F413432

General Info

Members Datasets Scaffolds Average Seq Length
338 272 281 198

Family's Representative Sequence

Representative Sequence 3300005578|Ga0068854_100083216|Ga0068854_1000832164
Length 229
Sequence VIHVKGDLDCEGNASMRKGLRREAGVPRAWQRMLSGRRLDLLDPSPLDIEIEDIAHGLARVARWNGQTVGEHAFSVAQHSLVVEEILAHIEPGVAPRWRLAALLHDASEYVAGDLISPFKAALGLDYRKFEERLEAAIHLRFGLPAATPMEIKRLIKRADRASAYFEATALAGFGVDEAAALFDPPPAGLAISVEPLPPAQAQARYLQRHMVLSEAAGFAPHAQAFDTE

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
3 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
6 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
7 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
8 2516143018 Ensifer sp. BR816 Isolate Nodule
9 2519899620 Rhizobium sp. Pop5 Isolate Nodule
10 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
11 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
12 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
13 2643221618 Ensifer sp. Root231 Isolate Unclassified
14 2643221626 Ensifer sp. Root31 Isolate Unclassified
15 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
16 2643221655 Ensifer sp. Root1252 Isolate Unclassified
17 2643221659 Ensifer sp. Root127 Isolate Unclassified
18 2643221698 Ensifer sp. Root142 Isolate Unclassified
19 2643221712 Ensifer sp. Root258 Isolate Unclassified
20 2643221719 Rhizobium sp. Root274 Isolate Unclassified
21 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
22 2791355199
23 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
24 2791355260 Rhizobium sp. L9 Isolate Nodule
25 2791355263 Rhizobium chutanense C5 Isolate Nodule
26 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
27 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
28 2837678835 Jiella endophytica CBS5Q-3 Isolate Unclassified
29 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
30 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
31 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
32 2844163670 Ensifer sp. 1H6 Isolate Unclassified
33 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
34 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
35 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
36 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
37 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
38 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
39 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
40 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
41 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
42 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
43 2936381700 Rhizobium chutanense C16 Isolate Unclassified
44 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
45 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
46 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
47 2996893221 Rhizobium sp. R635 Isolate Nodule
48 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
49 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
50 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
51 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
54 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
55 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
56 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
57 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
58 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
59 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
60 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
68 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
100 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
111 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
134 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
139 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
152 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
162 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
172 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
173 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
174 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
177 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
178 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
184 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
185 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
195 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
215 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
216 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
217 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
218 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
219 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
220 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
221 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
230 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
231 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
239 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
249 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
250 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
253 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
254 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
