F413591

General Info

Members Datasets Scaffolds Average Seq Length
338 228 676 305

Family's Representative Sequence

Representative Sequence 3300035115|Ga0373941_0001706|Ga0373941_0001706_62_1072
Length 336
Sequence VNGGFSCRCAAALATNTPLRYDPPGKKGYRNGILPIATRPRHLQALEDESIHIMREVAAQSAKPVMLYSIGKDSSVMLHLAMKAFYPSKPPFPLLHVDTTWKFREMIAFRDQRVKDLGLNLIVHINQDGLKAGIGPFTHGSAVHTDVMKTQALRQALDKYGFDAAFGGARRDEEKSRAKERIFSFRTASHRWDPKNQRPELWHIFNGRVHKGESIRVFPLSNWTELDIWQYVQAENIPVVPLYFAKPRPIVERDGALIMVDDDRMKLAPGEKPQMKTVRFRTLGCYPLTGAVESDAANVDDIVRETLAATQSERQGRVIDHDQAGSMEKKKQEGYF

Samples

Sample ID Description Type Environment
1 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
71 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
72 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
123 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
133 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
134 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
138 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
139 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
140 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
141 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
142 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
143 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
160 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
188 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
205 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
208 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
214 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
215 2517572101 Frankia sp. DC12 Isolate Nodule
216 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
217 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
218 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
219 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
220 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
221 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
222 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
223 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
224 2922554459 Rhodococcus sp. 66b Isolate Unclassified
225 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
226 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
227 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
228 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.56
Metatranscriptomes 0
Isolates 4.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.96
Nodule 0.89
Rhizoplane 1.18
Rhizosphere 86.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373941_0001706 3300035115 Bacteria 4707
2 Ga0065712_10069040 3300005290 Bacteria 8204
3 Ga0065715_10094304 3300005293 Bacteria 4381
4 Ga0070658_10001463 3300005327 Bacteria 20131
5 Ga0070690_100003395 3300005330 Bacteria 8703
6 Ga0070670_100133513 3300005331 Bacteria 2144
7 Ga0070666_10027482 3300005335 Bacteria 3727
8 Ga0070682_100028657 3300005337 Bacteria 3350
9 Ga0070660_100010111 3300005339 Bacteria 6657
10 Ga0070689_100005360 3300005340 Bacteria 8746
11 Ga0070687_100010136 3300005343 Bacteria 4061
12 Ga0070661_100006923 3300005344 Bacteria 7825
13 Ga0070668_100327780 3300005347 Bacteria 1290
14 Ga0070669_100014008 3300005353 Bacteria 5702
15 Ga0070675_100047665 3300005354 Bacteria 3511
16 Ga0070673_100043765 3300005364 Bacteria 3462
17 Ga0070659_100009208 3300005366 Bacteria 7247
18 Ga0070659_100453739 3300005366 Bacteria 1088
19 Ga0070714_100005744 3300005435 Bacteria 9511
