F413455

General Info

Members Datasets Scaffolds Average Seq Length
338 209 676 332

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10126340|Ga0075364_101263402
Length 333
Sequence MTKRRARIAALGRYLPERILTNADLEKMVDTTDEWIRTRTGIQTRHVVEPGTPNSELASRAALDALRRSGIPASDIDLIILATVTPDMLFPATACIVQDKIKATKAWGFDVSAACSGFLYALTVGAQFIESGAHKRVMVIGSDVMSSILNFKDRTTCVLFGDAAGAVILEAAEDDTGILDFHHEVDGSGGCYLHMPAGGSAMPTSHETVEKGLHYLKQDGPHVFKFASRKMAEVSKHIIERNNLTSEQVDLFVAHQANLRIIQAAQERMGLPDEKVVINIREYGNTTAATIPLALATAMDQGRLKPGHRVVVAAVGAGFTVGALLMKWSGVPW

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
99 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
110 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
119 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
120 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
121 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
122 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
125 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
126 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
127 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
128 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
186 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
187 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
190 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
206 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
207 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.59
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.56
Stem 0
Stem Tuber 0
Unclassified 6.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10126340 3300006051 Bacteria 1715
2 Ga0065712_10068497 3300005290 Bacteria 10234
3 Ga0065715_10000735 3300005293 Bacteria 10090
4 Ga0070690_100109125 3300005330 Bacteria 1844
5 Ga0070670_100004468 3300005331 Bacteria 11713
6 Ga0068869_100165810 3300005334 Bacteria 1723
7 Ga0070666_10110575 3300005335 Bacteria 1900
8 Ga0070668_100178811 3300005347 Bacteria 1732
9 Ga0070669_100007279 3300005353 Bacteria 7940
10 Ga0070669_100023099 3300005353 Bacteria 4451
11 Ga0070675_100004987 3300005354 Bacteria 10135
12 Ga0070667_100106411 3300005367 Bacteria 2428
13 Ga0070703_10000405 3300005406 Bacteria 17999
14 Ga0070709_10000032 3300005434 Bacteria 117122
15 Ga0070714_100101151 3300005435 Bacteria 2539
16 Ga0070713_100048391 3300005436 Bacteria 3500
17 Ga0070713_100101716 3300005436 Bacteria 2490
18 Ga0070711_100000019 3300005439 Bacteria 137012
19 Ga0070705_100016553 3300005440 Unclassified 3831
20 Ga0070700_100192402 3300005441 Unclassified 1427
21 Ga0070694_100114983 3300005444 Bacteria 1922
22 Ga0070694_100223826 3300005444 Bacteria 1412
23 Ga0070694_100341470 3300005444 Unclassified 1158
24 Ga0070678_100010777 3300005456 Bacteria 5602
25 Ga0068867_100086566 3300005459 Unclassified 2371
26 Ga0070706_100006572 3300005467 Bacteria 10969
27 Ga0070706_100084791 3300005467 Unclassified 2935
28 Ga0070707_100000205 3300005468 Bacteria 59421
29 Ga0070707_100000276 3300005468 Bacteria 50554
30 Ga0070698_100238765 3300005471 Bacteria 1751
31 Ga0070699_100000029 3300005518 Bacteria 151185
32 Ga0070699_100044926 3300005518 Unclassified 3824
33 Ga0070697_100358927 3300005536 Bacteria 1260
34 Ga0070672_100038324 3300005543 Bacteria 3661
35 Ga0070665_100016819 3300005548 Bacteria 7333
36 Ga0070665_100234213 3300005548 Bacteria 1837
37 Ga0070704_100211761 3300005549 Bacteria 1571
38 Ga0068852_100012150 3300005616 Bacteria 6522
39 Ga0068859_100043977 3300005617 Bacteria 4488
40 Ga0068859_100079150 3300005617 Bacteria 3326
41 Ga0068861_100110374 3300005719 Bacteria 2203
42 Ga0068851_10081493 3300005834 Bacteria 1691
43 Ga0068863_100011515 3300005841 Bacteria 8555
