F413583

General Info

Members Datasets Scaffolds Average Seq Length
338 246 308 216

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100358714|Ga0307409_1003587142
Length 238
Sequence MTSHAVDETATATSSPIGSAGAVATARAEIVRVGRSLHSRGYVHASAGNLSTRAGDDVLITPTDATLGFLEAERISVVAPDGQQRSGDRASKTLALHRRIYAGSAEAGFVIHTHSTHLVALTLSGVYQPGDIVPPLTPYYVMKVGHVPLIPYHRPGHPTVVDLVEQAIADAAGRGTPIRAVMLERLGPVVWGPTADAAMAVLEELEETARLWLLTDRRPEPLPPHAIQELKDTFGAPW

Samples

Sample ID Description Type Environment
1 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
2 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
3 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
4 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
5 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
6 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
7 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
8 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
9 2818991452 Burkholderia cepacia 561 Isolate Unclassified
10 2862574272 Streptomyces sp. AcE210 Isolate Nodule
11 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
12 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
13 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
14 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
15 2928163908 Burkholderia sp. 567 Isolate Unclassified
16 2928170801 Burkholderia sp. 572 Isolate Unclassified
17 2928536128 Burkholderia sola 565 Isolate Unclassified
18 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
19 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
20 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
21 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
22 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
23 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
24 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
25 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
26 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
27 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
32 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
33 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
41 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
42 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
43 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
48 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
49 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
98 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
107 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
151 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
152 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
153 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
154 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
155 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
156 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
157 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
158 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
159 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
162 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
170 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
175 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
179 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
186 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
189 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
190 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
193 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
194 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
197 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
198 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
199 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
200 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
207 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
208 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
209 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
210 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
230 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
231 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
232 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
233 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
234 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
235 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
236 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
237 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
238 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
239 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
240 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
241 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
242 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
243 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
244 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
245 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
246 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.12
Metatranscriptomes 0
Isolates 8.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.68
Nodule 0.89
Rhizoplane 1.48
Rhizosphere 76.04
Stem 0
Stem Tuber 0
Unclassified 5.92