20 Ga0070714_100190797 3300005435 Bacteria 1870
21 Ga0070714_100206893 3300005435 Bacteria 1797
22 Ga0070714_100417503 3300005435 Bacteria 1271
23 Ga0070713_100332586 3300005436 Bacteria 1405
24 Ga0070705_100005571 3300005440 Bacteria 6143
25 Ga0070694_100010895 3300005444 Bacteria 5626
26 Ga0070681_10109032 3300005458 Bacteria 2709
27 Ga0070681_10113990 3300005458 Bacteria 2642
28 Ga0070679_100027049 3300005530 Bacteria 5640
29 Ga0070679_100227090 3300005530 Bacteria 1827
30 Ga0070684_100038878 3300005535 Bacteria 4090
31 Ga0068853_100012264 3300005539 Bacteria 6969
32 Ga0070672_100168619 3300005543 Bacteria 1820
33 Ga0070686_100004123 3300005544 Bacteria 7998
34 Ga0070695_100062793 3300005545 Bacteria 2413
35 Ga0070696_100001773 3300005546 Bacteria 14149
36 Ga0070693_100072551 3300005547 Bacteria 2031
37 Ga0070665_100016767 3300005548 Bacteria 7343
38 Ga0068855_100049816 3300005563 Bacteria 4938
39 Ga0068855_100098003 3300005563 Bacteria 3377
40 Ga0070664_100002892 3300005564 Bacteria 13898
41 Ga0068857_100025137 3300005577 Bacteria 5245
42 Ga0070702_100000268 3300005615 Bacteria 17734
43 Ga0068859_100000952 3300005617 Bacteria 29623
44 Ga0068864_100002936 3300005618 Bacteria 14096
45 Ga0068861_100034116 3300005719 Bacteria 3761
46 Ga0068861_100450977 3300005719 Bacteria 1152
47 Ga0068870_10119038 3300005840 Bacteria 1519
48 Ga0068863_100012993 3300005841 Bacteria 8029
49 Ga0068863_100050158 3300005841 Bacteria 3958
50 Ga0068858_100075593 3300005842 Bacteria 3129
51 Ga0068860_100000433 3300005843 Bacteria 53218
52 Ga0068860_100009792 3300005843 Bacteria 9512
53 Ga0068862_100003350 3300005844 Bacteria 13829
54 Ga0081539_10005127 3300005985 Bacteria 13679
55 Ga0070717_10011454 3300006028 Bacteria 6737
56 Ga0075365_10218634 3300006038 Bacteria 1336
57 Ga0070712_100062412 3300006175 Bacteria 2635
58 Ga0070712_100071288 3300006175 Bacteria 2486
59 Ga0075366_10223046 3300006195 Bacteria 1148
60 Ga0068865_100032190 3300006881 Bacteria 3501
61 Ga0097620_100000952 3300006931 Bacteria 29623
62 Ga0105240_10000565 3300009093 Bacteria 68589
63 Ga0105240_10389173 3300009093 Bacteria 1573
64 Ga0111539_10040972 3300009094 Bacteria 5571
65 Ga0105245_10367494 3300009098 Bacteria 1429
66 Ga0105243_10052724 3300009148 Bacteria 3223
67 Ga0105243_10377406 3300009148 Bacteria 1310
68 Ga0105241_10177574 3300009174 Bacteria 1764
69 Ga0105242_10258457 3300009176 Bacteria 1572
70 Ga0105248_10015017 3300009177 Bacteria 8524
71 Ga0105248_10194120 3300009177 Bacteria 2287
72 Ga0105248_10325896 3300009177 Bacteria 1730
73 Ga0105238_10021071 3300009551 Bacteria 6642
74 Ga0105238_10197587 3300009551 Bacteria 1987
75 Ga0105249_10024307 3300009553 Bacteria 5444
76 Ga0105249_10246653 3300009553 Bacteria 1768
77 Ga0105239_10196616 3300010375 Bacteria 2258
78 Ga0157373_10014025 3300013100 Bacteria 5875
79 Ga0157371_10004904 3300013102 Bacteria 11495
80 Ga0157370_10006319 3300013104 Bacteria 13090
81 Ga0157370_10023217 3300013104 Bacteria 6161
82 Ga0157369_10002349 3300013105 Bacteria 22746
83 Ga0163162_10062184 3300013306 Bacteria 3774
84 Ga0163162_10224546 3300013306 Bacteria 2008
85 Ga0157372_10006819 3300013307 Bacteria 12145
86 Ga0157372_10509359 3300013307 Bacteria 1403
87 Ga0157375_10057501 3300013308 Bacteria 3845
88 Ga0157375_10431913 3300013308 Bacteria 1483
89 Ga0163163_10006283 3300014325 Bacteria 10371
90 Ga0157377_10080090 3300014745 Bacteria 1907
91 Ga0182006_1014042 3300015261 Bacteria 3458
92 Ga0213872_10003477 3300021361 Bacteria 8730