44 Ga0068863_100040089 3300005841 Bacteria 4454
45 Ga0068858_100071722 3300005842 Bacteria 3213
46 Ga0068860_100036434 3300005843 Bacteria 4714
47 Ga0068860_100258155 3300005843 Bacteria 1698
48 Ga0070717_10109810 3300006028 Bacteria 2351
49 Ga0075364_10097168 3300006051 Bacteria 1959
50 Ga0070715_10094354 3300006163 Bacteria 1383
51 Ga0070716_100077038 3300006173 Bacteria 1978
52 Ga0070716_100277570 3300006173 Bacteria 1155
53 Ga0097621_100005430 3300006237 Bacteria 8984
54 Ga0097621_100232088 3300006237 Bacteria 1611
55 Ga0068871_100016049 3300006358 Bacteria 5628
56 Ga0068871_100020135 3300006358 Bacteria 5106
57 Ga0075428_100001126 3300006844 Bacteria 28567
58 Ga0075428_100044542 3300006844 Bacteria 4876
59 Ga0075428_100215924 3300006844 Unclassified 2072
60 Ga0075430_100000961 3300006846 Bacteria 22714
61 Ga0075431_100024065 3300006847 Bacteria 6236
62 Ga0075431_100061288 3300006847 Bacteria 3882
63 Ga0075431_100092156 3300006847 Bacteria 3127
64 Ga0075431_100505547 3300006847 Bacteria 1199
65 Ga0075433_10103980 3300006852 Bacteria 2516
66 Ga0075434_100006130 3300006871 Bacteria 11010
67 Ga0075434_100027705 3300006871 Bacteria 5564
68 Ga0075434_100226693 3300006871 Unclassified 1888
69 Ga0075436_100000696 3300006914 Bacteria 22198
70 Ga0097620_100043978 3300006931 Bacteria 4488
71 Ga0097620_100079153 3300006931 Bacteria 3326
72 Ga0075435_100034608 3300007076 Bacteria 4004
73 Ga0075435_100177898 3300007076 Bacteria 1797
74 Ga0099794_10044006 3300007265 Bacteria 2133
75 Ga0111539_10000870 3300009094 Bacteria 39436
76 Ga0111539_10730290 3300009094 Unclassified 1153
77 Ga0114129_10000857 3300009147 Bacteria 39461
78 Ga0114129_10004922 3300009147 Bacteria 18851
79 Ga0114129_10016198 3300009147 Bacteria 10607
80 Ga0114129_10032387 3300009147 Bacteria 7387
81 Ga0114129_10071344 3300009147 Bacteria 4843
82 Ga0105242_10058458 3300009176 Bacteria 3161
83 Ga0105242_10279691 3300009176 Unclassified 1515
84 Ga0105248_10036203 3300009177 Bacteria 5519
85 Ga0105248_10135472 3300009177 Bacteria 2778
86 Ga0105249_10015751 3300009553 Bacteria 6697
87 Ga0105239_10155598 3300010375 Bacteria 2552
88 Ga0157370_10221723 3300013104 Bacteria 1751
89 Ga0157369_10010296 3300013105 Bacteria 10666
90 Ga0157369_10654996 3300013105 Bacteria 1083
91 Ga0157378_10002348 3300013297 Bacteria 16815
92 Ga0157378_10306918 3300013297 Bacteria 1538
93 Ga0163162_10085286 3300013306 Bacteria 3235
94 Ga0163162_10300165 3300013306 Bacteria 1738
95 Ga0163162_10718745 3300013306 Bacteria 1120
96 Ga0157375_10056381 3300013308 Bacteria 3879
97 Ga0163163_10015982 3300014325 Bacteria 6956
98 Ga0163163_10026040 3300014325 Bacteria 5585
99 Ga0163163_10197790 3300014325 Bacteria 2058
100 Ga0157380_10080332 3300014326 Bacteria 2665
101 Ga0157380_10113388 3300014326 Bacteria 2283
102 Ga0157377_10030013 3300014745 Bacteria 2941
103 Ga0157379_10022265 3300014968 Bacteria 5613
104 Ga0157376_10000017 3300014969 Bacteria 268501
105 Ga0228598_1000397 3300024227 Bacteria 8779
106 Ga0207697_10009964 3300025315 Bacteria 4083
107 Ga0207653_10000022 3300025885 Bacteria 126662
108 Ga0207699_10000002 3300025906 Bacteria 662194
109 Ga0207699_10078231 3300025906 Bacteria 2042
110 Ga0207705_10039960 3300025909 Bacteria 3362
111 Ga0207684_10000248 3300025910 Bacteria 80978
112 Ga0207684_10089028 3300025910 Unclassified 2630
113 Ga0207707_10256640 3300025912 Bacteria 1518
114 Ga0207693_10100712 3300025915 Unclassified 2265
115 Ga0207663_10000021 3300025916 Bacteria 137021
116 Ga0207646_10000042 3300025922 Bacteria 186121
117 Ga0207646_10000095 3300025922 Bacteria 117382
118 Ga0207650_10006090 3300025925 Bacteria 8225
119 Ga0207659_10012226 3300025926 Bacteria 5449