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10008043 3300001989 Bacteria 3940
2 JGI25151J46595_10001553 3300003187 Bacteria 15323
3 rootH1_10025618 3300003316 Bacteria 13568
4 rootH2_10018558 3300003320 Bacteria 1578
5 Ga0055532_1000422 3300003758 Bacteria 20282
6 Ga0055532_1000486 3300003758 Bacteria 17734
7 Ga0055532_1000548 3300003758 Bacteria 16029
8 Ga0055527_1000288 3300003760 Bacteria 29471
9 Ga0055527_1000359 3300003760 Bacteria 21867
10 Ga0055535_1000604 3300003761 Bacteria 29593
11 Ga0055535_1000845 3300003761 Bacteria 21867
12 Ga0055542_1000633 3300003762 Bacteria 29593
13 Ga0055542_1000944 3300003762 Bacteria 19122
14 Ga0055529_1000568 3300003763 Bacteria 30261
15 Ga0055529_1000659 3300003763 Bacteria 24478
16 Ga0055526_1011012 3300003771 Bacteria 4132
17 Ga0055537_1004761 3300003773 Bacteria 3798
18 Ga0055524_1000647 3300003775 Bacteria 24696
19 Ga0055528_1001220 3300003790 Bacteria 16479
20 Ga0058692_1016051 3300003856 Bacteria 1674
21 Ga0065714_10075842 3300005288 Bacteria 2859
22 Ga0070658_10018007 3300005327 Bacteria 5650
23 Ga0070676_10007786 3300005328 Bacteria 5756
24 Ga0070690_100290598 3300005330 Bacteria 1169
25 Ga0070677_10101200 3300005333 Bacteria 1271
26 Ga0070677_10115979 3300005333 Bacteria 1202
27 Ga0068869_100012129 3300005334 Bacteria 5683
28 Ga0070680_100240127 3300005336 Bacteria 1531
29 Ga0070660_100000006 3300005339 Bacteria 166714
30 Ga0070660_100000965 3300005339 Bacteria 19234
31 Ga0070687_100216553 3300005343 Bacteria 1170
32 Ga0070675_100589674 3300005354 Bacteria 1007
33 Ga0070671_100543262 3300005355 Bacteria 1002
34 Ga0070674_100342733 3300005356 Bacteria 1204
35 Ga0070673_100043260 3300005364 Bacteria 3479
36 Ga0070673_100185825 3300005364 Bacteria 1782
37 Ga0070659_100000082 3300005366 Bacteria 71707
38 Ga0070659_100807644 3300005366 Bacteria 816
39 Ga0070709_10348899 3300005434 Bacteria 1093
40 Ga0070713_100405179 3300005436 Bacteria 1274
41 Ga0070663_100006199 3300005455 Bacteria 7167
42 Ga0070678_100271881 3300005456 Bacteria 1429
43 Ga0070678_100425027 3300005456 Bacteria 1159
44 Ga0070662_100129323 3300005457 Bacteria 1945
45 Ga0070681_10003713 3300005458 Bacteria 14324
46 Ga0068867_100030456 3300005459 Bacteria 3893
47 Ga0068867_100062936 3300005459 Bacteria 2758
48 Ga0068867_100107085 3300005459 Bacteria 2142
49 Ga0068867_100231253 3300005459 Bacteria 1495
50 Ga0068867_100238393 3300005459 Bacteria 1474
51 Ga0070706_100221268 3300005467 Bacteria 1767
52 Ga0070679_100001120 3300005530 Bacteria 23378
53 Ga0070686_100175438 3300005544 Bacteria 1519
54 Ga0070693_100522726 3300005547 Bacteria 845
55 Ga0070665_100061178 3300005548 Bacteria 3774
56 Ga0070665_100070516 3300005548 Bacteria 3502
57 Ga0068855_100019387 3300005563 Bacteria 8172
58 Ga0068855_100042237 3300005563 Bacteria 5402
59 Ga0068855_100773125 3300005563 Bacteria 1022
60 Ga0070664_100135664 3300005564 Bacteria 2164
61 Ga0068857_100045080 3300005577 Bacteria 3912
62 Ga0068857_100050579 3300005577 Bacteria 3686
63 Ga0068857_100460801 3300005577 Bacteria 1190
64 Ga0068856_100002983 3300005614 Bacteria 17324
65 Ga0068856_100286394 3300005614 Bacteria 1664
66 Ga0068856_100296965 3300005614 Bacteria 1633
67 Ga0068856_101023281 3300005614 Bacteria 844
68 Ga0068852_100002020 3300005616 Bacteria 13822
69 Ga0068852_100910518 3300005616 Bacteria 897
70 Ga0068866_10040445 3300005718 Bacteria 2308
71 Ga0068866_10232145 3300005718 Bacteria 1119
72 Ga0068860_100734623 3300005843 Bacteria 998
73 Ga0068862_100083087 3300005844 Bacteria 2781
74 Ga0068862_100089683 3300005844 Bacteria 2676
75 Ga0081455_10253261 3300005937 Bacteria 1287
76 Ga0070717_10596215 3300006028 Unclassified 1002
77 Ga0075369_10006157 3300006186 Bacteria 4526
78 Ga0075366_10010199 3300006195 Bacteria 5270
79 Ga0075366_10066802 3300006195 Bacteria 2139
80 Ga0075366_10072883 3300006195 Bacteria 2047
81 Ga0075366_10100411 3300006195 Bacteria 1736
82 Ga0075370_10089521 3300006353 Bacteria 1775
83 Ga0075428_100002412 3300006844 Bacteria 20305
84 Ga0075431_100011563 3300006847 Bacteria 8903
85 Ga0068865_100064949 3300006881 Bacteria 2570
86 Ga0099795_10153000 3300007788 Unclassified 946
87 Ga0105251_10004244 3300009011 Bacteria 9889
88 Ga0105244_10119850 3300009036 Bacteria 1275
89 Ga0105250_10002909 3300009092 Bacteria 8367
90 Ga0105240_10002065 3300009093 Bacteria 32902
91 Ga0105240_10002523 3300009093 Bacteria 29393
92 Ga0105240_10009041 3300009093 Bacteria 14148
93 Ga0105240_10018427 3300009093 Bacteria 9372
94 Ga0105245_10300945 3300009098 Bacteria 1574
95 Ga0114129_10275997 3300009147 Bacteria 2247
96 Ga0105243_10020397 3300009148 Bacteria 5026
97 Ga0105242_10001707 3300009176 Bacteria 17362
98 Ga0105248_10132506 3300009177 Bacteria 2812
99 Ga0105237_10001734 3300009545 Bacteria 28197
100 Ga0105237_10018081 3300009545 Bacteria 7301
101 Ga0105237_10112557 3300009545 Bacteria 2714
102 Ga0105238_10001410 3300009551 Bacteria 24084
103 Ga0105238_10051850 3300009551 Bacteria 4125
104 Ga0105238_10407460 3300009551 Bacteria 1353
105 Ga0105249_11016940 3300009553 Bacteria 898
106 Ga0105239_10001342 3300010375 Bacteria 33155
107 Ga0105239_10917583 3300010375 Bacteria 1005
108 Ga0157373_10010249 3300013100 Bacteria 6904
