacteria 1361
307 Ga0439458_0001207 3300042157 Bacteria 6549
308 Ga0439464_0002720 3300042439 Bacteria 4385
309 Ga0466972_0024067 3300044658 Bacteria 3024
310 Ga0466966_0007749 3300044684 Bacteria 7113
311 Ga0466966_0278484 3300044684 Bacteria 1006
312 Ga0466961_0017856 3300044693 Bacteria 4561
313 Ga0466963_0075812 3300044694 Bacteria 2270
314 Ga0466970_0124073 3300044765 Bacteria 1416
315 Ga0466957_0127070 3300044842 Bacteria 1630
316 Ga0466957_0233270 3300044842 Bacteria 1219
317 Ga0466960_0022409 3300044901 Bacteria 2824
318 Ga0466958_0032434 3300045836 Bacteria 3108
319 Ga0466958_0080000 3300045836 Bacteria 2010
320 Ga0466958_0089892 3300045836 Bacteria 1899
321 Ga0466967_0020997 3300045976 Bacteria 5290
322 Ga0466967_0113134 3300045976 Bacteria 2496
323 Ga0466967_0132257 3300045976 Bacteria 2317
324 Ga0495669_0078573 3300046684 Bacteria 1512
325 Ga0496107_0095605 3300048910 Bacteria 2174
326 Ga0496109_0029055 3300048912 Bacteria 4949
327 Ga0496109_0163473 3300048912 Bacteria 2086
328 Ga0496110_0217158 3300048913 Bacteria 1739
329 Ga0496112_0051014 3300048915 Bacteria 4057
330 Ga0496112_0057299 3300048915 Bacteria 3836
331 Ga0496113_0214066 3300048916 Bacteria 1534
332 nmdc:mga09592_199596_c1 3300050508 Bacteria 1732
333 nmdc:mga08y16_109128_c1 3300050511 Bacteria 2881
334 nmdc:mga0n895_361784_c1 3300050512 Bacteria 1469
335 Ga0500658_0000036 3300053134 Bacteria 85304

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032005 Ga0307411_10327743 Ga0307411_103277432 247
2 3300044684 Ga0466966_0278484 Ga0466966_0278484_34_918 252
3 3300045976 Ga0466967_0132257 Ga0466967_0132257_659_1537 255
4 3300005367 Ga0070667_100042585 Ga0070667_1000425854 258
5 3300005334 Ga0068869_100055312 Ga0068869_1000553125 260
6 3300005353 Ga0070669_100060853 Ga0070669_1000608532 260
7 3300005355 Ga0070671_100016707 Ga0070671_1000167075 260
8 3300005367 Ga0070667_100003813 Ga0070667_1000038135 260
9 3300005617 Ga0068859_100002392 Ga0068859_1000023926 260
10 3300005618 Ga0068864_100001110 Ga0068864_10000111020 260
11 3300005841 Ga0068863_100001056 Ga0068863_1000010566 260
12 3300005842 Ga0068858_100003145 Ga0068858_10000314517 260
13 3300005843 Ga0068860_100002768 Ga0068860_1000027686 260
14 3300005844 Ga0068862_100311638 Ga0068862_1003116381 260
15 3300006931 Ga0097620_100002392 Ga0097620_1000023926 260
16 3300009092 Ga0105250_10035676 Ga0105250_100356763 260
17 3300009177 Ga0105248_10001320 Ga0105248_1000132029 260
18 3300009553 Ga0105249_10026708 Ga0105249_100267084 260
19 3300013306 Ga0163162_10182809 Ga0163162_101828094 260
20 3300014325 Ga0163163_10006151 Ga0163163_1000615110 260
21 3300014968 Ga0157379_10057778 Ga0157379_100577785 260
22 3300025711 Ga0207696_1030327 Ga0207696_10303273 260
23 3300025923 Ga0207681_10195736 Ga0207681_101957362 260
24 3300025941 Ga0207711_10000869 Ga0207711_1000086926 260
25 3300025942 Ga0207689_10033527 Ga0207689_100335274 260