120 Ga0207659_10153950 3300025926 Bacteria 1798
121 Ga0207664_10123016 3300025929 Bacteria 2174
122 Ga0207664_10139741 3300025929 Bacteria 2047
123 Ga0207686_10319197 3300025934 Bacteria 1160
124 Ga0207669_10182743 3300025937 Bacteria 1505
125 Ga0207704_10119742 3300025938 Unclassified 1799
126 Ga0207691_10160189 3300025940 Bacteria 1975
127 Ga0207711_10075073 3300025941 Bacteria 2942
128 Ga0207711_10094871 3300025941 Bacteria 2630
129 Ga0207689_10094010 3300025942 Bacteria 2462
130 Ga0207712_10017972 3300025961 Bacteria 4600
131 Ga0207703_10270059 3300026035 Bacteria 1540
132 Ga0207641_10007619 3300026088 Bacteria 9001
133 Ga0207641_10036733 3300026088 Bacteria 4089
134 Ga0207648_10014255 3300026089 Bacteria 7349
135 Ga0207648_10041766 3300026089 Bacteria 4028
136 Ga0207676_10007437 3300026095 Bacteria 7769
137 Ga0207675_100128611 3300026118 Bacteria 2401
138 Ga0207675_100517688 3300026118 Bacteria 1189
139 Ga0207683_10024912 3300026121 Bacteria 5157
140 Ga0207698_10163545 3300026142 Bacteria 1950
141 Ga0268266_10000444 3300028379 Bacteria 61604
142 Ga0268266_10352693 3300028379 Bacteria 1383
143 Ga0268265_10277935 3300028380 Bacteria 1497
144 Ga0268265_10357272 3300028380 Bacteria 1336
145 Ga0268264_10039426 3300028381 Bacteria 3903
146 Ga0268264_10176708 3300028381 Bacteria 1936
147 Ga0265760_10000006 3300031090 Bacteria 143747
148 Ga0265325_10012198 3300031241 Bacteria 4917
149 Ga0307408_100007220 3300031548 Bacteria 7348
150 Ga0307408_100118024 3300031548 Unclassified 2050
151 Ga0307405_10092226 3300031731 Bacteria 2009
152 Ga0307405_10193960 3300031731 Bacteria 1469
153 Ga0307413_10039364 3300031824 Bacteria 2749
154 Ga0307413_10190452 3300031824 Bacteria 1472
155 Ga0307412_10024124 3300031911 Bacteria 3752
156 Ga0307409_100161151 3300031995 Bacteria 1962
157 Ga0307409_100258304 3300031995 Bacteria 1597
158 Ga0307416_100005385 3300032002 Bacteria 7857
159 Ga0307416_100024794 3300032002 Bacteria 4385
160 Ga0307411_10012515 3300032005 Bacteria 4635
161 Ga0307411_10026725 3300032005 Bacteria 3479
162 Ga0373926_0000603 3300035083 Bacteria 9744
163 Ga0373926_0001672 3300035083 Bacteria 6856
164 Ga0373934_0010204 3300035086 Bacteria 3526
165 Ga0373923_0020891 3300035111 Bacteria 2550
166 Ga0373923_0096374 3300035111 Bacteria 1300
167 Ga0373954_0073118 3300035118 Bacteria 1631
168 Ga0373956_0007044 3300035119 Bacteria 4523
169 Ga0373946_0000790 3300035171 Bacteria 10792
170 Ga0373955_0037484 3300035172 Bacteria 2578
171 Ga0373955_0093592 3300035172 Bacteria 1716
172 Ga0373927_0000250 3300035695 Bacteria 42453
173 Ga0373933_0001702 3300035724 Bacteria 12766
174 Ga0373947_0001109 3300035725 Bacteria 16525
175 Ga0373947_0008050 3300035725 Bacteria 6080
176 Ga0373937_0000208 3300036401 Bacteria 56666
177 Ga0373937_0000258 3300036401 Bacteria 51434
178 Ga0373937_0009775 3300036401 Bacteria 8362
179 Ga0373925_0000395 3300037068 Bacteria 44643
180 Ga0439451_021632 3300042009 Bacteria 1297
181 Ga0450923_028578 3300042125 Bacteria 1126
182 Ga0450896_008387 3300042133 Bacteria 1432
183 Ga0439435_0005911 3300042436 Bacteria 2720
184 Ga0439464_0003067 3300042439 Bacteria 4178
185 Ga0439460_0015241 3300042461 Bacteria 2032
186 Ga0450916_001253 3300042530 Bacteria 2506
187 Ga0451577_0179734 3300042876 Bacteria 1907
188 Ga0451577_0298815 3300042876 Bacteria 1459
189 Ga0439440_0024537 3300042993 Bacteria 1383
190 Ga0453683_0003680 3300044673 Bacteria 11231
191 Ga0453683_0013053 3300044673 Bacteria 5432
192 Ga0453683_0019488 3300044673 Bacteria 4344
193 Ga0453684_0021191 3300044712 Bacteria 9729
194 Ga0453684_0069860 3300044712 Bacteria 4452
195 Ga0451576_0130582 3300045051 Bacteria 2619