109 Ga0157370_10004909 3300013104 Bacteria 15153
110 Ga0157369_10111187 3300013105 Bacteria 2912
111 Ga0157369_10658774 3300013105 Bacteria 1079
112 Ga0157374_10014937 3300013296 Bacteria 6805
113 Ga0157378_11232655 3300013297 Bacteria 788
114 Ga0157372_10002510 3300013307 Bacteria 19901
115 Ga0157372_10069982 3300013307 Bacteria 3947
116 Ga0157375_10603419 3300013308 Bacteria 1257
117 Ga0157379_10376612 3300014968 Bacteria 1302
118 Ga0182006_1053191 3300015261 Bacteria 1553
119 Ga0182007_10014332 3300015262 Bacteria 2993
120 Ga0163161_10019408 3300017792 Bacteria 4769
121 Ga0209566_100917 3300025225 Bacteria 13777
122 Ga0209674_101407 3300025226 Bacteria 6431
123 Ga0209672_100020 3300025228 Bacteria 429003
124 Ga0209672_100066 3300025228 Bacteria 189828
125 Ga0209672_108994 3300025228 Bacteria 1438
126 Ga0209147_100024 3300025229 Bacteria 429003
127 Ga0209147_100084 3300025229 Bacteria 189828
128 Ga0209147_100562 3300025229 Bacteria 20865
129 Ga0209258_100084 3300025242 Bacteria 244783
130 Ga0209258_100117 3300025242 Bacteria 189828
131 Ga0209148_1000442 3300025254 Bacteria 45703
132 Ga0209148_1000644 3300025254 Bacteria 30313
133 Ga0209759_1004404 3300025256 Bacteria 5275
134 Ga0209565_1000066 3300025263 Bacteria 173062
135 Ga0209455_1000110 3300025272 Bacteria 189828
136 Ga0209455_1000414 3300025272 Bacteria 34168
137 Ga0209455_1000627 3300025272 Bacteria 21920
138 Ga0209673_1000057 3300025273 Bacteria 270150
139 Ga0209675_1000930 3300025291 Bacteria 18669
140 Ga0209675_1006100 3300025291 Bacteria 4909
141 Ga0209025_1003952 3300025294 Bacteria 13303
142 Ga0209564_1001787 3300025295 Bacteria 19890
143 Ga0209758_1010144 3300025297 Bacteria 5696
144 Ga0209256_1000600 3300025299 Bacteria 50120
145 Ga0209256_1001560 3300025299 Bacteria 22629
146 Ga0209051_1062249 3300025303 Bacteria 1168
147 Ga0207696_1007555 3300025711 Bacteria 4240
148 Ga0207696_1011009 3300025711 Bacteria 3283
149 Ga0207682_10006158 3300025893 Bacteria 4847
150 Ga0207642_10184060 3300025899 Bacteria 1141
151 Ga0207647_10014824 3300025904 Bacteria 5362
152 Ga0207699_10321269 3300025906 Bacteria 1086
153 Ga0207645_10005869 3300025907 Bacteria 8845
154 Ga0207705_10008289 3300025909 Bacteria 7592
155 Ga0207705_10131768 3300025909 Bacteria 1861
156 Ga0207707_10008247 3300025912 Bacteria 9045
157 Ga0207695_10001034 3300025913 Bacteria 48892
158 Ga0207695_10004360 3300025913 Bacteria 19376
159 Ga0207695_10012371 3300025913 Bacteria 10250
160 Ga0207671_10044649 3300025914 Bacteria 3278
161 Ga0207671_10354068 3300025914 Bacteria 1164
162 Ga0207660_10208256 3300025917 Bacteria 1530
163 Ga0207657_10000003 3300025919 Bacteria 263148
164 Ga0207657_10001776 3300025919 Bacteria 23290
165 Ga0207652_10001985 3300025921 Bacteria 17706
166 Ga0207652_10382929 3300025921 Bacteria 1269
167 Ga0207694_10007403 3300025924 Bacteria 8325
168 Ga0207694_10053339 3300025924 Bacteria 3135
169 Ga0207659_10051046 3300025926 Bacteria 2940
170 Ga0207659_10216549 3300025926 Bacteria 1537
171 Ga0207644_10034000 3300025931 Bacteria 3567
172 Ga0207644_10561491 3300025931 Bacteria 945
173 Ga0207690_10000007 3300025932 Bacteria 388533
174 Ga0207706_10145881 3300025933 Bacteria 2082
175 Ga0207686_10001711 3300025934 Bacteria 12224
176 Ga0207709_10111648 3300025935 Bacteria 1829
177 Ga0207669_10116855 3300025937 Bacteria 1801
178 Ga0207691_10032476 3300025940 Bacteria 4866
179 Ga0207691_10034663 3300025940 Bacteria 4692
180 Ga0207691_10514520 3300025940 Bacteria 1016
181 Ga0207689_10018692 3300025942 Bacteria 5845
182 Ga0207667_10003444 3300025949 Bacteria 19522
183 Ga0207667_10036084 3300025949 Bacteria 5301
184 Ga0207658_10018517 3300025986 Bacteria 4810
185 Ga0207678_10001015 3300026067 Bacteria 25611
186 Ga0207702_10006926 3300026078 Bacteria 9709
187 Ga0207702_10365193 3300026078 Bacteria 1384
188 Ga0207648_10015068 3300026089 Bacteria 7119
189 Ga0207648_10016378 3300026089 Bacteria 6774
190 Ga0207648_10087409 3300026089 Bacteria 2720
191 Ga0207648_10103885 3300026089 Bacteria 2492
192 Ga0207648_10313185 3300026089 Bacteria 1409
193 Ga0207674_10005973 3300026116 Bacteria 14412
194 Ga0207674_10201771 3300026116 Bacteria 1938
195 Ga0207683_10050579 3300026121 Bacteria 3641
196 Ga0207683_10063863 3300026121 Bacteria 3244
197 Ga0207683_10365656 3300026121 Bacteria 1325
198 Ga0207698_10011334 3300026142 Bacteria 5773
199 Ga0207698_10132219 3300026142 Bacteria 2134
200 Ga0207698_10158856 3300026142 Bacteria 1974
201 Ga0207698_10172554 3300026142 Bacteria 1906
202 Ga0209371_1000255 3300027312 Bacteria 64538
203 Ga0268266_10221517 3300028379 Bacteria 1739
204 Ga0268265_10113266 3300028380 Bacteria 2219
205 Ga0265336_10025545 3300028666 Unclassified 1860
206 Ga0265338_10030681 3300028800 Bacteria 5287
207 Ga0265338_10078202 3300028800 Unclassified 2791
208 Ga0268256_1000210 3300030500 Bacteria 65841
209 Ga0265330_10007809 3300031235 Bacteria 5190
210 Ga0265332_10015028 3300031238 Bacteria 3422
211 Ga0265325_10004021 3300031241 Bacteria 9390
212 Ga0265339_10185634 3300031249 Bacteria 1033
213 Ga0307513_10026344 3300031456 Bacteria 6706
214 Ga0307509_10164174 3300031507 Bacteria 2113
215 Ga0307408_100641238 3300031548 Bacteria 949
216 Ga0265313_10005985 3300031595 Bacteria 8787