26 3300025960 Ga0207651_10009471 Ga0207651_100094718 260
27 3300025972 Ga0207668_10026318 Ga0207668_100263182 260
28 3300025986 Ga0207658_10009361 Ga0207658_100093615 260
29 3300026035 Ga0207703_10004152 Ga0207703_1000415212 260
30 3300026088 Ga0207641_10001513 Ga0207641_100015136 260
31 3300026095 Ga0207676_10006150 Ga0207676_100061504 260
32 3300028380 Ga0268265_10072644 Ga0268265_100726442 260
33 3300028381 Ga0268264_10005781 Ga0268264_100057816 260
34 3300037471 Ga0395905_0213936 Ga0395905_0213936_498_1379 261
35 3300045836 Ga0466958_0080000 Ga0466958_0080000_941_1825 262
36 3300045836 Ga0466958_0089892 Ga0466958_0089892_458_1336 262
37 3300005331 Ga0070670_100100967 Ga0070670_1001009672 264
38 3300025925 Ga0207650_10328852 Ga0207650_103288522 264
39 3300025926 Ga0207659_10134720 Ga0207659_101347202 264
40 3300032126 Ga0307415_100100797 Ga0307415_1001007972 264
41 3300048912 Ga0496109_0029055 Ga0496109_0029055_3135_4016 264
42 3300048913 Ga0496110_0217158 Ga0496110_0217158_238_1119 264
43 3300005336 Ga0070680_100191149 Ga0070680_1001911492 266
44 3300005339 Ga0070660_100122881 Ga0070660_1001228812 266
45 3300005616 Ga0068852_100183006 Ga0068852_1001830062 266
46 3300025909 Ga0207705_10005317 Ga0207705_100053175 266
47 3300025919 Ga0207657_10008107 Ga0207657_100081079 266
48 3300025921 Ga0207652_10255489 Ga0207652_102554892 266
49 3300005344 Ga0070661_100263234 Ga0070661_1002632342 274
50 3300005356 Ga0070674_100026410 Ga0070674_1000264105 274
51 3300044842 Ga0466957_0233270 Ga0466957_0233270_283_1167 274
52 3300005328 Ga0070676_10006376 Ga0070676_100063766 275
53 3300005347 Ga0070668_100484529 Ga0070668_1004845291 275
54 3300005364 Ga0070673_100143669 Ga0070673_1001436692 275
55 3300005367 Ga0070667_100264343 Ga0070667_1002643431 275
56 3300005459 Ga0068867_100006896 Ga0068867_1000068967 275
57 3300005840 Ga0068870_10114449 Ga0068870_101144492 275
58 3300013306 Ga0163162_10554062 Ga0163162_105540621 275
59 3300014497 Ga0182008_10017531 Ga0182008_100175314 275
60 3300025901 Ga0207688_10028788 Ga0207688_100287884 275
61 3300025907 Ga0207645_10007607 Ga0207645_100076078 275
62 3300025923 Ga0207681_10247056 Ga0207681_102470562 275
63 3300025940 Ga0207691_10012151 Ga0207691_100121516 275
64 3300025960 Ga0207651_10010482 Ga0207651_100104823 275
65 3300025972 Ga0207668_10000072 Ga0207668_1000007250 275
66 3300025986 Ga0207658_10467827 Ga0207658_104678271 275
67 3300026089 Ga0207648_10002300 Ga0207648_1000230018 275
68 3300037312 Ga0395899_0112850 Ga0395899_0112850_426_1310 275
69 3300037471 Ga0395905_0134598 Ga0395905_0134598_143_1027 275
70 3300046684 Ga0495669_0078573 Ga0495669_0078573_541_1422 276
71 3300013100 Ga0157373_10110842 Ga0157373_101108423 277
72 3300044765 Ga0466970_0124073 Ga0466970_0124073_33_914 277
73 3300005328 Ga0070676_10030317 Ga0070676_100303172 278
74 3300005334 Ga0068869_100514941 Ga0068869_1005149411 278
75 3300005456 Ga0070678_100042409 Ga0070678_1000424093 278