196 Ga0451576_0692122 3300045051 Bacteria 1071
197 Ga0466967_0013112 3300045976 Bacteria 6385
198 Ga0495592_0052167 3300046454 Bacteria 3037
199 Ga0495651_0001555 3300046462 Bacteria 17737
200 Ga0495651_0009530 3300046462 Bacteria 7459
201 Ga0495653_0003265 3300046463 Bacteria 13013
202 Ga0495580_0004821 3300046472 Bacteria 11292
203 Ga0495580_0005754 3300046472 Bacteria 10183
204 Ga0495582_0002924 3300046473 Bacteria 9551
205 Ga0495664_0025002 3300046477 Bacteria 3474
206 Ga0495608_0002955 3300046511 Bacteria 12152
207 Ga0495608_0020820 3300046511 Unclassified 4506
208 Ga0495608_0112011 3300046511 Unclassified 1754
209 Ga0495628_0000283 3300046516 Bacteria 45481
210 Ga0495630_0318219 3300046517 Bacteria 1189
211 Ga0495666_0015994 3300046526 Bacteria 3736
212 Ga0495652_0001131 3300046529 Bacteria 30078
213 Ga0495652_0007749 3300046529 Bacteria 9874
214 Ga0495665_0000672 3300046531 Bacteria 17541
215 Ga0495640_0053192 3300046533 Bacteria 2777
216 Ga0495586_0000773 3300046535 Bacteria 18367
217 Ga0495587_0000180 3300046536 Bacteria 46346
218 Ga0495587_0003629 3300046536 Bacteria 10271
219 Ga0495667_0008999 3300046559 Bacteria 6784
220 Ga0495667_0050913 3300046559 Bacteria 2733
221 Ga0495635_0001513 3300046663 Bacteria 15559
222 Ga0495623_0000369 3300046679 Bacteria 29555
223 Ga0495646_0000366 3300046680 Bacteria 23389
224 Ga0495613_0070400 3300046689 Bacteria 2550
225 Ga0495613_0221149 3300046689 Bacteria 1329
226 Ga0495624_0200278 3300046690 Bacteria 1213
227 Ga0495600_0000341 3300046809 Bacteria 24882
228 Ga0495604_0211793 3300047317 Bacteria 1339
229 Ga0495604_0224874 3300047317 Unclassified 1290
230 Ga0495674_0005638 3300047319 Bacteria 11990
231 Ga0495676_0243446 3300047321 Bacteria 1230
232 Ga0495680_0012201 3300047322 Bacteria 7578
233 Ga0495675_0000240 3300047444 Bacteria 39699
234 Ga0495675_0000599 3300047444 Bacteria 23250
235 Ga0495675_0000645 3300047444 Bacteria 22163
236 Ga0495684_0005235 3300047471 Bacteria 10107
237 Ga0495593_0007606 3300047673 Bacteria 6327
238 Ga0495602_0003206 3300048088 Bacteria 16883
239 Ga0495602_0011067 3300048088 Bacteria 9342
240 Ga0495602_0029131 3300048088 Bacteria 5269
241 Ga0496100_0053398 3300048903 Bacteria 2632
242 Ga0496104_0016781 3300048907 Bacteria 6655
243 Ga0496104_0027899 3300048907 Bacteria 5227
244 Ga0496104_0395302 3300048907 Bacteria 1295
245 Ga0496108_0015730 3300048911 Bacteria 6169
246 Ga0496109_0001109 3300048912 Bacteria 22334
247 Ga0496110_0012922 3300048913 Bacteria 6885
248 Ga0496111_0374916 3300048914 Bacteria 1053
249 Ga0496112_0001819 3300048915 Bacteria 16770
250 Ga0496113_0039300 3300048916 Bacteria 3482
251 Ga0496114_0003779 3300048917 Bacteria 11670
252 Ga0496114_0017463 3300048917 Bacteria 5790
253 Ga0496115_0054103 3300048918 Bacteria 3222
254 Ga0501033_0131093 3300049570 Bacteria 1816
255 Ga0501036_0014261 3300049572 Bacteria 6613
256 Ga0501036_0020670 3300049572 Bacteria 5530
257 Ga0501038_0075827 3300049574 Bacteria 2842
258 Ga0501038_0090420 3300049574 Bacteria 2566
259 Ga0501038_0145648 3300049574 Bacteria 1934
260 Ga0501039_0075400 3300049575 Bacteria 2622
261 Ga0501039_0076223 3300049575 Bacteria 2607
262 Ga0501039_0230767 3300049575 Bacteria 1455
263 Ga0501040_0047419 3300049576 Bacteria 2934
264 Ga0501041_0010123 3300049577 Bacteria 5557
265 Ga0501041_0227990 3300049577 Bacteria 1169
266 Ga0501042_0034060 3300049578 Bacteria 3612
267 Ga0501042_0038051 3300049578 Bacteria 3416
268 Ga0501042_0201929 3300049578 Bacteria 1433
269 Ga0501046_0014990 3300049580 Bacteria 6520
270 Ga0501046_0223303 3300049580 Bacteria 1394
271 Ga0501046_0264996 3300049580 Bacteria 1261
272 Ga0501048_0037754 3300049582 Bacteria 3469
273 Ga0501048_0082182 3300049582 Bacteria 2272