93 Ga0209674_100332 3300025226 Bacteria 28707
94 Ga0209674_100507 3300025226 Bacteria 16050
95 Ga0209026_1000129 3300025250 Bacteria 121927
96 Ga0207680_10016894 3300025903 Bacteria 3843
97 Ga0207647_10000005 3300025904 Bacteria 223490
98 Ga0207647_10008549 3300025904 Bacteria 7330
99 Ga0207643_10119706 3300025908 Bacteria 1558
100 Ga0207705_10000092 3300025909 Bacteria 109488
101 Ga0207705_10028248 3300025909 Bacteria 3999
102 Ga0207707_10006254 3300025912 Bacteria 10398
103 Ga0207707_10195741 3300025912 Bacteria 1763
104 Ga0207695_10006009 3300025913 Bacteria 15873
105 Ga0207693_10138936 3300025915 Bacteria 1911
106 Ga0207693_10466346 3300025915 Bacteria 986
107 Ga0207663_10263276 3300025916 Bacteria 1274
108 Ga0207660_10211099 3300025917 Bacteria 1520
109 Ga0207662_10013208 3300025918 Bacteria 4616
110 Ga0207657_10002811 3300025919 Bacteria 18726
111 Ga0207649_10037635 3300025920 Bacteria 2924
112 Ga0207652_10018663 3300025921 Bacteria 5691
113 Ga0207652_10133198 3300025921 Bacteria 2218
114 Ga0207652_10416832 3300025921 Bacteria 1211
115 Ga0207681_10011541 3300025923 Bacteria 5428
116 Ga0207694_10127878 3300025924 Bacteria 2034
117 Ga0207694_10211973 3300025924 Bacteria 1578
118 Ga0207650_10261390 3300025925 Bacteria 1404
119 Ga0207659_10016318 3300025926 Bacteria 4831
120 Ga0207687_10187451 3300025927 Bacteria 1607
121 Ga0207664_10000415 3300025929 Bacteria 30402
122 Ga0207664_10166801 3300025929 Bacteria 1882
123 Ga0207664_10313229 3300025929 Bacteria 1383
124 Ga0207644_10168248 3300025931 Bacteria 1709
125 Ga0207690_10035469 3300025932 Bacteria 3222
126 Ga0207706_10154595 3300025933 Bacteria 2018
127 Ga0207706_10368395 3300025933 Bacteria 1248
128 Ga0207686_10217394 3300025934 Bacteria 1378
129 Ga0207709_10058975 3300025935 Bacteria 2387
130 Ga0207670_10003474 3300025936 Bacteria 8359
131 Ga0207704_10337501 3300025938 Bacteria 1169
132 Ga0207691_10170621 3300025940 Bacteria 1905
133 Ga0207711_10023092 3300025941 Bacteria 5208
134 Ga0207679_10014125 3300025945 Bacteria 5243
135 Ga0207667_10028014 3300025949 Bacteria 6123
136 Ga0207651_10024412 3300025960 Bacteria 3739
137 Ga0207712_10144139 3300025961 Bacteria 1832
138 Ga0207703_10064202 3300026035 Bacteria 3013
139 Ga0207639_10008473 3300026041 Bacteria 7048
140 Ga0207708_10045871 3300026075 Bacteria 3330
141 Ga0207641_10024903 3300026088 Bacteria 4934
142 Ga0207641_10074662 3300026088 Bacteria 2925
143 Ga0207641_10409902 3300026088 Bacteria 1303
144 Ga0207676_10021640 3300026095 Bacteria 4720
145 Ga0207674_10012772 3300026116 Bacteria 9380
146 Ga0207674_10066730 3300026116 Bacteria 3623
147 Ga0207675_100051923 3300026118 Bacteria 3826
148 Ga0207675_100109226 3300026118 Bacteria 2609
149 Ga0207675_100144474 3300026118 Bacteria 2261
150 Ga0268266_10109654 3300028379 Bacteria 2444
151 Ga0268264_10000062 3300028381 Bacteria 302110
152 Ga0268264_10089428 3300028381 Bacteria 2651
153 Ga0265334_10004005 3300028573 Bacteria 6613
154 Ga0265334_10027166 3300028573 Bacteria 2306
155 Ga0307515_10119661 3300028794 Bacteria 2993
156 Ga0265338_10000697 3300028800 Bacteria 57680
157 Ga0265338_10012477 3300028800 Bacteria 9685
158 Ga0265338_10070512 3300028800 Bacteria 2996
159 Ga0265328_10064147 3300031239 Bacteria 1349
160 Ga0265320_10000713 3300031240 Bacteria 25439
161 Ga0265325_10002590 3300031241 Bacteria 12126
162 Ga0265325_10003363 3300031241 Bacteria 10494
163 Ga0265325_10012722 3300031241 Bacteria 4803
164 Ga0265340_10030809 3300031247 Bacteria 2687
165 Ga0265331_10000419 3300031250 Bacteria 43019