76 3300005564 Ga0070664_100003263 Ga0070664_10000326312 278
77 3300005841 Ga0068863_100040743 Ga0068863_1000407434 278
78 3300005841 Ga0068863_100079639 Ga0068863_1000796394 278
79 3300013308 Ga0157375_10858565 Ga0157375_108585651 278
80 3300025933 Ga0207706_10122387 Ga0207706_101223872 278
81 3300025942 Ga0207689_10003432 Ga0207689_1000343214 278
82 3300025942 Ga0207689_10280410 Ga0207689_102804102 278
83 3300025986 Ga0207658_10172171 Ga0207658_101721712 278
84 3300026088 Ga0207641_10201211 Ga0207641_102012112 278
85 3300050512 nmdc:mga0n895_361784_c1 nmdc:mga0n895_361784_c1_458_1309 278
86 3300001990 JGI24737J22298_10005831 JGI24737J22298_100058314 279
87 3300005331 Ga0070670_100191117 Ga0070670_1001911172 279
88 iso_pu_bacteria 2909399089 2909399742 279
89 iso_pu_bacteria 641228493 641334619 279
90 iso_pu_bacteria 643348555 643390877 279
91 3300006880 Ga0075429_100522044 Ga0075429_1005220442 280
92 3300050508 nmdc:mga09592_199596_c1 nmdc:mga09592_199596_c1_780_1658 280
93 3300037418 Ga0395900_0086807 Ga0395900_0086807_2203_3087 281
94 3300005355 Ga0070671_100000866 Ga0070671_10000086620 282
95 3300005459 Ga0068867_100082832 Ga0068867_1000828322 282
96 3300012508 Ga0157315_1002197 Ga0157315_10021972 282
97 3300025931 Ga0207644_10001103 Ga0207644_100011032 282
98 3300025937 Ga0207669_10007101 Ga0207669_100071013 282
99 3300025941 Ga0207711_10363898 Ga0207711_103638982 282
100 3300025960 Ga0207651_10073328 Ga0207651_100733283 282
101 3300026089 Ga0207648_10111854 Ga0207648_101118543 282
102 3300026142 Ga0207698_10526523 Ga0207698_105265232 282
103 3300005844 Ga0068862_100016753 Ga0068862_1000167537 283
104 3300009177 Ga0105248_10062053 Ga0105248_100620534 283
105 3300025941 Ga0207711_10036302 Ga0207711_100363023 283
106 3300028380 Ga0268265_10003724 Ga0268265_100037249 283
107 3300005530 Ga0070679_100153712 Ga0070679_1001537121 284
108 3300028380 Ga0268265_10185815 Ga0268265_101858152 284
109 3300031901 Ga0307406_10410673 Ga0307406_104106732 284
110 3300031903 Ga0307407_10034029 Ga0307407_100340292 284
111 3300032126 Ga0307415_100107385 Ga0307415_1001073854 284
112 3300037466 Ga0395898_0392483 Ga0395898_0392483_48_926 284
113 3300037471 Ga0395905_0023571 Ga0395905_0023571_575_1453 284
114 3300038443 Ga0395901_0115481 Ga0395901_0115481_175_1053 284
115 3300053134 Ga0500658_0000036 Ga0500658_0000036_44231_45109 284
116 3300001989 JGI24739J22299_10009698 JGI24739J22299_100096982 285
117 3300002075 JGI24738J21930_10004159 JGI24738J21930_100041595 285
118 3300005327 Ga0070658_10155074 Ga0070658_101550742 285
119 3300005329 Ga0070683_100072446 Ga0070683_1000724465 285
120 3300005331 Ga0070670_100003949 Ga0070670_10000394910 285
121 3300005335 Ga0070666_10274861 Ga0070666_102748612 285
122 3300005337 Ga0070682_100145648 Ga0070682_1001456482 285
123 3300005339 Ga0070660_100022523 Ga0070660_1000225232 285
124 3300005344 Ga0070661_100131164 Ga0070661_1001311642 285