274 Ga0501068_0076280 3300049584 Unclassified 2051
275 Ga0501071_0007846 3300049587 Bacteria 7040
276 Ga0501071_0027574 3300049587 Bacteria 3997
277 Ga0501072_0015475 3300049588 Bacteria 5848
278 Ga0501072_0048854 3300049588 Bacteria 3331
279 Ga0501072_0200964 3300049588 Bacteria 1589
280 Ga0501072_0306550 3300049588 Bacteria 1262
281 Ga0501074_0014603 3300049590 Bacteria 5714
282 Ga0501074_0044209 3300049590 Bacteria 3225
283 Ga0501074_0055892 3300049590 Bacteria 2844
284 Ga0501075_0001850 3300049591 Bacteria 13973
285 Ga0501075_0014357 3300049591 Bacteria 5675
286 Ga0501076_0000633 3300049592 Bacteria 22451
287 Ga0501076_0057091 3300049592 Bacteria 3099
288 Ga0501076_0178875 3300049592 Bacteria 1729
289 Ga0501076_0213678 3300049592 Bacteria 1576
290 Ga0501077_0021021 3300049593 Bacteria 4129
291 Ga0501079_0015604 3300049741 Bacteria 5800
292 Ga0501079_0148071 3300049741 Bacteria 1830
293 Ga0501080_0046033 3300049742 Bacteria 4063
294 Ga0501081_0018947 3300049743 Bacteria 4575
295 Ga0501083_0184834 3300049744 Bacteria 1360
296 Ga0501035_0106768 3300049822 Bacteria 2454
297 Ga0501045_0008164 3300049824 Bacteria 7293
298 Ga0501045_0021060 3300049824 Bacteria 4661
299 Ga0501045_0033751 3300049824 Bacteria 3712
300 Ga0501045_0038316 3300049824 Bacteria 3486
301 nmdc:mga05p37_12193_c1 3300050507 Bacteria 10263
302 nmdc:mga05p37_31095_c1 3300050507 Bacteria 6519
303 nmdc:mga05p37_893_c1 3300050507 Bacteria 33632
304 nmdc:mga09592_147186_c1 3300050508 Bacteria 2031
305 nmdc:mga09592_241077_c1 3300050508 Bacteria 1566
306 nmdc:mga09592_3762_c1 3300050508 Bacteria 12226
307 nmdc:mga09592_46496_c1 3300050508 Unclassified 3656
308 nmdc:mga0qj67_7314_c1 3300050509 Bacteria 8161
309 nmdc:mga06r32_13579_c1 3300050510 Bacteria 4111
310 nmdc:mga06r32_186626_c1 3300050510 Bacteria 2060
311 nmdc:mga06r32_33250_c1 3300050510 Bacteria 4857
312 nmdc:mga08y16_735_c1 3300050511 Bacteria 31112
313 nmdc:mga08y16_78054_c1 3300050511 Unclassified 3452
314 nmdc:mga08y16_88212_c1 3300050511 Bacteria 3232
315 nmdc:mga0n895_27666_c1 3300050512 Bacteria 5389
316 nmdc:mga0n895_5974_c1 3300050512 Bacteria 10250
317 nmdc:mga0rr50_45133_c1 3300050513 Bacteria 3236
318 nmdc:mga08x19_236_c1 3300050514 Bacteria 42242
319 nmdc:mga08x19_2_c1 3300050514 Bacteria 741277
320 nmdc:mga0a205_117535_c1 3300050515 Bacteria 2557
321 nmdc:mga0a205_124964_c2 3300050515 Bacteria 1699
322 nmdc:mga0a205_280703_c1 3300050515 Unclassified 1541
323 nmdc:mga0a205_350725_c1 3300050515 Bacteria 1343
324 nmdc:mga0a205_4572_c1 3300050515 Bacteria 12409
325 Ga0495601_0076317 3300053077 Bacteria 2146
326 Ga0495595_0053366 3300053084 Bacteria 1878
327 Ga0501084_0007476 3300054114 Bacteria 9007
328 Ga0501084_0030447 3300054114 Bacteria 4513
329 Ga0501084_0129844 3300054114 Bacteria 2121
330 Ga0590071_000359 3300059421 Bacteria 13451
331 Ga0590071_012069 3300059421 Bacteria 2025
332 Ga0590075_000139 3300059424 Bacteria 19073
333 Ga0590077_000011 3300059426 Bacteria 41505
334 Ga0590077_005365 3300059426 Bacteria 2628
335 Ga0501082_0036375 3300060353 Bacteria 4241
336 Ga0501082_0425798 3300060353 Bacteria 1159
337 Ga0530510_0005554 3300061734 Bacteria 8740
338 Ga0530510_0101535 3300061734 Bacteria 2103
339 Ga0075364_10126340
340 Ga0065712_10068497
341 Ga0065715_10000735
342 Ga0070690_100109125
343 Ga0070670_100004468
344 Ga0068869_100165810
345 Ga0070666_10110575
346 Ga0070668_100178811
347 Ga0070669_100007279
348 Ga0070669_100023099
349 Ga0070675_100004987
350 Ga0070667_100106411
351 Ga0070703_10000405
352 Ga0070709_10000032
353 Ga0070714_100101151
354 Ga0070713_100048391
355 Ga0070713_100101716
356 Ga0070711_100000019
357 Ga0070705_100016553
