F413624

General Info

Members Datasets Scaffolds Average Seq Length
338 202 676 223

Family's Representative Sequence

Representative Sequence 3300041511|Ga0451855_0279592|Ga0451855_0279592_969_1757
Length 262
Sequence MKIYDRAGFPNPSRIRIVLAEKGVESQIEFVSVDLIAAEHKQSAFLLKNVSGVVPILELDDGTFLAECTAITEYLDNLDGNPTLTGRTPLEKGLIHMMQKRADNMLIDNIGIFFHHGTPGLGSALEAHKSPEWAHRKEWGLRHRELAIEGLRYFDDVLATRPYVAGGTFSMADITVFAALLFAGAAGIEIPDGCAALKAWHARVSELPSVKNRSGQNLEAEDLRRLGFSCIGSKIGIDFRKADAWIERVRAPFGRLKGRTAL

Samples

Sample ID Description Type Environment
1 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
9 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
10 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
18 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
19 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
20 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
21 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
29 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
30 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
31 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
32 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
34 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
35 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
36 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
37 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
39 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
40 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
42 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
55 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
56 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
57 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
58 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
59 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
60 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
61 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
62 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
63 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
64 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
65 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
66 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
67 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
68 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
69 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
70 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
71 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
72 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
73 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
74 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
75 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
76 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
77 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
78 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
79 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
80 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
81 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
82 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
83 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
84 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
85 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
86 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
87 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
88 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
89 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
90 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
93 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
94 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
95 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
96 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
97 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
100 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
101 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
102 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
105 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
106 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