125 3300005353 Ga0070669_100018965 Ga0070669_1000189656 285
126 3300005355 Ga0070671_100034633 Ga0070671_1000346332 285
127 3300005355 Ga0070671_100359566 Ga0070671_1003595662 285
128 3300005364 Ga0070673_100005428 Ga0070673_1000054282 285
129 3300005366 Ga0070659_100016115 Ga0070659_1000161155 285
130 3300005366 Ga0070659_100110658 Ga0070659_1001106581 285
131 3300005367 Ga0070667_100013654 Ga0070667_1000136548 285
132 3300005367 Ga0070667_100209559 Ga0070667_1002095592 285
133 3300005440 Ga0070705_100105385 Ga0070705_1001053853 285
134 3300005444 Ga0070694_100036881 Ga0070694_1000368812 285
135 3300005455 Ga0070663_100017986 Ga0070663_1000179866 285
136 3300005457 Ga0070662_100041923 Ga0070662_1000419235 285
137 3300005459 Ga0068867_100107757 Ga0068867_1001077574 285
138 3300005459 Ga0068867_100112099 Ga0068867_1001120992 285
139 3300005539 Ga0068853_100116509 Ga0068853_1001165095 285
140 3300005539 Ga0068853_100693859 Ga0068853_1006938591 285
141 3300005546 Ga0070696_100002969 Ga0070696_1000029699 285
142 3300005547 Ga0070693_100000995 Ga0070693_1000009957 285
143 3300005547 Ga0070693_100107930 Ga0070693_1001079302 285
144 3300005548 Ga0070665_100008330 Ga0070665_1000083305 285
145 3300005564 Ga0070664_100041421 Ga0070664_1000414214 285
146 3300005564 Ga0070664_100240422 Ga0070664_1002404223 285
147 3300005577 Ga0068857_100046265 Ga0068857_1000462652 285
148 3300005578 Ga0068854_100002116 Ga0068854_10000211612 285
149 3300005616 Ga0068852_100005093 Ga0068852_1000050936 285
150 3300005617 Ga0068859_100013237 Ga0068859_1000132375 285
151 3300005618 Ga0068864_100307540 Ga0068864_1003075403 285
152 3300005719 Ga0068861_100058259 Ga0068861_1000582592 285
153 3300005841 Ga0068863_100015881 Ga0068863_1000158817 285
154 3300005841 Ga0068863_100024403 Ga0068863_1000244035 285
155 3300005843 Ga0068860_100003557 Ga0068860_10000355716 285
156 3300005844 Ga0068862_100010067 Ga0068862_1000100675 285
157 3300006931 Ga0097620_100013239 Ga0097620_1000132395 285
158 3300009094 Ga0111539_10127387 Ga0111539_101273874 285
159 3300009174 Ga0105241_10035723 Ga0105241_100357235 285
160 3300009177 Ga0105248_10269472 Ga0105248_102694722 285
161 3300009553 Ga0105249_10021461 Ga0105249_100214615 285
162 3300013102 Ga0157371_10014319 Ga0157371_100143195 285
163 3300014968 Ga0157379_10437572 Ga0157379_104375722 285
164 3300025904 Ga0207647_10035461 Ga0207647_100354615 285
165 3300025907 Ga0207645_10015089 Ga0207645_100150892 285
166 3300025909 Ga0207705_10313509 Ga0207705_103135092 285
167 3300025911 Ga0207654_10143157 Ga0207654_101431572 285
168 3300025917 Ga0207660_10335891 Ga0207660_103358912 285
169 3300025919 Ga0207657_10011972 Ga0207657_100119728 285
170 3300025920 Ga0207649_10031507 Ga0207649_100315072 285
171 3300025923 Ga0207681_10010745 Ga0207681_100107456 285
172 3300025925 Ga0207650_10291548 Ga0207650_102915482 285
173 3300025931 Ga0207644_10250443 Ga0207644_102504431 285