166 Ga0265327_10000074 3300031251 Bacteria 214435
167 Ga0265316_10141229 3300031344 Bacteria 1808
168 Ga0307513_10010168 3300031456 Bacteria 11832
169 Ga0307513_10229095 3300031456 Bacteria 1672
170 Ga0307513_10329757 3300031456 Bacteria 1281
171 Ga0265313_10000292 3300031595 Bacteria 54582
172 Ga0316575_10044383 3300031665 Bacteria 1764
173 Ga0265314_10002776 3300031711 Bacteria 17490
174 Ga0265314_10015460 3300031711 Bacteria 6056
175 Ga0265342_10010205 3300031712 Bacteria 6538
176 Ga0307516_10008557 3300031730 Bacteria 11553
177 Ga0307412_10220434 3300031911 Bacteria 1454
178 Ga0316583_10002746 3300032133 Bacteria 6157
179 Ga0316585_10034357 3300032137 Bacteria 1602
180 Ga0316580_10003426 3300032139 Bacteria 4500
181 Ga0373931_0053913 3300035691 Bacteria 2147
182 Ga0316582_0018890 3300036647 Bacteria 4022
183 Ga0436364_0761783 3300037853 Bacteria 1133
184 Ga0400483_094321 3300039062 Bacteria 60006
185 Ga0400483_175798 3300039062 Bacteria 45834
186 Ga0436365_0097042 3300039437 Bacteria 195024
187 Ga0436360_1325990 3300039438 Bacteria 2580
188 Ga0436361_0041735 3300039447 Bacteria 40196
189 Ga0436361_0090261 3300039447 Bacteria 10047
190 Ga0466965_0111937 3300044683 Bacteria 1403
191 Ga0466965_0222695 3300044683 Bacteria 1006
192 Ga0466966_0000588 3300044684 Bacteria 23112
193 Ga0466961_0000753 3300044693 Bacteria 20269
194 Ga0466961_0009959 3300044693 Bacteria 6058
195 Ga0466963_0061976 3300044694 Bacteria 2502
196 Ga0466963_0070166 3300044694 Bacteria 2356
197 Ga0453684_0327695 3300044712 Bacteria 1732
198 Ga0466971_0056959 3300044719 Bacteria 1763
199 Ga0466968_0015381 3300044735 Bacteria 3032
200 Ga0466959_0015031 3300045049 Bacteria 5640
201 Ga0466959_0020207 3300045049 Bacteria 4903
202 Ga0451576_0005130 3300045051 Bacteria 16597
203 Ga0466958_0000561 3300045836 Bacteria 15805
204 Ga0466967_0103412 3300045976 Bacteria 2606
205 Ga0466967_0129171 3300045976 Bacteria 2344
206 Ga0495603_0179504 3300046455 Bacteria 1225
207 Ga0495638_0000357 3300046460 Bacteria 56906
208 Ga0495638_0004581 3300046460 Bacteria 10462
209 Ga0495650_0000134 3300046471 Bacteria 173331
210 Ga0495664_0080187 3300046477 Bacteria 1956
211 Ga0495594_0014818 3300046499 Bacteria 4091
212 Ga0495606_0002555 3300046507 Bacteria 20910
213 Ga0495628_0054241 3300046516 Bacteria 3161
214 Ga0495668_0000701 3300046616 Bacteria 40353
215 Ga0495599_0032111 3300046678 Bacteria 3296
216 Ga0495646_0022223 3300046680 Bacteria 4002
217 Ga0495658_0061525 3300046683 Bacteria 2156
218 Ga0495672_0131044 3300047320 Bacteria 1319
219 Ga0496108_0041668 3300048911 Bacteria 3834
220 Ga0496108_0045494 3300048911 Bacteria 3666
221 Ga0496109_0012381 3300048912 Bacteria 7365
222 Ga0496111_0069404 3300048914 Bacteria 2563
223 Ga0496117_0151408 3300048920 Bacteria 1372
224 Ga0496118_0001532 3300048921 Bacteria 34388
225 Ga0496123_0015488 3300048926 Bacteria 6252
226 Ga0496125_0000125 3300048928 Bacteria 169979
227 Ga0496125_0004167 3300048928 Bacteria 16852
228 Ga0496125_0032650 3300048928 Bacteria 4621
229 Ga0496125_0130239 3300048928 Bacteria 1772
230 Ga0496126_0000624 3300048929 Bacteria 66411
231 Ga0496126_0030412 3300048929 Bacteria 5116
232 Ga0496126_0047677 3300048929 Bacteria 3922
233 Ga0496126_0113568 3300048929 Bacteria 2357
234 Ga0501032_0072398 3300049569 Bacteria 2297
235 Ga0501032_0072437 3300049569 Bacteria 2296
236 Ga0501032_0163712 3300049569 Bacteria 1460
237 Ga0501033_0096572 3300049570 Bacteria 2159
238 Ga0501034_0001651 3300049571 Bacteria 28815