358 Ga0070700_100192402
359 Ga0070694_100114983
360 Ga0070694_100223826
361 Ga0070694_100341470
362 Ga0070678_100010777
363 Ga0068867_100086566
364 Ga0070706_100006572
365 Ga0070706_100084791
366 Ga0070707_100000205
367 Ga0070707_100000276
368 Ga0070698_100238765
369 Ga0070699_100000029
370 Ga0070699_100044926
371 Ga0070697_100358927
372 Ga0070672_100038324
373 Ga0070665_100016819
374 Ga0070665_100234213
375 Ga0070704_100211761
376 Ga0068852_100012150
377 Ga0068859_100043977
378 Ga0068859_100079150
379 Ga0068861_100110374
380 Ga0068851_10081493
381 Ga0068863_100011515
382 Ga0068863_100040089
383 Ga0068858_100071722
384 Ga0068860_100036434
385 Ga0068860_100258155
386 Ga0070717_10109810
387 Ga0075364_10097168
388 Ga0070715_10094354
389 Ga0070716_100077038
390 Ga0070716_100277570
391 Ga0097621_100005430
392 Ga0097621_100232088
393 Ga0068871_100016049
394 Ga0068871_100020135
395 Ga0075428_100001126
396 Ga0075428_100044542
397 Ga0075428_100215924
398 Ga0075430_100000961
399 Ga0075431_100024065
400 Ga0075431_100061288
401 Ga0075431_100092156
402 Ga0075431_100505547
403 Ga0075433_10103980
404 Ga0075434_100006130
405 Ga0075434_100027705
406 Ga0075434_100226693
407 Ga0075436_100000696
408 Ga0097620_100043978
409 Ga0097620_100079153
410 Ga0075435_100034608
411 Ga0075435_100177898
412 Ga0099794_10044006
413 Ga0111539_10000870
414 Ga0111539_10730290
415 Ga0114129_10000857
416 Ga0114129_10004922
417 Ga0114129_10016198
418 Ga0114129_10032387
419 Ga0114129_10071344
420 Ga0105242_10058458
421 Ga0105242_10279691
422 Ga0105248_10036203
423 Ga0105248_10135472
424 Ga0105249_10015751
425 Ga0105239_10155598
426 Ga0157370_10221723
427 Ga0157369_10010296
428 Ga0157369_10654996
429 Ga0157378_10002348
430 Ga0157378_10306918
431 Ga0163162_10085286
432 Ga0163162_10300165
433 Ga0163162_10718745
434 Ga0157375_10056381
435 Ga0163163_10015982
436 Ga0163163_10026040
437 Ga0163163_10197790
438 Ga0157380_10080332
439 Ga0157380_10113388
440 Ga0157377_10030013
441 Ga0157379_10022265
442 Ga0157376_10000017
443 Ga0228598_1000397
444 Ga0207697_10009964
445 Ga0207653_10000022
446 Ga0207699_10000002
447 Ga0207699_10078231
448 Ga0207705_10039960
449 Ga0207684_10000248
450 Ga0207684_10089028
451 Ga0207707_10256640
452 Ga0207693_10100712
453 Ga0207663_10000021
454 Ga0207646_10000042
455 Ga0207646_10000095
456 Ga0207650_10006090
457 Ga0207659_10012226
458 Ga0207659_10153950
459 Ga0207664_10123016
460 Ga0207664_10139741
461 Ga0207686_10319197
462 Ga0207669_10182743
463 Ga0207704_10119742
464 Ga0207691_10160189
465 Ga0207711_10075073
466 Ga0207711_10094871
467 Ga0207689_10094010
468 Ga0207712_10017972
469 Ga0207703_10270059
470 Ga0207641_10007619
471 Ga0207641_10036733
472 Ga0207648_10014255
473 Ga0207648_10041766
474 Ga0207676_10007437
475 Ga0207675_100128611
476 Ga0207675_100517688
477 Ga0207683_10024912
478 Ga0207698_10163545
479 Ga0268266_10000444
480 Ga0268266_10352693
481 Ga0268265_10277935
482 Ga0268265_10357272
483 Ga0268264_10039426
484 Ga0268264_10176708
485 Ga0265760_10000006
486 Ga0265325_10012198
487 Ga0307408_100007220
488 Ga0307408_100118024
489 Ga0307405_10092226
490 Ga0307405_10193960
491 Ga0307413_10039364
492 Ga0307413_10190452
493 Ga0307412_10024124
494 Ga0307409_100161151
495 Ga0307409_100258304
496 Ga0307416_100005385
497 Ga0307416_100024794
498 Ga0307411_10012515
499 Ga0307411_10026725
500 Ga0373926_0000603
501 Ga0373926_0001672
502 Ga0373934_0010204
503 Ga0373923_0020891
504 Ga0373923_0096374
505 Ga0373954_0073118
506 Ga0373956_0007044
507 Ga0373946_0000790
508 Ga0373955_0037484
509 Ga0373955_0093592
510 Ga0373927_0000250
511 Ga0373933_0001702
512 Ga0373947_0001109
513 Ga0373947_0008050
514 Ga0373937_0000208