217 Ga0265314_10000552 3300031711 Bacteria 47809
218 Ga0265342_10005622 3300031712 Bacteria 9490
219 Ga0307410_10272347 3300031852 Bacteria 1325
220 Ga0307406_10283565 3300031901 Bacteria 1265
221 Ga0307406_10508825 3300031901 Bacteria 978
222 Ga0307409_100358714 3300031995 Bacteria 1378
223 Ga0307414_10923495 3300032004 Bacteria 801
224 Ga0307411_10623304 3300032005 Bacteria 930
225 Ga0307415_100384533 3300032126 Bacteria 1193
226 Ga0307510_10015777 3300033180 Bacteria 8931
227 Ga0373929_0048328 3300035085 Bacteria 966
228 Ga0373931_0332056 3300035691 Bacteria 947
229 Ga0395905_0002320 3300037471 Bacteria 21297
230 Ga0395905_0013468 3300037471 Bacteria 7837
231 Ga0395905_0141011 3300037471 Bacteria 2267
232 Ga0451853_0032473 3300041512 Bacteria 909
233 Ga0439432_017591 3300042006 Bacteria 2397
234 Ga0450896_018564 3300042133 Bacteria 1009
235 Ga0451577_0012180 3300042876 Bacteria 8086
236 Ga0451577_0772276 3300042876 Bacteria 869
237 Ga0466969_0002024 3300044656 Bacteria 10823
238 Ga0466973_0024812 3300044659 Bacteria 5750
239 Ga0466965_0017038 3300044683 Bacteria 3467
240 Ga0466965_0066682 3300044683 Bacteria 1805
241 Ga0466961_0053811 3300044693 Bacteria 2567
242 Ga0466961_0226490 3300044693 Bacteria 1151
243 Ga0466963_0000069 3300044694 Bacteria 35701
244 Ga0466971_0001214 3300044719 Bacteria 10720
245 Ga0466970_0031883 3300044765 Bacteria 2784
246 Ga0466957_0003376 3300044842 Bacteria 8767
247 Ga0466959_0030887 3300045049 Bacteria 3966
248 Ga0451576_0646742 3300045051 Bacteria 1111
249 Ga0466958_0078641 3300045836 Bacteria 2027
250 Ga0495603_0002758 3300046455 Bacteria 10350
251 Ga0495603_0044046 3300046455 Bacteria 2663
252 Ga0495590_0013851 3300046457 Bacteria 2956
253 Ga0495638_0026589 3300046460 Bacteria 3749
254 Ga0495638_0145534 3300046460 Bacteria 1379
255 Ga0495651_0000983 3300046462 Bacteria 22103
256 Ga0495650_0006343 3300046471 Bacteria 7391
257 Ga0495616_0035431 3300046513 Bacteria 2582
258 Ga0495632_0000963 3300046519 Bacteria 25144
259 Ga0495637_0006338 3300046520 Bacteria 5945
260 Ga0495648_0024838 3300046524 Bacteria 4069
261 Ga0495642_0000154 3300046528 Bacteria 39891
262 Ga0495654_0009615 3300046530 Bacteria 5295
263 Ga0495597_0000116 3300046542 Bacteria 72210
264 Ga0495633_0049648 3300046558 Bacteria 1980
265 Ga0495656_0091960 3300046615 Bacteria 1388
266 Ga0495611_0134126 3300046648 Bacteria 1155
267 Ga0495611_0171456 3300046648 Bacteria 1014
268 Ga0495625_0039840 3300046660 Bacteria 3429
269 Ga0495625_0073588 3300046660 Bacteria 2394
270 Ga0495659_0008512 3300046664 Bacteria 3264
271 Ga0495661_0167693 3300046665 Bacteria 1174
272 Ga0495669_0007480 3300046684 Bacteria 4580
273 Ga0495670_0066087 3300046691 Bacteria 1824
274 Ga0495671_0084661 3300046692 Bacteria 1553
275 Ga0495649_0110029 3300046694 Bacteria 1461
276 Ga0495589_0007879 3300046794 Bacteria 5577
277 Ga0495589_0012538 3300046794 Bacteria 4388
278 Ga0495676_0012801 3300047321 Bacteria 7544
279 Ga0495676_0048604 3300047321 Bacteria 3418
280 Ga0495683_0068222 3300047323 Bacteria 1749
281 Ga0495683_0178370 3300047323 Bacteria 972
282 Ga0495677_0002221 3300047445 Bacteria 7680
283 Ga0495677_0098410 3300047445 Bacteria 1106
284 Ga0495679_002218 3300047446 Bacteria 10112
285 Ga0495685_004069 3300047447 Bacteria 4701
286 Ga0495681_0035058 3300047470 Bacteria 2495
287 Ga0496126_0001121 3300048929 Bacteria 44841
288 Ga0496126_0004764 3300048929 Bacteria 15975
289 Ga0496126_0043586 3300048929 Bacteria 4138
290 Ga0495678_060997 3300049459 Bacteria 1416
291 Ga0501032_0105974 3300049569 Bacteria 1862
292 Ga0501034_0708356 3300049571 Bacteria 905
293 Ga0501043_0001751 3300049579 Bacteria 18712
294 Ga0501046_0008135 3300049580 Bacteria 9161
295 Ga0501047_0000546 3300049581 Bacteria 40630
296 Ga0501048_0000832 3300049582 Bacteria 22775
297 Ga0501035_0004633 3300049822 Bacteria 13044
298 Ga0501035_0011407 3300049822 Bacteria 8239
299 Ga0501044_0000045 3300049823 Bacteria 148353
300 Ga0501045_0047356 3300049824 Bacteria 3132
301 nmdc:mga0k408_1020_c1 3300050493 Bacteria 15354
302 nmdc:mga0k408_121964_c1 3300050493 Bacteria 1544
303 nmdc:mga06r32_149103_c1 3300050510 Bacteria 2317
304 nmdc:mga0sz30_53102_c1 3300050516 Bacteria 1721
305 Ga0500578_0032015 3300053086 Bacteria 3381
306 Ga0500651_0000787 3300053093 Bacteria 15478
307 Ga0500645_006873 3300053730 Bacteria 4018
308 Ga0466962_0014425 3300061719 Bacteria 3808

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10018558 rootH2_100185582 197
2 3300047447 Ga0495685_004069 Ga0495685_004069_2961_3617 202
3 3300005328 Ga0070676_10007786 Ga0070676_100077864 208
4 3300005334 Ga0068869_100012129 Ga0068869_1000121293 208
5 3300005364 Ga0070673_100043260 Ga0070673_1000432602 208
6 3300005366 Ga0070659_100807644 Ga0070659_1008076441 208
7 3300005456 Ga0070678_100425027 Ga0070678_1004250272 208
8 3300005457 Ga0070662_100129323 Ga0070662_1001293232 208
9 3300005459 Ga0068867_100030456 Ga0068867_1000304562 208
10 3300005459 Ga0068867_100062936 Ga0068867_1000629362 208
11 3300005577 Ga0068857_100045080 Ga0068857_1000450802 208
12 3300005614 Ga0068856_100296965 Ga0068856_1002969652 208
13 3300005844 Ga0068862_100083087 Ga0068862_1000830872 208
14 3300005844 Ga0068862_100089683 Ga0068862_1000896832 208