258 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
259 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
260 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
261 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 8005382845 Rhizobium sp. R634 Isolate Nodule
265 8005395548 Rhizobium sp. R339 Isolate Nodule
266 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
267 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
268 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
269 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
270 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
271 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
272 8056382006 Rhizobium croatiense 13T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 83.09
Metatranscriptomes 0.3
Isolates 16.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.43
Nodule 8.88
Rhizoplane 6.21
Rhizosphere 55.92
Stem 0
Stem Tuber 0
Unclassified 16.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25150J39212_1003811 3300002774 Bacteria 3467
2 JGI25153J46596_10004553 3300003215 Bacteria 7444
3 Ga0055526_1006364 3300003771 Bacteria 6427
4 Ga0055524_1016859 3300003775 Bacteria 2598
5 Ga0055528_1001051 3300003790 Bacteria 18227
6 Ga0070676_10113650 3300005328 Bacteria 1690
7 Ga0070670_100004253 3300005331 Bacteria 11976
8 Ga0068869_100995775 3300005334 Bacteria 729
9 Ga0070689_100265215 3300005340 Bacteria 1420
10 Ga0070669_100306326 3300005353 Bacteria 1279
11 Ga0070673_100341223 3300005364 Bacteria 1327
12 Ga0070688_100421937 3300005365 Bacteria 992
13 Ga0070714_100037383 3300005435 Bacteria 4080
14 Ga0070713_100001936 3300005436 Bacteria 13367
15 Ga0070662_100164056 3300005457 Bacteria 1740
16 Ga0070681_10386792 3300005458 Bacteria 1310
17 Ga0070679_100069429 3300005530 Bacteria 3514
18 Ga0068853_100278720 3300005539 Bacteria 1541
19 Ga0070665_100161546 3300005548 Bacteria 2242
20 Ga0070704_100065840 3300005549 Bacteria 2610
21 Ga0068854_100083216 3300005578 Bacteria 2366
22 Ga0070702_100551644 3300005615 Bacteria 856
23 Ga0068864_100161748 3300005618 Bacteria 2035
24 Ga0068866_10229693 3300005718 Bacteria 1125
25 Ga0068861_100214131 3300005719 Bacteria 1624
26 Ga0068863_100167429 3300005841 Bacteria 2107
27 Ga0068863_100312066 3300005841 Bacteria 1526
28 Ga0068860_100416857 3300005843 Bacteria 1330
29 Ga0068860_100618633 3300005843 Bacteria 1089
30 Ga0068862_100027955 3300005844 Bacteria 4750
31 Ga0068862_100555794 3300005844 Bacteria 1096
32 Ga0081455_10033221 3300005937 Bacteria 4639
33 Ga0081540_1010925 3300005983 Bacteria 6098
34 Ga0081539_10022337 3300005985 Bacteria 4191
35 Ga0070717_10001632 3300006028 Bacteria 15573
36 Ga0075365_10000250 3300006038 Bacteria 18403
37 Ga0075368_10027147 3300006042 Bacteria 2206
38 Ga0075363_100007644 3300006048 Bacteria 4984
39 Ga0075367_10000755 3300006178 Bacteria 12619
40 Ga0075366_10120027 3300006195 Bacteria 1584
41 Ga0097621_100363956 3300006237 Bacteria 1289
42 Ga0075430_100274544 3300006846 Bacteria 1395
43 Ga0075434_100075472 3300006871 Bacteria 3365
44 Ga0068865_100056840 3300006881 Bacteria 2727
45 Ga0075435_100205801 3300007076 Bacteria 1668
46 Ga0111539_10119059 3300009094 Bacteria 3095
47 Ga0111539_10207300 3300009094 Bacteria 2285
48 Ga0105245_10409663 3300009098 Bacteria 1357
49 Ga0105247_10435828 3300009101 Bacteria 941
50 Ga0105243_10676614 3300009148 Bacteria 1003
51 Ga0105242_10336832 3300009176 Bacteria 1389
52 Ga0105248_10527079 3300009177 Bacteria 1332
53 Ga0105238_10256389 3300009551 Bacteria 1728
54 Ga0105249_10776812 3300009553 Bacteria 1021
55 Ga0123341_1000048 3300009765 Bacteria 50946
56 Ga0123342_1007095 3300009766 Bacteria 15043
57 Ga0105239_10224855 3300010375 Bacteria 2105
58 Ga0105239_10250964 3300010375 Bacteria 1987
59 Ga0105246_10878984 3300011119 Bacteria 802
60 Ga0157371_10219530 3300013102 Bacteria 1365
61 Ga0163162_10606079 3300013306 Bacteria 1221
62 Ga0157380_11554674 3300014326 Bacteria 716
63 Ga0182005_1024401 3300015265 Bacteria 1651
64 Ga0163161_10319920 3300017792 Bacteria 1226
65 Ga0209673_1000254 3300025273 Bacteria 101508
66 Ga0209673_1006773 3300025273 Bacteria 5444
67 Ga0209564_1000233 3300025295 Bacteria 121692
68 Ga0209758_1002345 3300025297 Bacteria 19516
69 Ga0209256_1001044 3300025299 Bacteria 32321
70 Ga0209257_1005089 3300025304 Bacteria 9548
71 Ga0207710_10372338 3300025900 Bacteria 730
72 Ga0207707_10311082 3300025912 Bacteria 1361
73 Ga0207662_10287681 3300025918 Bacteria 1089
74 Ga0207694_10879574 3300025924 Bacteria 757
75 Ga0207687_10067901 3300025927 Bacteria 2538
76 Ga0207700_10001432 3300025928 Bacteria 13527
77 Ga0207644_10143348 3300025931 Bacteria 1842
78 Ga0207686_10100691 3300025934 Bacteria 1928
79 Ga0207709_10585189 3300025935 Bacteria 882
80 Ga0207704_10196721 3300025938 Bacteria 1471
81 Ga0207689_10043629 3300025942 Bacteria 3707
82 Ga0207712_10034148 3300025961 Bacteria 3444
83 Ga0207668_10085328 3300025972 Bacteria 2303
84 Ga0207668_10097231 3300025972 Bacteria 2178
85 Ga0207640_10027977 3300025981 Bacteria 3441
86 Ga0207678_10097632 3300026067 Bacteria 2510
87 Ga0207683_10163112 3300026121 Bacteria 2016