239 Ga0501034_0001824 3300049571 Bacteria 27067
240 Ga0501034_0005587 3300049571 Bacteria 13696
241 Ga0501034_0085409 3300049571 Bacteria 3157
242 Ga0501036_0012931 3300049572 Bacteria 6930
243 Ga0501036_0064496 3300049572 Bacteria 3100
244 Ga0501036_0397655 3300049572 Bacteria 1149
245 Ga0501037_0043493 3300049573 Bacteria 3300
246 Ga0501037_0077950 3300049573 Bacteria 2404
247 Ga0501037_0263242 3300049573 Bacteria 1204
248 Ga0501038_0119206 3300049574 Bacteria 2178
249 Ga0501038_0132100 3300049574 Bacteria 2048
250 Ga0501039_0087538 3300049575 Bacteria 2426
251 Ga0501040_0015906 3300049576 Bacteria 4973
252 Ga0501042_0293542 3300049578 Bacteria 1174
253 Ga0501043_0004845 3300049579 Bacteria 10883
254 Ga0501043_0070354 3300049579 Bacteria 2748
255 Ga0501043_0082034 3300049579 Bacteria 2534
256 Ga0501043_0089494 3300049579 Bacteria 2419
257 Ga0501046_0039449 3300049580 Bacteria 3781
258 Ga0501046_0078035 3300049580 Bacteria 2563
259 Ga0501046_0375017 3300049580 Bacteria 1030
260 Ga0501047_0000617 3300049581 Bacteria 37540
261 Ga0501047_0001842 3300049581 Bacteria 20460
262 Ga0501047_0230149 3300049581 Bacteria 1707
263 Ga0501047_0377346 3300049581 Bacteria 1252
264 Ga0501048_0006656 3300049582 Bacteria 8783
265 Ga0501048_0321224 3300049582 Bacteria 1103
266 Ga0501067_0043070 3300049583 Bacteria 2507
267 Ga0501068_0021581 3300049584 Bacteria 3761
268 Ga0501068_0229821 3300049584 Bacteria 1179
269 Ga0501068_0253643 3300049584 Bacteria 1121
270 Ga0501069_0208120 3300049585 Bacteria 1135
271 Ga0501070_0000157 3300049586 Bacteria 62720
272 Ga0501070_0021312 3300049586 Bacteria 5438
273 Ga0501070_0037092 3300049586 Bacteria 4069
274 Ga0501070_0070114 3300049586 Bacteria 2902
275 Ga0501070_0218889 3300049586 Bacteria 1562
276 Ga0501070_0320205 3300049586 Bacteria 1261
277 Ga0501072_0003045 3300049588 Bacteria 12647
278 Ga0501073_0005976 3300049589 Bacteria 9082
279 Ga0501073_0027684 3300049589 Bacteria 4051
280 Ga0501074_0037556 3300049590 Bacteria 3510
281 Ga0501074_0044169 3300049590 Bacteria 3226
282 Ga0501074_0053905 3300049590 Bacteria 2901
283 Ga0501075_0019820 3300049591 Bacteria 4883
284 Ga0501076_0610877 3300049592 Bacteria 900
285 Ga0501077_0011086 3300049593 Bacteria 5623
286 Ga0501079_0002535 3300049741 Bacteria 13266
287 Ga0501079_0036449 3300049741 Bacteria 3789
288 Ga0501080_0001123 3300049742 Bacteria 22045
289 Ga0501080_0010226 3300049742 Bacteria 8581
290 Ga0501080_0092840 3300049742 Bacteria 2803
291 Ga0501080_0147606 3300049742 Bacteria 2174
292 Ga0501080_0155644 3300049742 Bacteria 2111
293 Ga0501080_0561924 3300049742 Bacteria 1015
294 Ga0501080_0662051 3300049742 Bacteria 923
295 Ga0501081_0228416 3300049743 Bacteria 1355
296 Ga0501083_0004518 3300049744 Bacteria 9833
297 Ga0501083_0037175 3300049744 Bacteria 3317
298 Ga0501035_0001697 3300049822 Bacteria 22250
299 Ga0501035_0086019 3300049822 Bacteria 2770
300 Ga0501035_0098048 3300049822 Bacteria 2573
301 Ga0501035_0242808 3300049822 Bacteria 1531
302 Ga0501035_0408586 3300049822 Bacteria 1128
303 Ga0501035_0452265 3300049822 Bacteria 1062
304 Ga0501044_0001051 3300049823 Bacteria 33192
305 Ga0501044_0003762 3300049823 Bacteria 17051
306 Ga0501044_0046829 3300049823 Bacteria 4476
307 Ga0501044_0135847 3300049823 Bacteria 2450
308 Ga0501044_0295700 3300049823 Bacteria 1549
309 Ga0501045_0004928 3300049824 Bacteria 9245
310 nmdc:mga08y16_31907_c1 3300050511 Bacteria 5539
311 Ga0495619_0045802 3300053085 Bacteria 2874