515 Ga0373937_0000258
516 Ga0373937_0009775
517 Ga0373925_0000395
518 Ga0439451_021632
519 Ga0450923_028578
520 Ga0450896_008387
521 Ga0439435_0005911
522 Ga0439464_0003067
523 Ga0439460_0015241
524 Ga0450916_001253
525 Ga0451577_0179734
526 Ga0451577_0298815
527 Ga0439440_0024537
528 Ga0453683_0003680
529 Ga0453683_0013053
530 Ga0453683_0019488
531 Ga0453684_0021191
532 Ga0453684_0069860
533 Ga0451576_0130582
534 Ga0451576_0692122
535 Ga0466967_0013112
536 Ga0495592_0052167
537 Ga0495651_0001555
538 Ga0495651_0009530
539 Ga0495653_0003265
540 Ga0495580_0004821
541 Ga0495580_0005754
542 Ga0495582_0002924
543 Ga0495664_0025002
544 Ga0495608_0002955
545 Ga0495608_0020820
546 Ga0495608_0112011
547 Ga0495628_0000283
548 Ga0495630_0318219
549 Ga0495666_0015994
550 Ga0495652_0001131
551 Ga0495652_0007749
552 Ga0495665_0000672
553 Ga0495640_0053192
554 Ga0495586_0000773
555 Ga0495587_0000180
556 Ga0495587_0003629
557 Ga0495667_0008999
558 Ga0495667_0050913
559 Ga0495635_0001513
560 Ga0495623_0000369
561 Ga0495646_0000366
562 Ga0495613_0070400
563 Ga0495613_0221149
564 Ga0495624_0200278
565 Ga0495600_0000341
566 Ga0495604_0211793
567 Ga0495604_0224874
568 Ga0495674_0005638
569 Ga0495676_0243446
570 Ga0495680_0012201
571 Ga0495675_0000240
572 Ga0495675_0000599
573 Ga0495675_0000645
574 Ga0495684_0005235
575 Ga0495593_0007606
576 Ga0495602_0003206
577 Ga0495602_0011067
578 Ga0495602_0029131
579 Ga0496100_0053398
580 Ga0496104_0016781
581 Ga0496104_0027899
582 Ga0496104_0395302
583 Ga0496108_0015730
584 Ga0496109_0001109
585 Ga0496110_0012922
586 Ga0496111_0374916
587 Ga0496112_0001819
588 Ga0496113_0039300
589 Ga0496114_0003779
590 Ga0496114_0017463
591 Ga0496115_0054103
592 Ga0501033_0131093
593 Ga0501036_0014261
594 Ga0501036_0020670
595 Ga0501038_0075827
596 Ga0501038_0090420
597 Ga0501038_0145648
598 Ga0501039_0075400
599 Ga0501039_0076223
600 Ga0501039_0230767
601 Ga0501040_0047419
602 Ga0501041_0010123
603 Ga0501041_0227990
604 Ga0501042_0034060
605 Ga0501042_0038051
606 Ga0501042_0201929
607 Ga0501046_0014990
608 Ga0501046_0223303
609 Ga0501046_0264996
610 Ga0501048_0037754
611 Ga0501048_0082182
612 Ga0501068_0076280
613 Ga0501071_0007846
614 Ga0501071_0027574
615 Ga0501072_0015475
616 Ga0501072_0048854
617 Ga0501072_0200964
618 Ga0501072_0306550
619 Ga0501074_0014603
620 Ga0501074_0044209
621 Ga0501074_0055892
622 Ga0501075_0001850
623 Ga0501075_0014357
624 Ga0501076_0000633
625 Ga0501076_0057091
626 Ga0501076_0178875
627 Ga0501076_0213678
628 Ga0501077_0021021
629 Ga0501079_0015604
630 Ga0501079_0148071
631 Ga0501080_0046033
632 Ga0501081_0018947
633 Ga0501083_0184834
634 Ga0501035_0106768
635 Ga0501045_0008164
636 Ga0501045_0021060
637 Ga0501045_0033751
638 Ga0501045_0038316
639 nmdc:mga05p37_12193_c1
640 nmdc:mga05p37_31095_c1
641 nmdc:mga05p37_893_c1
642 nmdc:mga09592_147186_c1
643 nmdc:mga09592_241077_c1
644 nmdc:mga09592_3762_c1
645 nmdc:mga09592_46496_c1
646 nmdc:mga0qj67_7314_c1
647 nmdc:mga06r32_13579_c1
648 nmdc:mga06r32_186626_c1
649 nmdc:mga06r32_33250_c1
650 nmdc:mga08y16_735_c1
651 nmdc:mga08y16_78054_c1
652 nmdc:mga08y16_88212_c1
653 nmdc:mga0n895_27666_c1
654 nmdc:mga0n895_5974_c1
655 nmdc:mga0rr50_45133_c1
656 nmdc:mga08x19_236_c1
657 nmdc:mga08x19_2_c1
658 nmdc:mga0a205_117535_c1
659 nmdc:mga0a205_124964_c2
660 nmdc:mga0a205_280703_c1
661 nmdc:mga0a205_350725_c1
662 nmdc:mga0a205_4572_c1
663 Ga0495601_0076317
664 Ga0495595_0053366
665 Ga0501084_0007476
666 Ga0501084_0030447
667 Ga0501084_0129844
668 Ga0590071_000359
669 Ga0590071_012069
670 Ga0590075_000139
671 Ga0590077_000011
672 Ga0590077_005365
673 Ga0501082_0036375
674 Ga0501082_0425798
675 Ga0530510_0005554
676 Ga0530510_0101535