15 3300006353 Ga0075370_10089521 Ga0075370_100895212 208
16 3300006881 Ga0068865_100064949 Ga0068865_1000649492 208
17 3300009093 Ga0105240_10009041 Ga0105240_1000904111 208
18 3300009545 Ga0105237_10001734 Ga0105237_1000173414 208
19 3300009551 Ga0105238_10051850 Ga0105238_100518503 208
20 3300010375 Ga0105239_10001342 Ga0105239_1000134219 208
21 3300013297 Ga0157378_11232655 Ga0157378_112326551 208
22 3300013308 Ga0157375_10603419 Ga0157375_106034192 208
23 3300025907 Ga0207645_10005869 Ga0207645_100058696 208
24 3300025913 Ga0207695_10012371 Ga0207695_100123718 208
25 3300025931 Ga0207644_10034000 Ga0207644_100340003 208
26 3300025933 Ga0207706_10145881 Ga0207706_101458812 208
27 3300025935 Ga0207709_10111648 Ga0207709_101116483 208
28 3300025940 Ga0207691_10034663 Ga0207691_100346632 208
29 3300025942 Ga0207689_10018692 Ga0207689_100186923 208
30 3300025986 Ga0207658_10018517 Ga0207658_100185173 208
31 3300026089 Ga0207648_10015068 Ga0207648_100150686 208
32 3300026089 Ga0207648_10103885 Ga0207648_101038853 208
33 3300026116 Ga0207674_10005973 Ga0207674_100059738 208
34 3300026121 Ga0207683_10063863 Ga0207683_100638632 208
35 3300026121 Ga0207683_10365656 Ga0207683_103656562 208
36 3300026142 Ga0207698_10172554 Ga0207698_101725542 208
37 3300028380 Ga0268265_10113266 Ga0268265_101132662 208
38 3300031901 Ga0307406_10508825 Ga0307406_105088252 208
39 3300035691 Ga0373931_0332056 Ga0373931_0332056_31_678 208
40 3300041512 Ga0451853_0032473 Ga0451853_0032473_224_871 208
41 iso_pu_bacteria 2599185239 2599741461 208
42 iso_pu_bacteria 2599185240 2599748777 208
43 iso_pu_bacteria 2599185355 2600210678 208
44 iso_pu_bacteria 2643221654 2644302454 208
45 iso_pu_bacteria 2675903129 2676746937 208
46 iso_pu_bacteria 2818991452 2819635130 208
47 iso_pu_bacteria 2863421361 2863427178 208
48 iso_pu_bacteria 2928170801 2928178322 208
49 iso_pu_bacteria 2928536128 2928543014 208
50 iso_pu_bacteria 641736154 642414554 208
51 iso_pu_bacteria 8018845410 8018852529 208
52 iso_pu_bacteria 8020938398 8020943352 208
53 iso_pu_bacteria 8020953355 8020954543 208
54 iso_pu_bacteria 8021120328 8021123806 208
55 iso_pu_bacteria 8039098773 8039100617 208
56 3300005333 Ga0070677_10101200 Ga0070677_101012002 209
57 3300006195 Ga0075366_10100411 Ga0075366_101004112 209
58 3300031507 Ga0307509_10164174 Ga0307509_101641742 209
59 3300031548 Ga0307408_100641238 Ga0307408_1006412381 209
60 3300037471 Ga0395905_0002320 Ga0395905_0002320_14157_14819 209
61 3300042133 Ga0450896_018564 Ga0450896_018564_291_941 209
62 3300046558 Ga0495633_0049648 Ga0495633_0049648_1275_1937 209
63 3300047445 Ga0495677_0098410 Ga0495677_0098410_410_1072 209
64 3300050516 nmdc:mga0sz30_53102_c1 nmdc:mga0sz30_53102_c1_585_1232 209
65 iso_pu_bacteria 2870068957 2870073615 209
66 iso_pu_bacteria 2928157003 2928158319 209
67 iso_pu_bacteria 2928163908 2928167476 209
68 iso_pu_bacteria 2981990288 2981991781 209
69 iso_pu_bacteria 8020945358 8020952718 209
70 iso_pu_bacteria 2515154122 2515680183 210
71 3300005327 Ga0070658_10018007 Ga0070658_100180073 211
72 3300005330 Ga0070690_100290598 Ga0070690_1002905982 211
73 3300005333 Ga0070677_10115979 Ga0070677_101159791 211
74 3300005336 Ga0070680_100240127 Ga0070680_1002401272 211
75 3300005339 Ga0070660_100000965 Ga0070660_1000009659 211
76 3300005343 Ga0070687_100216553 Ga0070687_1002165531 211
77 3300005354 Ga0070675_100589674 Ga0070675_1005896742 211
78 3300005355 Ga0070671_100543262 Ga0070671_1005432621 211
79 3300005356 Ga0070674_100342733 Ga0070674_1003427332 211
80 3300005364 Ga0070673_100185825 Ga0070673_1001858252 211
81 3300005434 Ga0070709_10348899 Ga0070709_103488992 211
82 3300005436 Ga0070713_100405179 Ga0070713_1004051792 211
83 3300005456 Ga0070678_100271881 Ga0070678_1002718812 211
84 3300005458 Ga0070681_10003713 Ga0070681_100037136 211
85 3300005459 Ga0068867_100107085 Ga0068867_1001070852 211
86 3300005459 Ga0068867_100231253 Ga0068867_1002312532 211
87 3300005459 Ga0068867_100238393 Ga0068867_1002383932 211
88 3300005530 Ga0070679_100001120 Ga0070679_10000112012 211
89 3300005544 Ga0070686_100175438 Ga0070686_1001754382 211
90 3300005547 Ga0070693_100522726 Ga0070693_1005227262 211
91 3300005548 Ga0070665_100070516 Ga0070665_1000705162 211
92 3300005563 Ga0068855_100019387 Ga0068855_1000193878 211
93 3300005563 Ga0068855_100042237 Ga0068855_1000422374 211
94 3300005577 Ga0068857_100050579 Ga0068857_1000505793 211
95 3300005614 Ga0068856_100002983 Ga0068856_10000298310 211
96 3300005614 Ga0068856_101023281 Ga0068856_1010232811 211
97 3300005616 Ga0068852_100002020 Ga0068852_10000202010 211
98 3300005616 Ga0068852_100910518 Ga0068852_1009105182 211
99 3300005718 Ga0068866_10040445 Ga0068866_100404452 211
100 3300005718 Ga0068866_10232145 Ga0068866_102321452 211
101 3300005843 Ga0068860_100734623 Ga0068860_1007346232 211
102 3300006028 Ga0070717_10596215 Ga0070717_105962151 211
103 3300006195 Ga0075366_10010199 Ga0075366_100101992 211
104 3300006195 Ga0075366_10066802 Ga0075366_100668022 211
105 3300006195 Ga0075366_10072883 Ga0075366_100728832 211
106 3300007788 Ga0099795_10153000 Ga0099795_101530002 211
107 3300009093 Ga0105240_10002523 Ga0105240_100025239 211
108 3300009098 Ga0105245_10300945 Ga0105245_103009453 211