107 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
108 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
109 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
113 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
114 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
121 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
122 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
123 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
124 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
125 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
126 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
129 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
130 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
131 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
132 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
133 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
134 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
138 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
139 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
140 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
141 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
142 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
143 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
147 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
148 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
149 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
150 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
151 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
152 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
153 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
154 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
155 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
156 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
157 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
158 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
159 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
160 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
161 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
162 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
163 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
164 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
165 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
166 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
167 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
168 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
169 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
170 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
171 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
172 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
173 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
174 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
175 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
176 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
177 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
178 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
179 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
180 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
181 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
182 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
183 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
184 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
185 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
186 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
187 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
188 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
189 2738541293 Rhizobium sp. GV031 Isolate Unclassified
190 2802429634 Rhizobium anhuiense S10 Isolate Nodule
191 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
192 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
193 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
194 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
195 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
196 2821131069 Duganella sp. 1224 Isolate Unclassified
197 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
198 2857558681 Duganella sp. R-74565 Isolate Unclassified
199 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
200 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
201 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
202 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.49
Metatranscriptomes 0
Isolates 6.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.19
Nodule 1.48
Rhizoplane 1.78
Rhizosphere 59.47
Stem 0
Stem Tuber 0
Unclassified 2.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451855_0279592 3300041511 Bacteria 2085
2 JGI25155J39150_1000109 3300002704 Bacteria 43954
3 JGI25156J39149_1000106 3300002705 Bacteria 60506
4 JGI25156J39149_1002595 3300002705 Bacteria 6373
5 JGI25154J39366_1000038 3300002738 Bacteria 155793
6 JGI25154J39366_1000128 3300002738 Bacteria 59551
7 JGI25157J39369_1000676 3300002741 Bacteria 18747
8 JGI25150J39212_1002809 3300002774 Bacteria 4223
9 JGI25151J46595_10043502 3300003187 Bacteria 1606
10 Ga0055539_1000955 3300003752 Bacteria 6391
11 Ga0055532_1000023 3300003758 Bacteria 248212
12 Ga0055535_1004221 3300003761 Bacteria 3602
13 Ga0065165_1002832 3300005262 Bacteria 13534
14 Ga0070658_10140789 3300005327 Bacteria 2015
15 Ga0070673_100205668 3300005364 Bacteria 1697
16 Ga0070663_100103172 3300005455 Bacteria 2131
17 Ga0068857_100013617 3300005577 Bacteria 7086
18 Ga0068856_101052905 3300005614 Unclassified 831
19 Ga0075363_100142055 3300006048 Bacteria 1352
20 Ga0075362_10095870 3300006177 Unclassified 1382
21 Ga0075367_10431914 3300006178 Bacteria 834
22 Ga0075369_10030492 3300006186 Bacteria 2272
23 Ga0075366_10001229 3300006195 Bacteria 12705
24 Ga0075366_10096954 3300006195 Bacteria 1768
25 Ga0075370_10024576 3300006353 Bacteria 3329
26 Ga0105251_10000884 3300009011 Bacteria 26850
27 Ga0105240_10007957 3300009093 Bacteria 15295
28 Ga0105240_10154449 3300009093 Unclassified 2731
29 Ga0105243_10303498 3300009148 Bacteria 1448
30 Ga0105237_10119545 3300009545 Bacteria 2629
31 Ga0105239_10145365 3300010375 Bacteria 2644
32 Ga0163162_10042922 3300013306 Bacteria 4527
33 Ga0163162_10220698 3300013306 Bacteria 2025
34 Ga0163162_10282744 3300013306 Bacteria 1791
35 Ga0182007_10002879 3300015262 Bacteria 8370
36 Ga0163161_10044182 3300017792 Bacteria 3209
37 Ga0163161_10070969 3300017792 Bacteria 2547
38 Ga0163161_10228047 3300017792 Bacteria 1445
39 Ga0209435_100013 3300025206 Bacteria 366789
40 Ga0209435_100131 3300025206 Bacteria 25636
41 Ga0209147_100030 3300025229 Bacteria 366789
42 Ga0209258_100429 3300025242 Bacteria 49055
43 Ga0207425_1003391 3300025245 Bacteria 5115
44 Ga0209646_1000034 3300025246 Bacteria 366789
45 Ga0209646_1000155 3300025246 Bacteria 95204
46 Ga0209026_1000022 3300025250 Bacteria 366789
47 Ga0209026_1001247 3300025250 Bacteria 11646
48 Ga0209677_100060 3300025253 Bacteria 155728
49 Ga0209759_1000018 3300025256 Bacteria 366789
50 Ga0209759_1000375 3300025256 Bacteria 55963
51 Ga0209129_1018704 3300025258 Bacteria 1326
52 Ga0209565_1004917 3300025263 Bacteria 3981
53 Ga0209455_1005934 3300025272 Bacteria 3683
54 Ga0209025_1039763 3300025294 Bacteria 2046
55 Ga0209256_1018872 3300025299 Bacteria 2220
56 Ga0209051_1018612 3300025303 Bacteria 3067
57 Ga0207655_1030989 3300025728 Bacteria 2474
58 Ga0207713_1000705 3300025735 Bacteria 31261
59 Ga0207695_10002671 3300025913 Bacteria 26049
60 Ga0207695_10252121 3300025913 Bacteria 1664
61 Ga0207651_10153714 3300025960 Bacteria 1795
62 Ga0207674_10032960 3300026116 Bacteria 5428
63 Ga0207674_10581832 3300026116 Bacteria 1081
64 Ga0207675_100000041 3300026118 Bacteria 90476
65 Ga0307515_10083127 3300028794 Bacteria 4131
66 Ga0307509_10425165 3300031507 Bacteria 1028
67 Ga0307408_100276554 3300031548 Bacteria 1396
68 Ga0307405_10091030 3300031731 Bacteria 2020
69 Ga0307405_10268722 3300031731 Bacteria 1278
70 Ga0307412_10005928 3300031911 Bacteria 6888
71 Ga0307414_10104166 3300032004 Bacteria 2142
72 Ga0307510_10105668 3300033180 Bacteria 2582
73 Ga0373931_0006607 3300035691 Bacteria 5429
74 Ga0439438_000450 3300041405 Bacteria 18562
75 Ga0439447_015924 3300041407 Bacteria 2075