88 Ga0207428_10331147 3300027907 Bacteria 1123
89 Ga0268266_10043752 3300028379 Bacteria 3827
90 Ga0268265_10431155 3300028380 Bacteria 1226
91 Ga0268264_10219003 3300028381 Bacteria 1751
92 Ga0307517_10000071 3300028786 Bacteria 138548
93 Ga0265762_1007013 3300030760 Bacteria 2014
94 Ga0307513_10212164 3300031456 Bacteria 1766
95 Ga0307509_10044557 3300031507 Bacteria 4792
96 Ga0307508_10004034 3300031616 Bacteria 14529
97 Ga0307516_10004621 3300031730 Bacteria 16891
98 Ga0307412_10613925 3300031911 Bacteria 923
99 Ga0307416_100964313 3300032002 Bacteria 955
100 Ga0307415_100538418 3300032126 Bacteria 1028
101 Ga0307510_10051086 3300033180 Bacteria 4377
102 Ga0307510_10108633 3300033180 Bacteria 2527
103 Ga0373944_0007301 3300035089 Bacteria 2957
104 Ga0373932_0086958 3300035112 Bacteria 997
105 Ga0373945_0211969 3300035116 Bacteria 808
106 Ga0373931_0004825 3300035691 Bacteria 6191
107 Ga0373935_0150413 3300035692 Bacteria 1579
108 Ga0373937_1159267 3300036401 Bacteria 721
109 Ga0373925_0564767 3300037068 Bacteria 936
110 Ga0439438_068099 3300041405 Bacteria 884
111 Ga0439461_0047237 3300041410 Bacteria 946
112 Ga0439465_0064700 3300041413 Bacteria 1217
113 Ga0439465_0118400 3300041413 Bacteria 927
114 Ga0451853_0679233 3300041512 Bacteria 1035
115 Ga0439431_0127191 3300041997 Bacteria 714
116 Ga0495592_0038397 3300046454 Bacteria 3603
117 Ga0495603_0003916 3300046455 Bacteria 8867
118 Ga0495590_0081289 3300046457 Bacteria 1141
119 Ga0495591_097198 3300046458 Bacteria 733
120 Ga0495638_0322777 3300046460 Bacteria 824
121 Ga0495641_0078089 3300046461 Bacteria 1484
122 Ga0495650_0091171 3300046471 Bacteria 1159
123 Ga0495650_0172656 3300046471 Bacteria 764
124 Ga0495584_0187094 3300046491 Bacteria 1052
125 Ga0495584_0259575 3300046491 Bacteria 883
126 Ga0495585_0242627 3300046492 Bacteria 901
127 Ga0495585_0367751 3300046492 Bacteria 696
128 Ga0495594_0038650 3300046499 Bacteria 2607
129 Ga0495606_0353300 3300046507 Bacteria 779
130 Ga0495610_0002783 3300046512 Bacteria 14321
131 Ga0495610_0017003 3300046512 Bacteria 4163
132 Ga0495618_0502672 3300046514 Bacteria 730
133 Ga0495620_0027880 3300046515 Bacteria 2636
134 Ga0495628_0611322 3300046516 Bacteria 778
135 Ga0495630_0018576 3300046517 Bacteria 5109
136 Ga0495631_0202234 3300046518 Bacteria 849
137 Ga0495632_0060382 3300046519 Bacteria 1842
138 Ga0495632_0161085 3300046519 Bacteria 1033
139 Ga0495637_0017700 3300046520 Bacteria 3315
140 Ga0495643_0062072 3300046522 Bacteria 1979
141 Ga0495643_0188916 3300046522 Bacteria 996
142 Ga0495643_0273248 3300046522 Bacteria 780
143 Ga0495644_0001026 3300046523 Bacteria 11635
144 Ga0495648_0094594 3300046524 Bacteria 1664
145 Ga0495663_0005573 3300046525 Bacteria 3489
146 Ga0495663_0021008 3300046525 Bacteria 1877
147 Ga0495642_0108061 3300046528 Bacteria 1188
148 Ga0495640_0125158 3300046533 Bacteria 1667
149 Ga0495622_0004476 3300046557 Bacteria 6478
150 Ga0495667_0026279 3300046559 Bacteria 3922
151 Ga0495656_0067916 3300046615 Bacteria 1574
152 Ga0495611_0374528 3300046648 Bacteria 652
153 Ga0495659_0001968 3300046664 Bacteria 6751
154 Ga0495659_0004161 3300046664 Bacteria 4567
155 Ga0495661_0213158 3300046665 Bacteria 1004
156 Ga0495599_0021621 3300046678 Bacteria 4014
157 Ga0495669_0000003 3300046684 Bacteria 267741
158 Ga0495670_0101556 3300046691 Bacteria 1481
159 Ga0495649_0008103 3300046694 Bacteria 6340
160 Ga0495674_0320320 3300047319 Bacteria 1263
161 Ga0495672_0000676 3300047320 Bacteria 37931
162 Ga0495672_0016264 3300047320 Bacteria 5020
163 Ga0495677_0015236 3300047445 Bacteria 2794
164 Ga0495679_016095 3300047446 Bacteria 2714
165 Ga0495686_0017733 3300047472 Bacteria 4792
166 Ga0495686_0229092 3300047472 Bacteria 1053
167 Ga0495686_0344914 3300047472 Bacteria 811
168 Ga0495593_0011207 3300047673 Bacteria 5155
169 Ga0495602_0064039 3300048088 Bacteria 3182
170 Ga0496100_0442609 3300048903 Bacteria 995
171 Ga0496102_0156146 3300048905 Bacteria 2145
172 Ga0496102_0240190 3300048905 Bacteria 1708
173 Ga0496102_0683880 3300048905 Bacteria 949
174 Ga0496105_0059992 3300048908 Bacteria 3138
175 Ga0496106_0000154 3300048909 Bacteria 50775
176 Ga0496106_0095493 3300048909 Bacteria 2300
177 Ga0496106_0129227 3300048909 Bacteria 1980
178 Ga0496106_0584223 3300048909 Bacteria 895
179 Ga0496106_0628683 3300048909 Bacteria 859
180 Ga0496107_0122320 3300048910 Bacteria 1917
181 Ga0496108_0652905 3300048911 Bacteria 914
182 Ga0496109_0067561 3300048912 Bacteria 3275
183 Ga0496109_0393375 3300048912 Bacteria 1310
184 Ga0496110_0118748 3300048913 Bacteria 2381
185 Ga0496110_0789595 3300048913 Bacteria 854
186 Ga0496111_0074390 3300048914 Bacteria 2474
187 Ga0496112_0018718 3300048915 Bacteria 6527
188 Ga0496112_0078917 3300048915 Bacteria 3255
189 Ga0496113_0063291 3300048916 Bacteria 2795
190 Ga0496115_0788319 3300048918 Bacteria 740
191 Ga0496116_0125834 3300048919 Bacteria 1472
192 Ga0496116_0157596 3300048919 Bacteria 1251
193 Ga0496117_0040784 3300048920 Bacteria 3410
194 Ga0496117_0047769 3300048920 Bacteria 3065
195 Ga0496117_0337904 3300048920 Bacteria 782
196 Ga0496118_0004792 3300048921 Bacteria 15799
197 Ga0496118_0026036 3300048921 Bacteria 4996