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08541

ACP_syn_III_C

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal

239

328

0.99

PF08545

ACP_syn_III

3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III

109

187

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ebd-assembly1.cif.gz_B crystal structure of 3-oxoacyl-[acyl-carrier-protein] synthase iii from aquifex aeolicus vf5 0.9766 27 350
5bnr-assembly1.cif.gz_A-2 e. coli fabh with small molecule inhibitor 2 0.976 26 350
1zow-assembly1.cif.gz_A crystal structure of s. aureus fabh, beta-ketoacyl carrier protein synthase iii 0.9745 26 351
4ylt-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis 0.974 26 350
4z19-assembly1.cif.gz_A-2 crystal structure of beta-ketoacyl-acp synthase iii (fabh) from yersinia pestis with acetylated active site cysteine 0.9738 26 350
ID Description Score Start End Superfamily
1zowB01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9791 26 195 3.40.47.10
3il3A01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9785 26 193 3.40.47.10
3il4B01 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9776 26 193 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9745 26 352 3.40.47.10
af_Q2FZS0_1_313_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.9684 26 352 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A7X7Z052-F1-model_v4 deleted 0.9846 26 352
AF-A0A351J771-F1-model_v4 3-oxoacyl-ACP synthase 0.9837 28 178 GO:0004315
GO:0006633
GO:0044550
AF-A0A6N6KK22-F1-model_v4 3-oxoacyl-ACP synthase 0.9836 25 187 GO:0004315
GO:0006633
GO:0044550
AF-A0A535AJN1-F1-model_v4 3-oxoacyl-ACP synthase 0.9834 24 183 GO:0004315
GO:0006633
GO:0044550
AF-A0A2N5Z9D3-F1-model_v4 Beta-ketoacyl-[acyl-carrier-protein] synthase III (Beta-ketoacyl-ACP synthase III) (KAS III) (EC 2.3.1.180) (3-oxoacyl-[acyl-carrier-protein] synthase 3) (3-oxoacyl-[acyl-carrier-protein] synthase III) 0.9829 25 350 GO:0004315
GO:0005737
GO:0006633
GO:0033818

Map