312 Ga0500644_0066244 3300053088 Bacteria 1288
313 Ga0500556_0004101 3300053104 Bacteria 4179
314 Ga0500562_014069 3300053108 Bacteria 2047
315 Ga0500608_117189 3300053122 Bacteria 1213
316 Ga0500622_0000769 3300053156 Bacteria 27916
317 Ga0500637_0005785 3300053178 Bacteria 6018
318 Ga0501082_0005306 3300060353 Bacteria 11204
319 Ga0501082_0133750 3300060353 Bacteria 2151
320 Ga0501082_0227510 3300060353 Bacteria 1623
321 Ga0501082_0426841 3300060353 Bacteria 1158
322 Ga0466962_0030355 3300061719 Bacteria 2589
323 Ga0530510_0013245 3300061734 Bacteria 5798
324 2512037634 2511231221 Bacteria 6846400
325 2517759823 2517572101 Bacteria 6884336
326 2566996757 2565956761 Bacteria 6601618
327 2738887670 2738541308 Bacteria 7020677
328 2791914153 2791354901 Bacteria 8322202
329 2793062097 2791355196 Bacteria 7323613
330 2838665573 2838661181 Bacteria 7385261
331 2904541476 2904535858 Bacteria 6308016
332 2919688669 2919688452 Bacteria 4595932
333 2920110174 2920107658 Bacteria 10042636
334 2922560148 2922554459 Bacteria 6683962
335 2928114801 2928108538 Bacteria 7360024
336 2928141817 2928135762 Bacteria 7259641
337 3005489023 3005483717 Bacteria 7877331
338 8002749364 8002745576 Bacteria 4840272
339 Ga0373941_0001706
340 Ga0065712_10069040
341 Ga0065715_10094304
342 Ga0070658_10001463
343 Ga0070690_100003395
344 Ga0070670_100133513
345 Ga0070666_10027482
346 Ga0070682_100028657
347 Ga0070660_100010111
348 Ga0070689_100005360
349 Ga0070687_100010136
350 Ga0070661_100006923
351 Ga0070668_100327780
352 Ga0070669_100014008
353 Ga0070675_100047665
354 Ga0070673_100043765
355 Ga0070659_100009208
356 Ga0070659_100453739
357 Ga0070714_100005744
358 Ga0070714_100190797
359 Ga0070714_100206893
360 Ga0070714_100417503
361 Ga0070713_100332586
362 Ga0070705_100005571
363 Ga0070694_100010895
364 Ga0070681_10109032
365 Ga0070681_10113990
366 Ga0070679_100027049
367 Ga0070679_100227090
368 Ga0070684_100038878
369 Ga0068853_100012264
370 Ga0070672_100168619
371 Ga0070686_100004123
372 Ga0070695_100062793
373 Ga0070696_100001773
374 Ga0070693_100072551
375 Ga0070665_100016767
376 Ga0068855_100049816
377 Ga0068855_100098003
378 Ga0070664_100002892
379 Ga0068857_100025137
380 Ga0070702_100000268
381 Ga0068859_100000952
382 Ga0068864_100002936
383 Ga0068861_100034116
384 Ga0068861_100450977
385 Ga0068870_10119038
386 Ga0068863_100012993
387 Ga0068863_100050158
388 Ga0068858_100075593
389 Ga0068860_100000433
390 Ga0068860_100009792
391 Ga0068862_100003350
392 Ga0081539_10005127
393 Ga0070717_10011454
394 Ga0075365_10218634
395 Ga0070712_100062412
396 Ga0070712_100071288
397 Ga0075366_10223046
398 Ga0068865_100032190
399 Ga0097620_100000952
400 Ga0105240_10000565
401 Ga0105240_10389173
402 Ga0111539_10040972
403 Ga0105245_10367494
404 Ga0105243_10052724
405 Ga0105243_10377406
406 Ga0105241_10177574
407 Ga0105242_10258457
408 Ga0105248_10015017
409 Ga0105248_10194120
410 Ga0105248_10325896
411 Ga0105238_10021071
412 Ga0105238_10197587
413 Ga0105249_10024307
414 Ga0105249_10246653
415 Ga0105239_10196616
416 Ga0157373_10014025
417 Ga0157371_10004904
418 Ga0157370_10006319
419 Ga0157370_10023217
420 Ga0157369_10002349
421 Ga0163162_10062184
422 Ga0163162_10224546
423 Ga0157372_10006819
424 Ga0157372_10509359
425 Ga0157375_10057501
426 Ga0157375_10431913
427 Ga0163163_10006283
428 Ga0157377_10080090
429 Ga0182006_1014042
430 Ga0213872_10003477
431 Ga0209674_100332
432 Ga0209674_100507
433 Ga0209026_1000129
434 Ga0207680_10016894
435 Ga0207647_10000005