198 Ga0496118_0194957 3300048921 Bacteria 1207
199 Ga0496119_0000308 3300048922 Bacteria 68303
200 Ga0496119_0251029 3300048922 Bacteria 892
201 Ga0496119_0420956 3300048922 Bacteria 634
202 Ga0496121_0054565 3300048924 Bacteria 3337
203 Ga0496121_0067181 3300048924 Bacteria 2906
204 Ga0496121_0090179 3300048924 Bacteria 2397
205 Ga0496121_0220641 3300048924 Bacteria 1336
206 Ga0496122_0001649 3300048925 Bacteria 34644
207 Ga0496122_0056613 3300048925 Bacteria 2921
208 Ga0496122_0202958 3300048925 Bacteria 1157
209 Ga0496123_0000602 3300048926 Bacteria 61127
210 Ga0496124_0000679 3300048927 Bacteria 55901
211 Ga0496124_0099371 3300048927 Bacteria 2360
212 Ga0496124_0422234 3300048927 Bacteria 918
213 Ga0496125_0015700 3300048928 Bacteria 7305
214 Ga0496126_0005092 3300048929 Bacteria 15243
215 Ga0496126_0392474 3300048929 Bacteria 1127
216 Ga0495678_008499 3300049459 Bacteria 5172
217 Ga0495682_0089639 3300049460 Bacteria 1105
218 Ga0501032_0002287 3300049569 Bacteria 15039
219 Ga0501033_0475374 3300049570 Bacteria 866
220 Ga0501034_0063584 3300049571 Bacteria 3704
221 Ga0501034_0254034 3300049571 Bacteria 1702
222 Ga0501034_0300699 3300049571 Bacteria 1541
223 Ga0501034_0396184 3300049571 Bacteria 1304
224 Ga0501037_0384698 3300049573 Bacteria 964
225 Ga0501041_0212973 3300049577 Bacteria 1212
226 Ga0501043_0009027 3300049579 Bacteria 7844
227 Ga0501043_0129149 3300049579 Bacteria 1981
228 Ga0501046_0497022 3300049580 Bacteria 874
229 Ga0501047_0030447 3300049581 Bacteria 5203
230 Ga0501047_0648955 3300049581 Bacteria 875
231 Ga0501047_0796042 3300049581 Bacteria 760
232 Ga0501067_0001421 3300049583 Bacteria 12986
233 Ga0501067_0059863 3300049583 Bacteria 2108
234 Ga0501068_0004001 3300049584 Bacteria 8023
235 Ga0501069_0071746 3300049585 Bacteria 1941
236 Ga0501070_0063146 3300049586 Bacteria 3068
237 Ga0501073_0000010 3300049589 Bacteria 171144
238 Ga0501073_0005784 3300049589 Bacteria 9242
239 Ga0501073_0054148 3300049589 Bacteria 2810
240 Ga0501076_0506302 3300049592 Bacteria 995
241 Ga0501076_0511493 3300049592 Bacteria 990
242 Ga0501077_0000019 3300049593 Bacteria 81775
243 Ga0501079_0141396 3300049741 Bacteria 1875
244 Ga0501079_0497689 3300049741 Bacteria 958
245 Ga0501080_0002297 3300049742 Bacteria 16660
246 Ga0501083_0023824 3300049744 Bacteria 4244
247 Ga0501035_0203419 3300049822 Bacteria 1697
248 Ga0501044_0009824 3300049823 Bacteria 10404
249 Ga0501044_0082394 3300049823 Bacteria 3255
250 nmdc:mga03683_26758_c1 3300050489 Bacteria 2278
251 nmdc:mga03n38_225876_c1 3300050490 Bacteria 979
252 nmdc:mga00v17_21661_c1 3300050491 Bacteria 3698
253 nmdc:mga07m45_443971_c1 3300050496 Bacteria 752
254 nmdc:mga06r32_486010_c1 3300050510 Bacteria 1212
255 nmdc:mga0n895_68916_c1 3300050512 Bacteria 3504
256 nmdc:mga0rr50_67861_c1 3300050513 Bacteria 2710
257 nmdc:mga0sz30_89336_c1 3300050516 Bacteria 1339
258 nmdc:mga0sz30_9957_c1 3300050516 Bacteria 3632
259 Ga0495655_0094162 3300053083 Bacteria 877
260 Ga0495595_0002267 3300053084 Bacteria 7489
261 Ga0500644_0081340 3300053088 Bacteria 1192
262 Ga0500556_0000017 3300053104 Bacteria 192495
263 Ga0500595_047089 3300053119 Bacteria 1353
264 Ga0500652_046770 3300053131 Bacteria 1757
265 Ga0500658_0013211 3300053134 Bacteria 3049
266 Ga0500658_0245188 3300053134 Bacteria 823
267 Ga0500658_0426888 3300053134 Bacteria 605
268 Ga0500568_0000811 3300053139 Bacteria 21961
269 Ga0500568_0053844 3300053139 Bacteria 1576
270 Ga0500568_0196865 3300053139 Bacteria 739
271 Ga0500604_0030333 3300053151 Bacteria 1581
272 Ga0500622_0000322 3300053156 Bacteria 48225
273 Ga0500622_0001215 3300053156 Bacteria 21197
274 Ga0500633_0031333 3300053160 Bacteria 1718
275 Ga0500576_229820 3300053725 Bacteria 599
276 Ga0500611_036202 3300053727 Bacteria 1056
277 Ga0500645_006578 3300053730 Bacteria 4128
278 Ga0500645_039073 3300053730 Bacteria 1407
279 Ga0500645_058828 3300053730 Bacteria 1113
280 Ga0500645_093865 3300053730 Bacteria 850
281 Ga0501082_0101400 3300060353 Bacteria 2490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048920 Ga0496117_0337904 Ga0496117_0337904_27_542 171
2 3300041405 Ga0439438_068099 Ga0439438_068099_103_660 180
3 3300005530 Ga0070679_100069429 Ga0070679_1000694294 182
4 3300006237 Ga0097621_100363956 Ga0097621_1003639562 183
5 3300049570 Ga0501033_0475374 Ga0501033_0475374_155_709 183
6 3300049571 Ga0501034_0063584 Ga0501034_0063584_2567_3121 183
7 3300049571 Ga0501034_0396184 Ga0501034_0396184_524_1078 183
8 3300049823 Ga0501044_0082394 Ga0501044_0082394_2201_2755 183
9 3300005539 Ga0068853_100278720 Ga0068853_1002787202 184
10 3300006881 Ga0068865_100056840 Ga0068865_1000568402 184
11 3300009094 Ga0111539_10119059 Ga0111539_101190593 184
12 3300014326 Ga0157380_11554674 Ga0157380_115546741 184
13 3300025927 Ga0207687_10067901 Ga0207687_100679013 184
14 3300041997 Ga0439431_0127191 Ga0439431_0127191_48_611 184
15 3300046460 Ga0495638_0322777 Ga0495638_0322777_55_618 184
16 3300046664 Ga0495659_0004161 Ga0495659_0004161_3294_3857 184
17 3300047319 Ga0495674_0320320 Ga0495674_0320320_208_765 184
18 3300047320 Ga0495672_0000676 Ga0495672_0000676_3509_4066 184