76 Ga0439466_0009809 3300041411 Bacteria 3567
77 Ga0439465_0009028 3300041413 Bacteria 3142
78 Ga0451789_0620400 3300041443 Bacteria 3429
79 Ga0451798_0315603 3300041458 Bacteria 2012
80 Ga0451800_0782159 3300041459 Bacteria 2160
81 Ga0451802_1222012 3300041460 Bacteria 2857
82 Ga0451807_1172974 3300041486 Bacteria 2708
83 Ga0451833_1351731 3300041491 Bacteria 1618
84 Ga0451835_0281586 3300041492 Bacteria 1953
85 Ga0451837_1739032 3300041494 Bacteria 1469
86 Ga0451839_0436899 3300041496 Bacteria 1341
87 Ga0451841_0511162 3300041498 Bacteria 2036
88 Ga0451845_0127159 3300041501 Bacteria 2588
89 Ga0451847_0529332 3300041503 Bacteria 2367
90 Ga0451849_0316777 3300041505 Bacteria 1239
91 Ga0451851_1003024 3300041507 Bacteria 2268
92 Ga0451843_0146066 3300041509 Bacteria 1474
93 Ga0451853_0222309 3300041512 Bacteria 1431
94 Ga0451853_0647994 3300041512 Bacteria 1215
95 Ga0451853_0911215 3300041512 Bacteria 2472
96 Ga0439432_000556 3300042006 Bacteria 13905
97 Ga0439432_017976 3300042006 Bacteria 2368
98 Ga0439451_000424 3300042009 Bacteria 8247
99 Ga0439452_001012 3300042010 Bacteria 12440
100 Ga0439452_009334 3300042010 Bacteria 2893
101 Ga0450911_003919 3300042115 Bacteria 2520
102 Ga0450905_000011 3300042142 Bacteria 19765
103 Ga0495617_000888 3300046452 Bacteria 14042
104 Ga0495617_024900 3300046452 Bacteria 2018
105 Ga0495617_124665 3300046452 Bacteria 828
106 Ga0495627_113245 3300046453 Bacteria 769
107 Ga0495590_0000004 3300046457 Bacteria 402091
108 Ga0495590_0026469 3300046457 Bacteria 2036
109 Ga0495590_0045119 3300046457 Bacteria 1537
110 Ga0495591_018723 3300046458 Bacteria 2341
111 Ga0495638_0000023 3300046460 Bacteria 363063
112 Ga0495638_0000301 3300046460 Bacteria 63603
113 Ga0495638_0000629 3300046460 Bacteria 38947
114 Ga0495638_0002285 3300046460 Bacteria 15813
115 Ga0495638_0012644 3300046460 Bacteria 5776
116 Ga0495638_0018793 3300046460 Bacteria 4584
117 Ga0495638_0051019 3300046460 Bacteria 2582
118 Ga0495650_0000169 3300046471 Bacteria 145238
119 Ga0495650_0001357 3300046471 Bacteria 24310
120 Ga0495650_0022091 3300046471 Bacteria 3058
121 Ga0495605_0000148 3300046474 Bacteria 90877
122 Ga0495605_0002755 3300046474 Bacteria 10731
123 Ga0495605_0010497 3300046474 Bacteria 5180
124 Ga0495605_0018105 3300046474 Bacteria 3782
125 Ga0495639_0073316 3300046475 Bacteria 1585
126 Ga0495584_0028391 3300046491 Bacteria 2835
127 Ga0495584_0071113 3300046491 Bacteria 1748
128 Ga0495585_0007857 3300046492 Bacteria 6489
129 Ga0495594_0001248 3300046499 Bacteria 13335
130 Ga0495607_0000047 3300046501 Bacteria 121696
131 Ga0495607_0001338 3300046501 Bacteria 21995
132 Ga0495607_0001437 3300046501 Bacteria 21228
133 Ga0495607_0006062 3300046501 Bacteria 8561
134 Ga0495607_0048013 3300046501 Bacteria 2497
135 Ga0495607_0108435 3300046501 Bacteria 1475
136 Ga0495583_0000021 3300046506 Bacteria 287046
137 Ga0495583_0000606 3300046506 Bacteria 48615
138 Ga0495583_0003911 3300046506 Bacteria 11025
139 Ga0495606_0000043 3300046507 Bacteria 214367
140 Ga0495606_0000713 3300046507 Bacteria 51369
141 Ga0495606_0000972 3300046507 Bacteria 41909
142 Ga0495606_0002409 3300046507 Bacteria 21851
143 Ga0495606_0002464 3300046507 Bacteria 21461
144 Ga0495606_0005955 3300046507 Bacteria 11442
145 Ga0495606_0015819 3300046507 Bacteria 5788
146 Ga0495606_0066785 3300046507 Bacteria 2279
147 Ga0495610_0002408 3300046512 Bacteria 15754
148 Ga0495610_0003661 3300046512 Bacteria 11825
149 Ga0495610_0024117 3300046512 Bacteria 3288
150 Ga0495610_0024943 3300046512 Bacteria 3219
151 Ga0495610_0045187 3300046512 Bacteria 2180
152 Ga0495610_0056986 3300046512 Bacteria 1876
153 Ga0495616_0000150 3300046513 Bacteria 60876
154 Ga0495616_0007406 3300046513 Bacteria 6567
155 Ga0495616_0207120 3300046513 Bacteria 859
156 Ga0495620_0005152 3300046515 Bacteria 7317
157 Ga0495628_0035202 3300046516 Bacteria 4025
158 Ga0495631_0000337 3300046518 Bacteria 32281
159 Ga0495632_0005519 3300046519 Bacteria 8344
160 Ga0495632_0035275 3300046519 Bacteria 2554
161 Ga0495637_0004374 3300046520 Bacteria 7328
162 Ga0495637_0078507 3300046520 Bacteria 1319
163 Ga0495637_0142034 3300046520 Bacteria 910
164 Ga0495643_0000134 3300046522 Bacteria 119143