174 3300025931 Ga0207644_10449031 Ga0207644_104490312 285
175 3300025932 Ga0207690_10024712 Ga0207690_100247122 285
176 3300025932 Ga0207690_10098763 Ga0207690_100987631 285
177 3300025932 Ga0207690_10265970 Ga0207690_102659702 285
178 3300025933 Ga0207706_10027073 Ga0207706_100270734 285
179 3300025933 Ga0207706_10037177 Ga0207706_100371775 285
180 3300025933 Ga0207706_10056735 Ga0207706_100567352 285
181 3300025944 Ga0207661_10145612 Ga0207661_101456121 285
182 3300025945 Ga0207679_10010992 Ga0207679_100109922 285
183 3300025960 Ga0207651_10191089 Ga0207651_101910891 285
184 3300025981 Ga0207640_10008254 Ga0207640_100082547 285
185 3300025981 Ga0207640_10186219 Ga0207640_101862192 285
186 3300025981 Ga0207640_10196299 Ga0207640_101962992 285
187 3300025986 Ga0207658_10029662 Ga0207658_100296625 285
188 3300026035 Ga0207703_10014765 Ga0207703_100147655 285
189 3300026041 Ga0207639_10245655 Ga0207639_102456552 285
190 3300026067 Ga0207678_10003768 Ga0207678_100037685 285
191 3300026088 Ga0207641_10011421 Ga0207641_100114215 285
192 3300026089 Ga0207648_10032350 Ga0207648_100323504 285
193 3300026089 Ga0207648_10157193 Ga0207648_101571934 285
194 3300026116 Ga0207674_10003678 Ga0207674_1000367810 285
195 3300026118 Ga0207675_100028535 Ga0207675_1000285353 285
196 3300026142 Ga0207698_10038595 Ga0207698_100385952 285
197 3300028380 Ga0268265_10006112 Ga0268265_100061125 285
198 3300028381 Ga0268264_10090619 Ga0268264_100906192 285
199 3300031852 Ga0307410_10008560 Ga0307410_100085603 285
200 3300031995 Ga0307409_100022858 Ga0307409_1000228583 285
201 3300037471 Ga0395905_0064478 Ga0395905_0064478_1553_2434 285
202 3300038443 Ga0395901_0562931 Ga0395901_0562931_215_1096 285
203 3300042120 Ga0450917_002309 Ga0450917_002309_14_895 285
204 3300042439 Ga0439464_0002720 Ga0439464_0002720_1204_2085 285
205 3300045836 Ga0466958_0032434 Ga0466958_0032434_31_918 285
206 3300048910 Ga0496107_0095605 Ga0496107_0095605_544_1425 285
207 3300048912 Ga0496109_0163473 Ga0496109_0163473_790_1671 285
208 3300050511 nmdc:mga08y16_109128_c1 nmdc:mga08y16_109128_c1_1008_1889 285
209 3300001915 JGI24741J21665_1012569 JGI24741J21665_10125692 286
210 3300001979 JGI24740J21852_10004688 JGI24740J21852_100046886 286
211 3300002067 JGI24735J21928_10003684 JGI24735J21928_100036844 286
212 3300005327 Ga0070658_10056657 Ga0070658_100566573 286
213 3300005329 Ga0070683_100007370 Ga0070683_1000073705 286
214 3300005329 Ga0070683_100024323 Ga0070683_1000243237 286
215 3300005329 Ga0070683_100030853 Ga0070683_1000308531 286
216 3300005339 Ga0070660_100003053 Ga0070660_1000030539 286
217 3300005339 Ga0070660_100135697 Ga0070660_1001356972 286
218 3300005341 Ga0070691_10100255 Ga0070691_101002551 286
219 3300005344 Ga0070661_100043365 Ga0070661_1000433652 286
220 3300005455 Ga0070663_100064637 Ga0070663_1000646372 286
221 3300005455 Ga0070663_100145911 Ga0070663_1001459112 286