19 3300048903 Ga0496100_0442609 Ga0496100_0442609_395_958 184
20 3300048905 Ga0496102_0683880 Ga0496102_0683880_26_589 184
21 3300049571 Ga0501034_0254034 Ga0501034_0254034_486_1043 184
22 3300049577 Ga0501041_0212973 Ga0501041_0212973_30_593 184
23 3300049580 Ga0501046_0497022 Ga0501046_0497022_32_595 184
24 3300049581 Ga0501047_0030447 Ga0501047_0030447_2741_3298 184
25 3300049581 Ga0501047_0796042 Ga0501047_0796042_10_573 184
26 3300049822 Ga0501035_0203419 Ga0501035_0203419_883_1440 184
27 3300053083 Ga0495655_0094162 Ga0495655_0094162_254_817 184
28 3300053119 Ga0500595_047089 Ga0500595_047089_538_1095 184
29 3300053134 Ga0500658_0245188 Ga0500658_0245188_53_616 184
30 3300053134 Ga0500658_0426888 Ga0500658_0426888_29_592 184
31 3300053725 Ga0500576_229820 Ga0500576_229820_15_572 184
32 3300006042 Ga0075368_10027147 Ga0075368_100271473 185
33 3300006048 Ga0075363_100007644 Ga0075363_1000076445 185
34 3300006178 Ga0075367_10000755 Ga0075367_100007552 185
35 3300013306 Ga0163162_10606079 Ga0163162_106060792 185
36 3300015265 Ga0182005_1024401 Ga0182005_10244012 185
37 3300025900 Ga0207710_10372338 Ga0207710_103723381 185
38 3300030760 Ga0265762_1007013 Ga0265762_10070132 185
39 3300035089 Ga0373944_0007301 Ga0373944_0007301_727_1293 185
40 3300046454 Ga0495592_0038397 Ga0495592_0038397_2054_2620 185
41 3300046491 Ga0495584_0187094 Ga0495584_0187094_292_858 185
42 3300046514 Ga0495618_0502672 Ga0495618_0502672_99_665 185
43 3300046516 Ga0495628_0611322 Ga0495628_0611322_178_744 185
44 3300046517 Ga0495630_0018576 Ga0495630_0018576_3328_3894 185
45 3300046520 Ga0495637_0017700 Ga0495637_0017700_2589_3155 185
46 3300046523 Ga0495644_0001026 Ga0495644_0001026_5400_5966 185
47 3300046525 Ga0495663_0005573 Ga0495663_0005573_1805_2371 185
48 3300046533 Ga0495640_0125158 Ga0495640_0125158_127_693 185
49 3300046559 Ga0495667_0026279 Ga0495667_0026279_1981_2547 185
50 3300046664 Ga0495659_0001968 Ga0495659_0001968_5239_5805 185
51 3300046665 Ga0495661_0213158 Ga0495661_0213158_168_734 185
52 3300046678 Ga0495599_0021621 Ga0495599_0021621_2772_3338 185
53 3300047446 Ga0495679_016095 Ga0495679_016095_735_1301 185
54 3300047673 Ga0495593_0011207 Ga0495593_0011207_1198_1764 185
55 3300048088 Ga0495602_0064039 Ga0495602_0064039_596_1162 185
56 3300048909 Ga0496106_0628683 Ga0496106_0628683_139_705 185
57 3300048915 Ga0496112_0078917 Ga0496112_0078917_439_1005 185
58 3300050489 nmdc:mga03683_26758_c1 nmdc:mga03683_26758_c1_1643_2209 185
59 3300050490 nmdc:mga03n38_225876_c1 nmdc:mga03n38_225876_c1_265_831 185
60 3300050491 nmdc:mga00v17_21661_c1 nmdc:mga00v17_21661_c1_1021_1587 185
61 3300050516 nmdc:mga0sz30_9957_c1 nmdc:mga0sz30_9957_c1_1791_2357 185
62 3300053084 Ga0495595_0002267 Ga0495595_0002267_964_1530 185
63 3300025304 Ga0209257_1005089 Ga0209257_100508910 188
64 3300031911 Ga0307412_10613925 Ga0307412_106139252 188
65 3300035692 Ga0373935_0150413 Ga0373935_0150413_806_1399 188
66 3300037068 Ga0373925_0564767 Ga0373925_0564767_50_643 188
67 3300046471 Ga0495650_0172656 Ga0495650_0172656_14_580 188
68 3300046507 Ga0495606_0353300 Ga0495606_0353300_13_579 188
69 3300046512 Ga0495610_0002783 Ga0495610_0002783_2928_3494 188
70 3300046515 Ga0495620_0027880 Ga0495620_0027880_1452_2018 188
71 3300046519 Ga0495632_0060382 Ga0495632_0060382_621_1187 188
72 3300046522 Ga0495643_0188916 Ga0495643_0188916_311_877 188
73 3300046684 Ga0495669_0000003 Ga0495669_0000003_265593_266186 188
74 3300047445 Ga0495677_0015236 Ga0495677_0015236_1598_2191 188
75 3300047472 Ga0495686_0017733 Ga0495686_0017733_2124_2690 188
76 3300049459 Ga0495678_008499 Ga0495678_008499_3925_4491 188
77 3300049569 Ga0501032_0002287 Ga0501032_0002287_3289_3867 188
78 3300049579 Ga0501043_0009027 Ga0501043_0009027_4756_5334 188
79 3300049581 Ga0501047_0648955 Ga0501047_0648955_197_775 188
80 3300049583 Ga0501067_0001421 Ga0501067_0001421_4430_5008 188
81 3300049584 Ga0501068_0004001 Ga0501068_0004001_4745_5323 188
82 3300049586 Ga0501070_0063146 Ga0501070_0063146_2074_2667 188
83 3300049589 Ga0501073_0000010 Ga0501073_0000010_119978_120556 188
84 3300049593 Ga0501077_0000019 Ga0501077_0000019_74545_75123 188
85 3300049742 Ga0501080_0002297 Ga0501080_0002297_4112_4690 188
86 3300049823 Ga0501044_0009824 Ga0501044_0009824_9203_9781 188
87 3300053730 Ga0500645_058828 Ga0500645_058828_492_1088 188
88 3300048922 Ga0496119_0251029 Ga0496119_0251029_185_754 189
89 3300003771 Ga0055526_1006364 Ga0055526_10063645 190
90 3300003790 Ga0055528_1001051 Ga0055528_10010514 190
91 3300009765 Ga0123341_1000048 Ga0123341_100004817 190
92 3300009766 Ga0123342_1007095 Ga0123342_100709512 190
93 3300046512 Ga0495610_0017003 Ga0495610_0017003_2625_3197 190
94 3300046522 Ga0495643_0062072 Ga0495643_0062072_1204_1776 190
95 3300046524 Ga0495648_0094594 Ga0495648_0094594_575_1147 190
96 3300046694 Ga0495649_0008103 Ga0495649_0008103_2408_2980 190
97 3300047472 Ga0495686_0344914 Ga0495686_0344914_194_766 190
98 3300048909 Ga0496106_0000154 Ga0496106_0000154_20435_21007 190
99 3300048909 Ga0496106_0129227 Ga0496106_0129227_721_1293 190
100 3300048919 Ga0496116_0125834 Ga0496116_0125834_886_1458 190
101 3300048920 Ga0496117_0040784 Ga0496117_0040784_2407_2979 190