436 Ga0207647_10008549
437 Ga0207643_10119706
438 Ga0207705_10000092
439 Ga0207705_10028248
440 Ga0207707_10006254
441 Ga0207707_10195741
442 Ga0207695_10006009
443 Ga0207693_10138936
444 Ga0207693_10466346
445 Ga0207663_10263276
446 Ga0207660_10211099
447 Ga0207662_10013208
448 Ga0207657_10002811
449 Ga0207649_10037635
450 Ga0207652_10018663
451 Ga0207652_10133198
452 Ga0207652_10416832
453 Ga0207681_10011541
454 Ga0207694_10127878
455 Ga0207694_10211973
456 Ga0207650_10261390
457 Ga0207659_10016318
458 Ga0207687_10187451
459 Ga0207664_10000415
460 Ga0207664_10166801
461 Ga0207664_10313229
462 Ga0207644_10168248
463 Ga0207690_10035469
464 Ga0207706_10154595
465 Ga0207706_10368395
466 Ga0207686_10217394
467 Ga0207709_10058975
468 Ga0207670_10003474
469 Ga0207704_10337501
470 Ga0207691_10170621
471 Ga0207711_10023092
472 Ga0207679_10014125
473 Ga0207667_10028014
474 Ga0207651_10024412
475 Ga0207712_10144139
476 Ga0207703_10064202
477 Ga0207639_10008473
478 Ga0207708_10045871
479 Ga0207641_10024903
480 Ga0207641_10074662
481 Ga0207641_10409902
482 Ga0207676_10021640
483 Ga0207674_10012772
484 Ga0207674_10066730
485 Ga0207675_100051923
486 Ga0207675_100109226
487 Ga0207675_100144474
488 Ga0268266_10109654
489 Ga0268264_10000062
490 Ga0268264_10089428
491 Ga0265334_10004005
492 Ga0265334_10027166
493 Ga0307515_10119661
494 Ga0265338_10000697
495 Ga0265338_10012477
496 Ga0265338_10070512
497 Ga0265328_10064147
498 Ga0265320_10000713
499 Ga0265325_10002590
500 Ga0265325_10003363
501 Ga0265325_10012722
502 Ga0265340_10030809
503 Ga0265331_10000419
504 Ga0265327_10000074
505 Ga0265316_10141229
506 Ga0307513_10010168
507 Ga0307513_10229095
508 Ga0307513_10329757
509 Ga0265313_10000292
510 Ga0316575_10044383
511 Ga0265314_10002776
512 Ga0265314_10015460
513 Ga0265342_10010205
514 Ga0307516_10008557
515 Ga0307412_10220434
516 Ga0316583_10002746
517 Ga0316585_10034357
518 Ga0316580_10003426
519 Ga0373931_0053913
520 Ga0316582_0018890
521 Ga0436364_0761783
522 Ga0400483_094321
523 Ga0400483_175798
524 Ga0436365_0097042
525 Ga0436360_1325990
526 Ga0436361_0041735
527 Ga0436361_0090261
528 Ga0466965_0111937
529 Ga0466965_0222695
530 Ga0466966_0000588
531 Ga0466961_0000753
532 Ga0466961_0009959
533 Ga0466963_0061976
534 Ga0466963_0070166
535 Ga0453684_0327695
536 Ga0466971_0056959
537 Ga0466968_0015381
538 Ga0466959_0015031
539 Ga0466959_0020207
540 Ga0451576_0005130
541 Ga0466958_0000561
542 Ga0466967_0103412
543 Ga0466967_0129171
544 Ga0495603_0179504
545 Ga0495638_0000357
546 Ga0495638_0004581
547 Ga0495650_0000134
548 Ga0495664_0080187
549 Ga0495594_0014818
550 Ga0495606_0002555
551 Ga0495628_0054241
552 Ga0495668_0000701
553 Ga0495599_0032111
554 Ga0495646_0022223
555 Ga0495658_0061525
556 Ga0495672_0131044
557 Ga0496108_0041668
558 Ga0496108_0045494
559 Ga0496109_0012381
560 Ga0496111_0069404
561 Ga0496117_0151408
562 Ga0496118_0001532
563 Ga0496123_0015488
564 Ga0496125_0000125
565 Ga0496125_0004167
566 Ga0496125_0032650
567 Ga0496125_0130239
568 Ga0496126_0000624
569 Ga0496126_0030412
570 Ga0496126_0047677
571 Ga0496126_0113568
572 Ga0501032_0072398
573 Ga0501032_0072437
574 Ga0501032_0163712
575 Ga0501033_0096572
576 Ga0501034_0001651
577 Ga0501034_0001824
578 Ga0501034_0005587
579 Ga0501034_0085409
580 Ga0501036_0012931
581 Ga0501036_0064496
582 Ga0501036_0397655
583 Ga0501037_0043493
584 Ga0501037_0077950
585 Ga0501037_0263242
586 Ga0501038_0119206
587 Ga0501038_0132100
588 Ga0501039_0087538
589 Ga0501040_0015906
590 Ga0501042_0293542