222 3300005457 Ga0070662_100135304 Ga0070662_1001353043 286
223 3300005458 Ga0070681_10020408 Ga0070681_100204085 286
224 3300005458 Ga0070681_10089236 Ga0070681_100892365 286
225 3300005459 Ga0068867_100524900 Ga0068867_1005249001 286
226 3300005530 Ga0070679_100015769 Ga0070679_1000157693 286
227 3300005535 Ga0070684_100002671 Ga0070684_1000026714 286
228 3300005535 Ga0070684_100007613 Ga0070684_1000076138 286
229 3300005539 Ga0068853_100208835 Ga0068853_1002088352 286
230 3300005539 Ga0068853_100282443 Ga0068853_1002824432 286
231 3300005563 Ga0068855_100070606 Ga0068855_1000706065 286
232 3300005563 Ga0068855_100200509 Ga0068855_1002005091 286
233 3300005564 Ga0070664_100213626 Ga0070664_1002136262 286
234 3300005564 Ga0070664_100339574 Ga0070664_1003395742 286
235 3300005577 Ga0068857_100000489 Ga0068857_10000048933 286
236 3300005577 Ga0068857_100011147 Ga0068857_1000111477 286
237 3300005577 Ga0068857_100055724 Ga0068857_1000557245 286
238 3300005578 Ga0068854_100013400 Ga0068854_1000134008 286
239 3300005578 Ga0068854_100023845 Ga0068854_1000238455 286
240 3300005578 Ga0068854_100210139 Ga0068854_1002101392 286
241 3300005614 Ga0068856_100014742 Ga0068856_1000147427 286
242 3300005616 Ga0068852_100109232 Ga0068852_1001092322 286
243 3300005617 Ga0068859_100031971 Ga0068859_1000319715 286
244 3300005841 Ga0068863_100073550 Ga0068863_1000735502 286
245 3300005842 Ga0068858_100258040 Ga0068858_1002580403 286
246 3300005844 Ga0068862_100180236 Ga0068862_1001802362 286
247 3300006195 Ga0075366_10054612 Ga0075366_100546122 286
248 3300006931 Ga0097620_100031972 Ga0097620_1000319725 286
249 3300007076 Ga0075435_100184925 Ga0075435_1001849252 286
250 3300009093 Ga0105240_10123343 Ga0105240_101233433 286
251 3300009176 Ga0105242_10412671 Ga0105242_104126711 286
252 3300009545 Ga0105237_10087706 Ga0105237_100877063 286
253 3300013100 Ga0157373_10014198 Ga0157373_100141981 286
254 3300013100 Ga0157373_10075054 Ga0157373_100750544 286
255 3300013104 Ga0157370_10112664 Ga0157370_101126642 286
256 3300013105 Ga0157369_10063577 Ga0157369_100635773 286
257 3300013105 Ga0157369_10080955 Ga0157369_100809552 286
258 3300013105 Ga0157369_10648884 Ga0157369_106488841 286
259 3300013307 Ga0157372_10344688 Ga0157372_103446883 286
260 3300014325 Ga0163163_10020987 Ga0163163_100209875 286
261 3300020070 Ga0206356_11523657 Ga0206356_115236572 286
262 3300025899 Ga0207642_10008791 Ga0207642_100087912 286
263 3300025901 Ga0207688_10036293 Ga0207688_100362934 286
264 3300025904 Ga0207647_10007000 Ga0207647_100070005 286
265 3300025904 Ga0207647_10080105 Ga0207647_100801052 286
266 3300025909 Ga0207705_10000493 Ga0207705_1000049310 286
267 3300025909 Ga0207705_10049343 Ga0207705_100493433 286
268 3300025909 Ga0207705_10102955 Ga0207705_101029552 286
269 3300025912 Ga0207707_10025551 Ga0207707_100255516 286
270 3300025912 Ga0207707_10134697 Ga0207707_101346972 286
271 3300025912 Ga0207707_10411219 Ga0207707_104112192 286