109 3300009176 Ga0105242_10001707 Ga0105242_100017074 211
110 3300009177 Ga0105248_10132506 Ga0105248_101325062 211
111 3300009551 Ga0105238_10001410 Ga0105238_100014108 211
112 3300009551 Ga0105238_10407460 Ga0105238_104074601 211
113 3300009553 Ga0105249_11016940 Ga0105249_110169402 211
114 3300010375 Ga0105239_10917583 Ga0105239_109175831 211
115 3300013104 Ga0157370_10004909 Ga0157370_100049093 211
116 3300013105 Ga0157369_10111187 Ga0157369_101111873 211
117 3300013296 Ga0157374_10014937 Ga0157374_100149374 211
118 3300013307 Ga0157372_10002510 Ga0157372_100025106 211
119 3300013307 Ga0157372_10069982 Ga0157372_100699822 211
120 3300014968 Ga0157379_10376612 Ga0157379_103766122 211
121 3300017792 Ga0163161_10019408 Ga0163161_100194083 211
122 3300025893 Ga0207682_10006158 Ga0207682_100061583 211
123 3300025899 Ga0207642_10184060 Ga0207642_101840602 211
124 3300025906 Ga0207699_10321269 Ga0207699_103212692 211
125 3300025909 Ga0207705_10008289 Ga0207705_100082893 211
126 3300025909 Ga0207705_10131768 Ga0207705_101317683 211
127 3300025912 Ga0207707_10008247 Ga0207707_100082477 211
128 3300025913 Ga0207695_10004360 Ga0207695_1000436014 211
129 3300025917 Ga0207660_10208256 Ga0207660_102082562 211
130 3300025919 Ga0207657_10001776 Ga0207657_100017766 211
131 3300025921 Ga0207652_10001985 Ga0207652_100019855 211
132 3300025921 Ga0207652_10382929 Ga0207652_103829292 211
133 3300025924 Ga0207694_10007403 Ga0207694_100074032 211
134 3300025926 Ga0207659_10051046 Ga0207659_100510463 211
135 3300025926 Ga0207659_10216549 Ga0207659_102165491 211
136 3300025931 Ga0207644_10561491 Ga0207644_105614911 211
137 3300025934 Ga0207686_10001711 Ga0207686_100017111 211
138 3300025937 Ga0207669_10116855 Ga0207669_101168552 211
139 3300025940 Ga0207691_10032476 Ga0207691_100324763 211
140 3300025940 Ga0207691_10514520 Ga0207691_105145202 211
141 3300025949 Ga0207667_10003444 Ga0207667_1000344412 211
142 3300026078 Ga0207702_10006926 Ga0207702_100069263 211
143 3300026078 Ga0207702_10365193 Ga0207702_103651932 211
144 3300026089 Ga0207648_10016378 Ga0207648_100163782 211
145 3300026089 Ga0207648_10087409 Ga0207648_100874092 211
146 3300026089 Ga0207648_10313185 Ga0207648_103131852 211
147 3300026121 Ga0207683_10050579 Ga0207683_100505795 211
148 3300026142 Ga0207698_10011334 Ga0207698_100113342 211
149 3300026142 Ga0207698_10158856 Ga0207698_101588562 211
150 3300028379 Ga0268266_10221517 Ga0268266_102215172 211
151 3300028666 Ga0265336_10025545 Ga0265336_100255452 211
152 3300028800 Ga0265338_10030681 Ga0265338_100306812 211
153 3300028800 Ga0265338_10078202 Ga0265338_100782021 211
154 3300031235 Ga0265330_10007809 Ga0265330_100078094 211
155 3300031238 Ga0265332_10015028 Ga0265332_100150283 211
156 3300031241 Ga0265325_10004021 Ga0265325_100040212 211
157 3300031249 Ga0265339_10185634 Ga0265339_101856341 211
158 3300031456 Ga0307513_10026344 Ga0307513_100263445 211
159 3300031595 Ga0265313_10005985 Ga0265313_100059855 211
160 3300031711 Ga0265314_10000552 Ga0265314_100005524 211
161 3300031712 Ga0265342_10005622 Ga0265342_100056222 211
162 3300031852 Ga0307410_10272347 Ga0307410_102723471 211
163 3300031901 Ga0307406_10283565 Ga0307406_102835652 211
164 3300032004 Ga0307414_10923495 Ga0307414_109234951 211
165 3300032005 Ga0307411_10623304 Ga0307411_106233042 211
166 3300032126 Ga0307415_100384533 Ga0307415_1003845332 211
167 3300033180 Ga0307510_10015777 Ga0307510_100157778 211
168 3300035085 Ga0373929_0048328 Ga0373929_0048328_70_726 211
169 3300037471 Ga0395905_0013468 Ga0395905_0013468_3446_4105 211
170 3300037471 Ga0395905_0141011 Ga0395905_0141011_1487_2155 211
171 3300042876 Ga0451577_0012180 Ga0451577_0012180_1674_2336 211
172 3300044683 Ga0466965_0066682 Ga0466965_0066682_734_1390 211
173 3300044693 Ga0466961_0226490 Ga0466961_0226490_270_926 211
174 3300045836 Ga0466958_0078641 Ga0466958_0078641_909_1565 211
175 3300046455 Ga0495603_0002758 Ga0495603_0002758_4102_4791 211
176 3300046455 Ga0495603_0044046 Ga0495603_0044046_254_958 211
177 3300046460 Ga0495638_0145534 Ga0495638_0145534_70_759 211
178 3300046648 Ga0495611_0171456 Ga0495611_0171456_35_724 211
179 3300046660 Ga0495625_0039840 Ga0495625_0039840_367_1056 211
180 3300046665 Ga0495661_0167693 Ga0495661_0167693_436_1125 211
181 3300046691 Ga0495670_0066087 Ga0495670_0066087_1090_1779 211
182 3300046794 Ga0495589_0012538 Ga0495589_0012538_1265_1954 211
183 3300047321 Ga0495676_0012801 Ga0495676_0012801_6302_6991 211
184 3300047321 Ga0495676_0048604 Ga0495676_0048604_553_1257 211
185 3300047323 Ga0495683_0178370 Ga0495683_0178370_141_830 211
186 3300048929 Ga0496126_0001121 Ga0496126_0001121_40785_41441 211
187 3300048929 Ga0496126_0043586 Ga0496126_0043586_2988_3644 211
188 3300049569 Ga0501032_0105974 Ga0501032_0105974_732_1391 211
189 3300049579 Ga0501043_0001751 Ga0501043_0001751_13188_13847 211
190 3300049580 Ga0501046_0008135 Ga0501046_0008135_3637_4296 211
191 3300049581 Ga0501047_0000546 Ga0501047_0000546_35106_35765 211
192 3300049582 Ga0501048_0000832 Ga0501048_0000832_18471_19130 211
193 3300049824 Ga0501045_0047356 Ga0501045_0047356_2337_2996 211
194 3300050493 nmdc:mga0k408_1020_c1 nmdc:mga0k408_1020_c1_13058_13714 211