102 3300048920 Ga0496117_0047769 Ga0496117_0047769_1861_2433 190
103 3300048921 Ga0496118_0004792 Ga0496118_0004792_4630_5202 190
104 3300048921 Ga0496118_0026036 Ga0496118_0026036_1065_1637 190
105 3300048921 Ga0496118_0194957 Ga0496118_0194957_551_1123 190
106 3300048922 Ga0496119_0420956 Ga0496119_0420956_44_616 190
107 3300048924 Ga0496121_0054565 Ga0496121_0054565_1063_1635 190
108 3300048924 Ga0496121_0067181 Ga0496121_0067181_1949_2521 190
109 3300048924 Ga0496121_0090179 Ga0496121_0090179_1440_2012 190
110 3300048925 Ga0496122_0056613 Ga0496122_0056613_565_1137 190
111 3300048925 Ga0496122_0202958 Ga0496122_0202958_29_601 190
112 3300048927 Ga0496124_0099371 Ga0496124_0099371_1482_2054 190
113 3300048928 Ga0496125_0015700 Ga0496125_0015700_4864_5436 190
114 3300048929 Ga0496126_0392474 Ga0496126_0392474_214_786 190
115 3300049579 Ga0501043_0129149 Ga0501043_0129149_977_1549 190
116 3300049589 Ga0501073_0054148 Ga0501073_0054148_1713_2285 190
117 3300049744 Ga0501083_0023824 Ga0501083_0023824_3234_3806 190
118 3300050496 nmdc:mga07m45_443971_c1 nmdc:mga07m45_443971_c1_159_731 190
119 3300050516 nmdc:mga0sz30_89336_c1 nmdc:mga0sz30_89336_c1_314_886 190
120 3300053088 Ga0500644_0081340 Ga0500644_0081340_38_610 190
121 3300053134 Ga0500658_0013211 Ga0500658_0013211_1924_2496 190
122 3300053139 Ga0500568_0000811 Ga0500568_0000811_10232_10804 190
123 3300053139 Ga0500568_0053844 Ga0500568_0053844_20_592 190
124 3300053151 Ga0500604_0030333 Ga0500604_0030333_229_801 190
125 3300053156 Ga0500622_0000322 Ga0500622_0000322_33163_33735 190
126 3300053160 Ga0500633_0031333 Ga0500633_0031333_578_1150 190
127 3300053730 Ga0500645_093865 Ga0500645_093865_238_813 190
128 3300060353 Ga0501082_0101400 Ga0501082_0101400_558_1130 190
129 3300041413 Ga0439465_0118400 Ga0439465_0118400_62_700 191
130 3300006871 Ga0075434_100075472 Ga0075434_1000754722 193
131 3300007076 Ga0075435_100205801 Ga0075435_1002058013 193
132 3300048909 Ga0496106_0095493 Ga0496106_0095493_38_628 193
133 3300049571 Ga0501034_0300699 Ga0501034_0300699_658_1254 193
134 3300050512 nmdc:mga0n895_68916_c1 nmdc:mga0n895_68916_c1_496_1086 193
135 3300050513 nmdc:mga0rr50_67861_c1 nmdc:mga0rr50_67861_c1_1718_2308 193
136 3300003215 JGI25153J46596_10004553 JGI25153J46596_100045537 194
137 3300005334 Ga0068869_100995775 Ga0068869_1009957751 194
138 3300005435 Ga0070714_100037383 Ga0070714_1000373834 194
139 3300005436 Ga0070713_100001936 Ga0070713_1000019362 194
140 3300005457 Ga0070662_100164056 Ga0070662_1001640561 194
141 3300005458 Ga0070681_10386792 Ga0070681_103867922 194
142 3300005548 Ga0070665_100161546 Ga0070665_1001615461 194
143 3300005549 Ga0070704_100065840 Ga0070704_1000658403 194
144 3300005615 Ga0070702_100551644 Ga0070702_1005516442 194
145 3300005618 Ga0068864_100161748 Ga0068864_1001617481 194
146 3300005718 Ga0068866_10229693 Ga0068866_102296932 194
147 3300005719 Ga0068861_100214131 Ga0068861_1002141313 194
148 3300005841 Ga0068863_100312066 Ga0068863_1003120662 194
149 3300005843 Ga0068860_100416857 Ga0068860_1004168571 194
150 3300005844 Ga0068862_100027955 Ga0068862_1000279553 194
151 3300005844 Ga0068862_100555794 Ga0068862_1005557942 194
152 3300005937 Ga0081455_10033221 Ga0081455_100332213 194
153 3300005983 Ga0081540_1010925 Ga0081540_10109252 194
154 3300005985 Ga0081539_10022337 Ga0081539_100223373 194
155 3300006028 Ga0070717_10001632 Ga0070717_1000163210 194
156 3300006195 Ga0075366_10120027 Ga0075366_101200273 194
157 3300009094 Ga0111539_10207300 Ga0111539_102073003 194
158 3300009098 Ga0105245_10409663 Ga0105245_104096632 194
159 3300009101 Ga0105247_10435828 Ga0105247_104358282 194
160 3300009148 Ga0105243_10676614 Ga0105243_106766141 194
161 3300009551 Ga0105238_10256389 Ga0105238_102563893 194
162 3300009553 Ga0105249_10776812 Ga0105249_107768122 194
163 3300010375 Ga0105239_10250964 Ga0105239_102509642 194
164 3300013102 Ga0157371_10219530 Ga0157371_102195302 194
165 3300017792 Ga0163161_10319920 Ga0163161_103199202 194
166 3300025297 Ga0209758_1002345 Ga0209758_100234515 194
167 3300025912 Ga0207707_10311082 Ga0207707_103110822 194
168 3300025918 Ga0207662_10287681 Ga0207662_102876812 194
169 3300025924 Ga0207694_10879574 Ga0207694_108795742 194
170 3300025928 Ga0207700_10001432 Ga0207700_100014322 194
171 3300025935 Ga0207709_10585189 Ga0207709_105851891 194
172 3300025942 Ga0207689_10043629 Ga0207689_100436293 194
173 3300025961 Ga0207712_10034148 Ga0207712_100341483 194
174 3300025972 Ga0207668_10085328 Ga0207668_100853283 194
175 3300025972 Ga0207668_10097231 Ga0207668_100972312 194
176 3300026067 Ga0207678_10097632 Ga0207678_100976322 194
177 3300026121 Ga0207683_10163112 Ga0207683_101631122 194
178 3300027907 Ga0207428_10331147 Ga0207428_103311471 194
179 3300028379 Ga0268266_10043752 Ga0268266_100437522 194
180 3300028380 Ga0268265_10431155 Ga0268265_104311552 194
181 3300028381 Ga0268264_10219003 Ga0268264_102190032 194
182 3300032002 Ga0307416_100964313 Ga0307416_1009643132 194
183 3300032126 Ga0307415_100538418 Ga0307415_1005384181 194
184 3300041413 Ga0439465_0064700 Ga0439465_0064700_365_976 194