272 3300025913 Ga0207695_10008855 Ga0207695_1000885510 286
273 3300025914 Ga0207671_10064244 Ga0207671_100642442 286
274 3300025917 Ga0207660_10000770 Ga0207660_100007706 286
275 3300025917 Ga0207660_10003208 Ga0207660_100032082 286
276 3300025917 Ga0207660_10139716 Ga0207660_101397164 286
277 3300025919 Ga0207657_10002261 Ga0207657_100022618 286
278 3300025919 Ga0207657_10006107 Ga0207657_100061079 286
279 3300025920 Ga0207649_10006255 Ga0207649_100062557 286
280 3300025921 Ga0207652_10000034 Ga0207652_10000034122 286
281 3300025924 Ga0207694_10080870 Ga0207694_100808702 286
282 3300025925 Ga0207650_10029644 Ga0207650_100296445 286
283 3300025932 Ga0207690_10003375 Ga0207690_100033755 286
284 3300025932 Ga0207690_10019381 Ga0207690_100193812 286
285 3300025932 Ga0207690_10069942 Ga0207690_100699423 286
286 3300025933 Ga0207706_10031454 Ga0207706_100314546 286
287 3300025940 Ga0207691_10062014 Ga0207691_100620143 286
288 3300025944 Ga0207661_10002378 Ga0207661_100023789 286
289 3300025944 Ga0207661_10002726 Ga0207661_1000272610 286
290 3300025944 Ga0207661_10012640 Ga0207661_100126402 286
291 3300025945 Ga0207679_10002993 Ga0207679_100029935 286
292 3300025949 Ga0207667_10004710 Ga0207667_1000471015 286
293 3300025949 Ga0207667_10069541 Ga0207667_100695412 286
294 3300025981 Ga0207640_10065894 Ga0207640_100658944 286
295 3300026035 Ga0207703_10010752 Ga0207703_100107524 286
296 3300026035 Ga0207703_10376282 Ga0207703_103762822 286
297 3300026041 Ga0207639_10001159 Ga0207639_1000115917 286
298 3300026041 Ga0207639_10059967 Ga0207639_100599673 286
299 3300026067 Ga0207678_10017937 Ga0207678_100179376 286
300 3300026067 Ga0207678_10189956 Ga0207678_101899562 286
301 3300026078 Ga0207702_10002063 Ga0207702_1000206319 286
302 3300026078 Ga0207702_10228530 Ga0207702_102285303 286
303 3300026095 Ga0207676_10037183 Ga0207676_100371833 286
304 3300026116 Ga0207674_10001507 Ga0207674_1000150736 286
305 3300026116 Ga0207674_10006843 Ga0207674_100068435 286
306 3300026116 Ga0207674_10012374 Ga0207674_100123746 286
307 3300026121 Ga0207683_10048901 Ga0207683_100489015 286
308 3300026142 Ga0207698_10000896 Ga0207698_1000089615 286
309 3300028380 Ga0268265_10016734 Ga0268265_100167346 286
310 3300028381 Ga0268264_10470999 Ga0268264_104709992 286
311 3300032002 Ga0307416_100009695 Ga0307416_1000096953 286
312 3300032002 Ga0307416_100047833 Ga0307416_1000478332 286
313 3300032126 Ga0307415_100001082 Ga0307415_10000108211 286
314 3300037418 Ga0395900_0003123 Ga0395900_0003123_9333_10217 286
315 3300037418 Ga0395900_0030498 Ga0395900_0030498_691_1578 286
316 3300037418 Ga0395900_0115619 Ga0395900_0115619_1097_1978 286
317 3300037418 Ga0395900_0263493 Ga0395900_0263493_815_1702 286
318 3300037466 Ga0395898_0028414 Ga0395898_0028414_453_1337 286
319 3300037471 Ga0395905_0056589 Ga0395905_0056589_725_1612 286
320 3300037471 Ga0395905_0064126 Ga0395905_0064126_1191_2075 286