195 3300050493 nmdc:mga0k408_121964_c1 nmdc:mga0k408_121964_c1_62_718 211
196 3300053086 Ga0500578_0032015 Ga0500578_0032015_1010_1675 211
197 3300053730 Ga0500645_006873 Ga0500645_006873_1195_1860 211
198 iso_pu_bacteria 2791355406 2793985500 211
199 iso_pu_bacteria 8047893842 8047903625 211
200 iso_pu_bacteria 8048356638 8048356887 211
201 iso_pu_bacteria 8048369669 8048378938 211
202 iso_pu_bacteria 8048379754 8048388041 211
203 3300001989 JGI24739J22299_10008043 JGI24739J22299_100080432 212
204 3300003187 JGI25151J46595_10001553 JGI25151J46595_100015538 212
205 3300003316 rootH1_10025618 rootH1_100256187 212
206 3300003758 Ga0055532_1000422 Ga0055532_10004222 212
207 3300003758 Ga0055532_1000486 Ga0055532_100048621 212
208 3300003758 Ga0055532_1000548 Ga0055532_10005486 212
209 3300003760 Ga0055527_1000288 Ga0055527_100028826 212
210 3300003760 Ga0055527_1000359 Ga0055527_100035921 212
211 3300003761 Ga0055535_1000604 Ga0055535_100060426 212
212 3300003761 Ga0055535_1000845 Ga0055535_100084521 212
213 3300003762 Ga0055542_1000633 Ga0055542_100063326 212
214 3300003762 Ga0055542_1000944 Ga0055542_100094419 212
215 3300003763 Ga0055529_1000568 Ga0055529_100056826 212
216 3300003763 Ga0055529_1000659 Ga0055529_100065914 212
217 3300003771 Ga0055526_1011012 Ga0055526_10110122 212
218 3300003773 Ga0055537_1004761 Ga0055537_10047614 212
219 3300003775 Ga0055524_1000647 Ga0055524_100064722 212
220 3300003790 Ga0055528_1001220 Ga0055528_100122015 212
221 3300003856 Ga0058692_1016051 Ga0058692_10160512 212
222 3300005288 Ga0065714_10075842 Ga0065714_100758423 212
223 3300005339 Ga0070660_100000006 Ga0070660_10000000629 212
224 3300005366 Ga0070659_100000082 Ga0070659_10000008260 212
225 3300005455 Ga0070663_100006199 Ga0070663_1000061996 212
226 3300005467 Ga0070706_100221268 Ga0070706_1002212682 212
227 3300005548 Ga0070665_100061178 Ga0070665_1000611783 212
228 3300005563 Ga0068855_100773125 Ga0068855_1007731251 212
229 3300005564 Ga0070664_100135664 Ga0070664_1001356643 212
230 3300005577 Ga0068857_100460801 Ga0068857_1004608012 212
231 3300005614 Ga0068856_100286394 Ga0068856_1002863942 212
232 3300005937 Ga0081455_10253261 Ga0081455_102532612 212
233 3300006186 Ga0075369_10006157 Ga0075369_100061572 212
234 3300006844 Ga0075428_100002412 Ga0075428_10000241213 212
235 3300006847 Ga0075431_100011563 Ga0075431_1000115636 212
236 3300009011 Ga0105251_10004244 Ga0105251_100042442 212
237 3300009036 Ga0105244_10119850 Ga0105244_101198501 212
238 3300009092 Ga0105250_10002909 Ga0105250_100029092 212
239 3300009093 Ga0105240_10002065 Ga0105240_100020653 212
240 3300009093 Ga0105240_10018427 Ga0105240_100184271 212
241 3300009147 Ga0114129_10275997 Ga0114129_102759972 212
242 3300009148 Ga0105243_10020397 Ga0105243_100203975 212
243 3300009545 Ga0105237_10018081 Ga0105237_100180814 212
244 3300009545 Ga0105237_10112557 Ga0105237_101125572 212
245 3300013100 Ga0157373_10010249 Ga0157373_100102492 212
246 3300013105 Ga0157369_10658774 Ga0157369_106587741 212
247 3300015261 Ga0182006_1053191 Ga0182006_10531912 212
248 3300015262 Ga0182007_10014332 Ga0182007_100143322 212
249 3300025225 Ga0209566_100917 Ga0209566_10091714 212
250 3300025226 Ga0209674_101407 Ga0209674_1014072 212
251 3300025228 Ga0209672_100020 Ga0209672_100020106 212
252 3300025228 Ga0209672_100066 Ga0209672_10006626 212
253 3300025228 Ga0209672_108994 Ga0209672_1089942 212
254 3300025229 Ga0209147_100024 Ga0209147_100024106 212
255 3300025229 Ga0209147_100084 Ga0209147_100084141 212
256 3300025229 Ga0209147_100562 Ga0209147_1005623 212
257 3300025242 Ga0209258_100084 Ga0209258_100084106 212
258 3300025242 Ga0209258_100117 Ga0209258_100117141 212
259 3300025254 Ga0209148_1000442 Ga0209148_100044241 212
260 3300025254 Ga0209148_1000644 Ga0209148_100064426 212
261 3300025256 Ga0209759_1004404 Ga0209759_10044044 212
262 3300025263 Ga0209565_1000066 Ga0209565_1000066135 212
263 3300025272 Ga0209455_1000110 Ga0209455_1000110141 212
264 3300025272 Ga0209455_1000414 Ga0209455_100041426 212
265 3300025272 Ga0209455_1000627 Ga0209455_100062720 212
266 3300025273 Ga0209673_1000057 Ga0209673_1000057108 212
267 3300025291 Ga0209675_1000930 Ga0209675_10009305 212
268 3300025291 Ga0209675_1006100 Ga0209675_10061003 212
269 3300025294 Ga0209025_1003952 Ga0209025_100395211 212
270 3300025295 Ga0209564_1001787 Ga0209564_10017872 212
271 3300025297 Ga0209758_1010144 Ga0209758_10101446 212
272 3300025299 Ga0209256_1000600 Ga0209256_100060039 212
273 3300025299 Ga0209256_1001560 Ga0209256_100156010 212
274 3300025303 Ga0209051_1062249 Ga0209051_10622491 212
275 3300025711 Ga0207696_1007555 Ga0207696_10075552 212
276 3300025711 Ga0207696_1011009 Ga0207696_10110093 212
277 3300025904 Ga0207647_10014824 Ga0207647_100148242 212
278 3300025913 Ga0207695_10001034 Ga0207695_100010347 212
279 3300025914 Ga0207671_10044649 Ga0207671_100446493 212
280 3300025914 Ga0207671_10354068 Ga0207671_103540682 212
281 3300025919 Ga0207657_10000003 Ga0207657_10000003111 212
282 3300025924 Ga0207694_10053339 Ga0207694_100533393 212
283 3300025932 Ga0207690_10000007 Ga0207690_10000007112 212
284 3300025949 Ga0207667_10036084 Ga0207667_100360845 212
285 3300026067 Ga0207678_10001015 Ga0207678_1000101527 212