185 3300046457 Ga0495590_0081289 Ga0495590_0081289_486_1097 194
186 3300046458 Ga0495591_097198 Ga0495591_097198_33_644 194
187 3300046491 Ga0495584_0259575 Ga0495584_0259575_224_835 194
188 3300046492 Ga0495585_0242627 Ga0495585_0242627_62_673 194
189 3300046492 Ga0495585_0367751 Ga0495585_0367751_58_669 194
190 3300046518 Ga0495631_0202234 Ga0495631_0202234_89_700 194
191 3300046522 Ga0495643_0273248 Ga0495643_0273248_94_705 194
192 3300046525 Ga0495663_0021008 Ga0495663_0021008_104_715 194
193 3300046528 Ga0495642_0108061 Ga0495642_0108061_200_811 194
194 3300046615 Ga0495656_0067916 Ga0495656_0067916_348_959 194
195 3300046648 Ga0495611_0374528 Ga0495611_0374528_21_632 194
196 3300046691 Ga0495670_0101556 Ga0495670_0101556_286_897 194
197 3300047472 Ga0495686_0229092 Ga0495686_0229092_156_767 194
198 3300048905 Ga0496102_0156146 Ga0496102_0156146_1421_2032 194
199 3300048909 Ga0496106_0584223 Ga0496106_0584223_145_756 194
200 3300048912 Ga0496109_0393375 Ga0496109_0393375_447_1058 194
201 3300048919 Ga0496116_0157596 Ga0496116_0157596_23_634 194
202 3300048924 Ga0496121_0220641 Ga0496121_0220641_411_1022 194
203 3300048927 Ga0496124_0422234 Ga0496124_0422234_149_760 194
204 3300049573 Ga0501037_0384698 Ga0501037_0384698_90_701 194
205 3300049583 Ga0501067_0059863 Ga0501067_0059863_900_1511 194
206 3300049585 Ga0501069_0071746 Ga0501069_0071746_16_627 194
207 3300049592 Ga0501076_0506302 Ga0501076_0506302_354_965 194
208 3300049592 Ga0501076_0511493 Ga0501076_0511493_250_861 194
209 3300049741 Ga0501079_0497689 Ga0501079_0497689_119_730 194
210 3300050510 nmdc:mga06r32_486010_c1 nmdc:mga06r32_486010_c1_169_780 194
211 3300053139 Ga0500568_0196865 Ga0500568_0196865_47_658 194
212 3300053727 Ga0500611_036202 Ga0500611_036202_337_948 194
213 3300053730 Ga0500645_039073 Ga0500645_039073_262_876 194
214 iso_pu_bacteria 2513237101 2513693204 194
215 iso_pu_bacteria 2515154112 2515631418 194
216 iso_pu_bacteria 2791355199 2793078182 194
217 iso_pu_bacteria 2828305725 2828308119 194
218 iso_pu_bacteria 2874604998 2874607795 194
219 iso_pu_bacteria 2876808645 2876818131 194
220 iso_pu_bacteria 2879110137 2879110791 194
221 iso_pu_bacteria 2885374607 2885379781 194
222 iso_pu_bacteria 2922361189 2922361505 194
223 iso_pu_bacteria 8006984368 8006985161 194
224 iso_pu_bacteria 8006994254 8007000855 194
225 3300005328 Ga0070676_10113650 Ga0070676_101136502 195
226 3300005340 Ga0070689_100265215 Ga0070689_1002652152 195
227 3300005364 Ga0070673_100341223 Ga0070673_1003412232 195
228 3300005365 Ga0070688_100421937 Ga0070688_1004219372 195
229 3300005841 Ga0068863_100167429 Ga0068863_1001674293 195
230 3300005843 Ga0068860_100618633 Ga0068860_1006186332 195
231 3300006846 Ga0075430_100274544 Ga0075430_1002745442 195
232 3300011119 Ga0105246_10878984 Ga0105246_108789842 195
233 3300025938 Ga0207704_10196721 Ga0207704_101967212 195
234 3300028786 Ga0307517_10000071 Ga0307517_1000007163 195
235 3300031507 Ga0307509_10044557 Ga0307509_100445573 195
236 3300031616 Ga0307508_10004034 Ga0307508_1000403413 195
237 3300033180 Ga0307510_10051086 Ga0307510_100510864 195
238 3300036401 Ga0373937_1159267 Ga0373937_1159267_20_628 195
239 3300041410 Ga0439461_0047237 Ga0439461_0047237_65_691 195
240 3300046455 Ga0495603_0003916 Ga0495603_0003916_2039_2662 195
241 3300046461 Ga0495641_0078089 Ga0495641_0078089_202_825 195
242 3300046471 Ga0495650_0091171 Ga0495650_0091171_79_702 195
243 3300046499 Ga0495594_0038650 Ga0495594_0038650_561_1184 195
244 3300046519 Ga0495632_0161085 Ga0495632_0161085_98_721 195
245 3300046557 Ga0495622_0004476 Ga0495622_0004476_181_804 195
246 3300047320 Ga0495672_0016264 Ga0495672_0016264_858_1472 195
247 3300048913 Ga0496110_0789595 Ga0496110_0789595_52_666 195
248 3300048922 Ga0496119_0000308 Ga0496119_0000308_34390_35016 195
249 3300048925 Ga0496122_0001649 Ga0496122_0001649_28961_29587 195
250 3300048926 Ga0496123_0000602 Ga0496123_0000602_10817_11443 195
251 3300048929 Ga0496126_0005092 Ga0496126_0005092_10439_11062 195
252 3300053104 Ga0500556_0000017 Ga0500556_0000017_172735_173361 195
253 3300053131 Ga0500652_046770 Ga0500652_046770_10_636 195
254 3300053730 Ga0500645_006578 Ga0500645_006578_1706_2332 195
255 iso_pu_bacteria 2513237137 2513863243 195
256 iso_pu_bacteria 2516143018 2516208856 195
257 iso_pu_bacteria 2643221618 2644109020 195
258 iso_pu_bacteria 2643221626 2644151542 195
259 iso_pu_bacteria 2643221655 2644311676 195
260 iso_pu_bacteria 2643221659 2644329934 195
261 iso_pu_bacteria 2643221698 2644546608 195
262 iso_pu_bacteria 2643221712 2644617475 195
263 iso_pu_bacteria 2844163670 2844168545 195
264 iso_pu_bacteria 2903748898 2903753622 195
265 iso_pu_bacteria 2941499720 2941500244 195
266 iso_pu_bacteria 3005474847 3005477500 195
267 iso_pu_bacteria 8005395548 8005400177 195
268 iso_pu_bacteria 8006964411 8006968954 195
269 3300009176 Ga0105242_10336832 Ga0105242_103368322 196
270 3300009177 Ga0105248_10527079 Ga0105248_105270791 196
271 3300010375 Ga0105239_10224855 Ga0105239_102248551 196
272 3300025931 Ga0207644_10143348 Ga0207644_101433483 196
273 3300025934 Ga0207686_10100691 Ga0207686_101006913 196