321 3300037471 Ga0395905_0104259 Ga0395905_0104259_365_1249 286
322 3300037471 Ga0395905_0106386 Ga0395905_0106386_916_1797 286
323 3300037471 Ga0395905_0119565 Ga0395905_0119565_1257_2141 286
324 3300037471 Ga0395905_0513932 Ga0395905_0513932_102_986 286
325 3300038443 Ga0395901_0055690 Ga0395901_0055690_174_1061 286
326 3300038443 Ga0395901_0095192 Ga0395901_0095192_1340_2227 286
327 3300042157 Ga0439458_0001207 Ga0439458_0001207_4794_5675 286
328 3300044658 Ga0466972_0024067 Ga0466972_0024067_1202_2095 286
329 3300044684 Ga0466966_0007749 Ga0466966_0007749_4869_5750 286
330 3300044693 Ga0466961_0017856 Ga0466961_0017856_535_1416 286
331 3300044694 Ga0466963_0075812 Ga0466963_0075812_889_1779 286
332 3300044842 Ga0466957_0127070 Ga0466957_0127070_198_1088 286
333 3300044901 Ga0466960_0022409 Ga0466960_0022409_709_1602 286
334 3300045976 Ga0466967_0020997 Ga0466967_0020997_1793_2677 286
335 3300045976 Ga0466967_0113134 Ga0466967_0113134_1270_2154 286
336 3300048915 Ga0496112_0051014 Ga0496112_0051014_2995_3879 286
337 3300048915 Ga0496112_0057299 Ga0496112_0057299_400_1284 286
338 3300048916 Ga0496113_0214066 Ga0496113_0214066_464_1348 286

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00160

Pro_isomerase

Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD

45

230

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ex1-assembly2.cif.gz_D crystal structure of cyclophilin aquacyp300 from hirschia baltica 0.8899 28 286
5ex1-assembly2.cif.gz_D crystal structure of cyclophilin aquacyp300 from hirschia baltica 0.8284 28 286
5ex2-assembly2.cif.gz_B crystal structure of cyclophilin aquacyp293 from hirschia baltica 0.7701 14 284
5ex2-assembly2.cif.gz_B crystal structure of cyclophilin aquacyp293 from hirschia baltica 0.7512 14 284
2mvz-assembly1.cif.gz_A solution structure for cyclophilin a from geobacillus kaustophilus 0.7446 37 228
ID Description Score Start End Superfamily
2k57A00 Mainly Beta;Roll;SH3 type barrels.; 0.755 35 49 2.30.30.100
2mvzA00 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7446 37 228 2.40.100.10
3bduF00 Mainly Beta;Roll;SH3 type barrels.; 0.7387 36 51 2.30.30.100
af_Q94A16_75_230_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7228 35 233 2.40.100.10
af_Q86IX8_29_167_2.40.100.10 Mainly Beta;Beta Barrel;Cyclophilin;Cyclophilin-like 0.7201 39 202 2.40.100.10
ID Description Score Start End GO Terms
AF-A0A4Y8ZMQ5-F1-model_v4 Peptidylprolyl isomerase 0.9311 9 286 GO:0003755
AF-A0A511B0R3-F1-model_v4 Peptidyl-prolyl cis-trans isomerase 0.9265 50 286 GO:0003755
AF-A0A2Z6AIA0-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9242 13 286 GO:0003755
AF-A0A7W5HHF6-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.9235 15 283 GO:0003755
AF-T1BUV4-F1-model_v4 peptidylprolyl isomerase (EC 5.2.1.8) 0.923 9 261 GO:0140839
GO:0140840

Feature Viewer

pLDDT pTM Quality
85.69 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map