591 Ga0501043_0004845
592 Ga0501043_0070354
593 Ga0501043_0082034
594 Ga0501043_0089494
595 Ga0501046_0039449
596 Ga0501046_0078035
597 Ga0501046_0375017
598 Ga0501047_0000617
599 Ga0501047_0001842
600 Ga0501047_0230149
601 Ga0501047_0377346
602 Ga0501048_0006656
603 Ga0501048_0321224
604 Ga0501067_0043070
605 Ga0501068_0021581
606 Ga0501068_0229821
607 Ga0501068_0253643
608 Ga0501069_0208120
609 Ga0501070_0000157
610 Ga0501070_0021312
611 Ga0501070_0037092
612 Ga0501070_0070114
613 Ga0501070_0218889
614 Ga0501070_0320205
615 Ga0501072_0003045
616 Ga0501073_0005976
617 Ga0501073_0027684
618 Ga0501074_0037556
619 Ga0501074_0044169
620 Ga0501074_0053905
621 Ga0501075_0019820
622 Ga0501076_0610877
623 Ga0501077_0011086
624 Ga0501079_0002535
625 Ga0501079_0036449
626 Ga0501080_0001123
627 Ga0501080_0010226
628 Ga0501080_0092840
629 Ga0501080_0147606
630 Ga0501080_0155644
631 Ga0501080_0561924
632 Ga0501080_0662051
633 Ga0501081_0228416
634 Ga0501083_0004518
635 Ga0501083_0037175
636 Ga0501035_0001697
637 Ga0501035_0086019
638 Ga0501035_0098048
639 Ga0501035_0242808
640 Ga0501035_0408586
641 Ga0501035_0452265
642 Ga0501044_0001051
643 Ga0501044_0003762
644 Ga0501044_0046829
645 Ga0501044_0135847
646 Ga0501044_0295700
647 Ga0501045_0004928
648 nmdc:mga08y16_31907_c1
649 Ga0495619_0045802
650 Ga0500644_0066244
651 Ga0500556_0004101
652 Ga0500562_014069
653 Ga0500608_117189
654 Ga0500622_0000769
655 Ga0500637_0005785
656 Ga0501082_0005306
657 Ga0501082_0133750
658 Ga0501082_0227510
659 Ga0501082_0426841
660 Ga0466962_0030355
661 Ga0530510_0013245
662 2512037634
663 2517759823
664 2566996757
665 2738887670
666 2791914153
667 2793062097
668 2838665573
669 2904541476
670 2919688669
671 2920110174
672 2922560148
673 2928114801
674 2928141817
675 3005489023
676 8002749364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01507

PAPS_reduct

Phosphoadenosine phosphosulfate reductase family

63

291

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.9214 1 208
1zun-assembly1.cif.gz_A crystal structure of a gtp-regulated atp sulfurylase heterodimer from pseudomonas syringae 0.8741 1 208
2o8v-assembly1.cif.gz_A paps reductase in a covalent complex with thioredoxin c35a 0.7785 7 207
6vpu-assembly8.cif.gz_H 1.90 angstrom resolution crystal structure phosphoadenosine phosphosulfate reductase (cysh) from vibrio vulnificus 0.7666 7 207
2oq2-assembly1.cif.gz_A crystal structure of yeast paps reductase with pap, a product complex 0.7664 2 206
ID Description Score Start End Superfamily
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.9127 5 208 3.40.50.620
1zunA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8988 5 208 3.40.50.620
af_Q60377_225_441_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7672 7 207 3.40.50.620
af_P17854_2_216_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7547 7 207 3.40.50.620
2goyE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.7508 5 283 3.40.50.620
ID Description Score Start End GO Terms
AF-W1XGT1-F1-model_v4 Sulfate adenylyltransferase subunit 2, nonfunctional 0.988 56 125 GO:0016779
AF-A0A537YYX6-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9744 1 124 GO:0016779
AF-A0A659USR4-F1-model_v4 Sulfate adenylyltransferase small subunit (EC 2.7.7.4) 0.9722 1 124 GO:0004781
AF-A0A6N8UYU1-F1-model_v4 Phosphoadenosine phosphosulfate reductase family protein 0.9717 4 126 GO:0003824
AF-A0A259LPJ9-F1-model_v4 Sulfate adenylyltransferase small subunit 0.9706 1 129 GO:0016779

Map