274 3300031730 Ga0307516_10004621 Ga0307516_100046212 196
275 3300033180 Ga0307510_10108633 Ga0307510_101086332 196
276 3300035112 Ga0373932_0086958 Ga0373932_0086958_250_873 196
277 3300035116 Ga0373945_0211969 Ga0373945_0211969_39_662 196
278 3300035691 Ga0373931_0004825 Ga0373931_0004825_2552_3175 196
279 3300041512 Ga0451853_0679233 Ga0451853_0679233_81_707 196
280 3300048905 Ga0496102_0240190 Ga0496102_0240190_742_1365 196
281 3300048908 Ga0496105_0059992 Ga0496105_0059992_35_658 196
282 3300048910 Ga0496107_0122320 Ga0496107_0122320_735_1358 196
283 3300048911 Ga0496108_0652905 Ga0496108_0652905_40_666 196
284 3300048912 Ga0496109_0067561 Ga0496109_0067561_2284_2907 196
285 3300048913 Ga0496110_0118748 Ga0496110_0118748_705_1331 196
286 3300048914 Ga0496111_0074390 Ga0496111_0074390_586_1212 196
287 3300048915 Ga0496112_0018718 Ga0496112_0018718_3324_3947 196
288 3300048916 Ga0496113_0063291 Ga0496113_0063291_697_1320 196
289 3300048918 Ga0496115_0788319 Ga0496115_0788319_19_642 196
290 3300049460 Ga0495682_0089639 Ga0495682_0089639_181_807 196
291 iso_pu_bacteria 2513237138 2513868732 197
292 iso_pu_bacteria 2582581867 2585400162 197
293 iso_pu_bacteria 2585427590 2585822721 197
294 iso_pu_bacteria 2615840624 2616296246 197
295 iso_pu_bacteria 2791355260 2793321137 197
296 iso_pu_bacteria 2838022645 2838023201 197
297 iso_pu_bacteria 2842198810 2842199629 197
298 iso_pu_bacteria 2923556063 2923557607 197
299 iso_pu_bacteria 2996893221 2996895040 197
300 iso_pu_bacteria 8018127388 8018131296 197
301 iso_pu_bacteria 8056382006 8056384790 197
302 3300049589 Ga0501073_0005784 Ga0501073_0005784_6956_7567 198
303 3300049741 Ga0501079_0141396 Ga0501079_0141396_794_1405 198
304 3300053156 Ga0500622_0001215 Ga0500622_0001215_14253_14873 198
305 iso_pu_bacteria 2509276033 2509443112 198
306 iso_pu_bacteria 2510917030 2511197221 198
307 iso_pu_bacteria 2515075009 2515111250 198
308 iso_pu_bacteria 2519899620 2520375290 198
309 iso_pu_bacteria 2791355259 2793317490 198
310 iso_pu_bacteria 2791355263 2793339838 198
311 iso_pu_bacteria 2838042994 2838048025 198
312 iso_pu_bacteria 2894817345 2894819559 198
313 iso_pu_bacteria 2917554339 2917555753 198
314 iso_pu_bacteria 2936381700 2936387426 198
315 iso_pu_bacteria 8005382845 8005386039 198
316 iso_pu_bacteria 8005460587 8005461894 198
317 3300005578 Ga0068854_100083216 Ga0068854_1000832164 199
318 3300025981 Ga0207640_10027977 Ga0207640_100279772 199
319 iso_pu_bacteria 2837678835 2837679122 199
320 iso_pu_bacteria 8005658619 8005660014 199
321 iso_pu_bacteria 2643221653 2644296871 200
322 iso_pu_bacteria 2643221719 2644655125 200
323 iso_pu_bacteria 2738541317 2738946599 200
324 iso_pu_bacteria 2818991272 2819242586 200
325 iso_pu_bacteria 2913308742 2913311017 200
326 iso_pu_bacteria 2939669807 2939669909 200
327 iso_pu_bacteria 2989776772 2989778141 200
328 3300006038 Ga0075365_10000250 Ga0075365_1000025019 201
329 3300031456 Ga0307513_10212164 Ga0307513_102121642 201
330 3300002774 JGI25150J39212_1003811 JGI25150J39212_10038112 202
331 3300003775 Ga0055524_1016859 Ga0055524_10168593 202
332 3300005331 Ga0070670_100004253 Ga0070670_1000042535 202
333 3300005353 Ga0070669_100306326 Ga0070669_1003063262 202
334 3300025273 Ga0209673_1000254 Ga0209673_100025479 202
335 3300025273 Ga0209673_1006773 Ga0209673_10067732 202
336 3300025295 Ga0209564_1000233 Ga0209564_100023376 202
337 3300025299 Ga0209256_1001044 Ga0209256_100104422 202
338 3300048927 Ga0496124_0000679 Ga0496124_0000679_16473_17102 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13023

HD_3

HD domain

56

178

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
2gz4-assembly1.cif.gz_C 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens 0.9292 6 200
2gz4-assembly1.cif.gz_C 1.5 a crystal structure of a protein of unknown function atu1052 from agrobacterium tumefaciens 0.9199 6 200
5tk6-assembly1.cif.gz_A structure of the hd-domain phosphohydrolase oxsa with oxetanocin-a diphosphate bound 0.5498 29 197
6zpa-assembly1.cif.gz_A cyanophage s-2l hd phosphohydrolase (datz) bound to da and one catalytic zn2+ ion 0.5482 29 196
6zpa-assembly1.cif.gz_A cyanophage s-2l hd phosphohydrolase (datz) bound to da and one catalytic zn2+ ion 0.5318 29 196
ID Description Score Start End Superfamily
2gz4D00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9384 8 198 1.10.3210.10
2gz4D00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9056 8 198 1.10.3210.10
af_P76514_1_178_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.826 10 199 1.10.3210.10
af_P76514_1_178_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8044 10 199 1.10.3210.10
5tk6A00 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5498 29 197 1.10.3210.10
ID Description Score Start End GO Terms
AF-A0A5E9AYS3-F1-model_v4 Hydrolase 0.9686 112 199 GO:0016787
AF-A0A072R211-F1-model_v4 Uncharacterized protein 0.9638 107 200
AF-A0A529UL33-F1-model_v4 deleted 0.9637 103 199
AF-A0A072R211-F1-model_v4 Uncharacterized protein 0.9444 107 200
AF-A0A526QFV6-F1-model_v4 Hydrolase 0.9402 6 70 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.76 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map