286 3300026116 Ga0207674_10201771 Ga0207674_102017712 212
287 3300026142 Ga0207698_10132219 Ga0207698_101322192 212
288 3300027312 Ga0209371_1000255 Ga0209371_100025528 212
289 3300030500 Ga0268256_1000210 Ga0268256_100021028 212
290 3300031995 Ga0307409_100358714 Ga0307409_1003587142 212
291 3300042006 Ga0439432_017591 Ga0439432_017591_465_1127 212
292 3300042876 Ga0451577_0772276 Ga0451577_0772276_72_743 212
293 3300044656 Ga0466969_0002024 Ga0466969_0002024_2918_3559 212
294 3300044659 Ga0466973_0024812 Ga0466973_0024812_525_1166 212
295 3300044683 Ga0466965_0017038 Ga0466965_0017038_45_686 212
296 3300044693 Ga0466961_0053811 Ga0466961_0053811_1882_2523 212
297 3300044694 Ga0466963_0000069 Ga0466963_0000069_19195_19836 212
298 3300044719 Ga0466971_0001214 Ga0466971_0001214_9255_9896 212
299 3300044765 Ga0466970_0031883 Ga0466970_0031883_486_1127 212
300 3300044842 Ga0466957_0003376 Ga0466957_0003376_4945_5586 212
301 3300045049 Ga0466959_0030887 Ga0466959_0030887_2397_3038 212
302 3300045051 Ga0451576_0646742 Ga0451576_0646742_355_1014 212
303 3300046457 Ga0495590_0013851 Ga0495590_0013851_1027_1665 212
304 3300046460 Ga0495638_0026589 Ga0495638_0026589_3057_3695 212
305 3300046462 Ga0495651_0000983 Ga0495651_0000983_12781_13455 212
306 3300046471 Ga0495650_0006343 Ga0495650_0006343_4142_4780 212
307 3300046513 Ga0495616_0035431 Ga0495616_0035431_537_1175 212
308 3300046519 Ga0495632_0000963 Ga0495632_0000963_20997_21635 212
309 3300046520 Ga0495637_0006338 Ga0495637_0006338_2703_3341 212
310 3300046524 Ga0495648_0024838 Ga0495648_0024838_2896_3534 212
311 3300046528 Ga0495642_0000154 Ga0495642_0000154_6902_7540 212
312 3300046530 Ga0495654_0009615 Ga0495654_0009615_1294_1932 212
313 3300046542 Ga0495597_0000116 Ga0495597_0000116_44734_45381 212
314 3300046615 Ga0495656_0091960 Ga0495656_0091960_86_724 212
315 3300046648 Ga0495611_0134126 Ga0495611_0134126_456_1094 212
316 3300046660 Ga0495625_0073588 Ga0495625_0073588_1201_1839 212
317 3300046664 Ga0495659_0008512 Ga0495659_0008512_1330_1968 212
318 3300046684 Ga0495669_0007480 Ga0495669_0007480_63_701 212
319 3300046692 Ga0495671_0084661 Ga0495671_0084661_633_1271 212
320 3300046694 Ga0495649_0110029 Ga0495649_0110029_178_816 212
321 3300046794 Ga0495589_0007879 Ga0495589_0007879_3893_4531 212
322 3300047323 Ga0495683_0068222 Ga0495683_0068222_65_703 212
323 3300047445 Ga0495677_0002221 Ga0495677_0002221_2693_3331 212
324 3300047446 Ga0495679_002218 Ga0495679_002218_3673_4311 212
325 3300047470 Ga0495681_0035058 Ga0495681_0035058_1333_1971 212
326 3300048929 Ga0496126_0004764 Ga0496126_0004764_7033_7683 212
327 3300049459 Ga0495678_060997 Ga0495678_060997_536_1174 212
328 3300049571 Ga0501034_0708356 Ga0501034_0708356_92_754 212
329 3300049822 Ga0501035_0004633 Ga0501035_0004633_728_1390 212
330 3300049822 Ga0501035_0011407 Ga0501035_0011407_188_850 212
331 3300049823 Ga0501044_0000045 Ga0501044_0000045_10059_10721 212
332 3300050510 nmdc:mga06r32_149103_c1 nmdc:mga06r32_149103_c1_669_1328 212
333 3300053093 Ga0500651_0000787 Ga0500651_0000787_5954_6604 212
334 3300061719 Ga0466962_0014425 Ga0466962_0014425_1122_1763 212
335 iso_pu_bacteria 2622736626 2623589263 212
336 iso_pu_bacteria 2862574272 2862584039 212
337 iso_pu_bacteria 2921643360 2921647882 212
338 iso_pu_bacteria 8048127548 8048131988 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00596

Aldolase_II

Class II Aldolase and Adducin N-terminal domain

28

213

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9448 4 205
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.9412 4 205
6vop-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from escherichia coli 0.9185 4 205
6voq-assembly1.cif.gz_A crystal structure of ygbl, a putative aldolase/epimerase/decarboxylase from klebsiella pneumoniae 0.915 4 205
2opi-assembly1.cif.gz_B crystal structure of l-fuculose-1-phosphate aldolase from bacteroides thetaiotaomicron 0.8944 9 207
ID Description Score Start End Superfamily
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9466 4 205 3.40.225.10
af_Q46890_7_212_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9245 4 205 3.40.225.10
af_Q58813_1_180_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.9004 8 188 3.40.225.10
af_P95075_7_208_3.40.225.10 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8946 8 204 3.40.225.10
6btgA00 Alpha Beta;3-Layer(aba) Sandwich;L-fuculose-1-phosphate Aldolase;Class II aldolase/adducin N-terminal domain 0.8901 5 208 3.40.225.10
ID Description Score Start End GO Terms
AF-A0A3M4JP80-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9961 3 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A2N5C5S4-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.996 1 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A3N8E765-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9947 1 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A2N5C5S4-F1-model_v4 3-oxo-tetronate 4-phosphate decarboxylase (EC 4.1.1.104) 0.9913 1 212 GO:0005829
GO:0016832
GO:0019323
GO:0046872
AF-A0A656H5S0-F1-model_v4 deleted 0.989 115 212

Feature Viewer

pLDDT pTM Quality
93.02 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map