165 Ga0495643_0000182 3300046522 Bacteria 100196
166 Ga0495643_0000496 3300046522 Bacteria 49653
167 Ga0495644_0000347 3300046523 Bacteria 21047
168 Ga0495644_0011918 3300046523 Bacteria 3343
169 Ga0495648_0000084 3300046524 Bacteria 120611
170 Ga0495648_0000326 3300046524 Bacteria 52532
171 Ga0495648_0021064 3300046524 Bacteria 4526
172 Ga0495648_0049194 3300046524 Bacteria 2586
173 Ga0495663_0178262 3300046525 Bacteria 735
174 Ga0495654_0001816 3300046530 Bacteria 14212
175 Ga0495609_0012432 3300046538 Bacteria 4038
176 Ga0495609_0048693 3300046538 Bacteria 1893
177 Ga0495609_0075077 3300046538 Bacteria 1482
178 Ga0495597_0000022 3300046542 Bacteria 150986
179 Ga0495597_0000339 3300046542 Bacteria 41939
180 Ga0495622_0000454 3300046557 Bacteria 26304
181 Ga0495622_0020962 3300046557 Bacteria 3043
182 Ga0495633_0000113 3300046558 Bacteria 109307
183 Ga0495633_0000421 3300046558 Bacteria 44029
184 Ga0495633_0006119 3300046558 Bacteria 7205
185 Ga0495656_0003608 3300046615 Bacteria 5243
186 Ga0495656_0037932 3300046615 Unclassified 1993
187 Ga0495668_0000369 3300046616 Bacteria 59509
188 Ga0495668_0096415 3300046616 Bacteria 1618
189 Ga0495668_0290331 3300046616 Bacteria 896
190 Ga0495611_0002187 3300046648 Bacteria 9108
191 Ga0495611_0009567 3300046648 Bacteria 4094
192 Ga0495625_0004936 3300046660 Bacteria 12404
193 Ga0495625_0008678 3300046660 Bacteria 8634
194 Ga0495625_0069717 3300046660 Bacteria 2469
195 Ga0495625_0181743 3300046660 Bacteria 1398
196 Ga0495625_0298642 3300046660 Bacteria 1031
197 Ga0495659_0000414 3300046664 Bacteria 16287
198 Ga0495661_0001046 3300046665 Bacteria 24531
199 Ga0495661_0093228 3300046665 Bacteria 1709
200 Ga0495661_0135001 3300046665 Bacteria 1348
201 Ga0495588_0125226 3300046674 Bacteria 1355
202 Ga0495624_0117803 3300046690 Bacteria 1632
203 Ga0495670_0003476 3300046691 Bacteria 7737
204 Ga0495670_0006733 3300046691 Bacteria 5653
205 Ga0495671_0000374 3300046692 Bacteria 36687
206 Ga0495671_0008605 3300046692 Bacteria 5731
207 Ga0495671_0012309 3300046692 Bacteria 4676
208 Ga0495649_0121150 3300046694 Bacteria 1383
209 Ga0495649_0134243 3300046694 Bacteria 1305
210 Ga0495649_0150880 3300046694 Bacteria 1221
211 Ga0495589_0000046 3300046794 Bacteria 122544
212 Ga0495660_0000040 3300046810 Bacteria 172614
213 Ga0495660_0011935 3300046810 Bacteria 5039
214 Ga0495660_0068430 3300046810 Bacteria 1889
215 Ga0495636_0000430 3300047318 Bacteria 15568
216 Ga0495672_0000154 3300047320 Bacteria 100095
217 Ga0495672_0003962 3300047320 Bacteria 12393
218 Ga0495672_0010999 3300047320 Bacteria 6411
219 Ga0495672_0059185 3300047320 Bacteria 2217
220 Ga0495672_0133779 3300047320 Bacteria 1302
221 Ga0495683_0000006 3300047323 Bacteria 272409
222 Ga0495683_0000479 3300047323 Bacteria 31100
223 Ga0495683_0001547 3300047323 Bacteria 14899
224 Ga0495683_0007540 3300047323 Bacteria 5871
225 Ga0495683_0010325 3300047323 Bacteria 4940
226 Ga0495687_000100 3300047443 Bacteria 130324
227 Ga0495687_000245 3300047443 Bacteria 73990
228 Ga0495687_002038 3300047443 Bacteria 17054
229 Ga0495677_0000371 3300047445 Bacteria 19395
230 Ga0495677_0002770 3300047445 Bacteria 6835
231 Ga0495677_0088854 3300047445 Bacteria 1163
232 Ga0495679_004903 3300047446 Bacteria 6040
233 Ga0495685_000045 3300047447 Bacteria 50520
234 Ga0495673_0000997 3300047469 Bacteria 25163
235 Ga0495673_0006271 3300047469 Bacteria 7013
236 Ga0495673_0012864 3300047469 Bacteria 4414
237 Ga0495673_0082410 3300047469 Bacteria 1330
238 Ga0495673_0156584 3300047469 Unclassified 877
239 Ga0495681_0001998 3300047470 Bacteria 14903
240 Ga0495686_0000143 3300047472 Bacteria 143037
241 Ga0495686_0002474 3300047472 Bacteria 17399
242 Ga0495686_0004696 3300047472 Bacteria 11081
243 Ga0495626_0000328 3300048091 Bacteria 50162
244 Ga0495626_0023261 3300048091 Bacteria 3054
245 Ga0495626_0033078 3300048091 Bacteria 2479
246 Ga0496117_0125211 3300048920 Bacteria 1570
247 Ga0496118_0001619 3300048921 Bacteria 33260
248 Ga0496121_0000987 3300048924 Bacteria 50954
249 Ga0496121_0085346 3300048924 Unclassified 2486
250 Ga0496121_0105606 3300048924 Bacteria 2161
251 Ga0496121_0414871 3300048924 Bacteria 878
252 Ga0496122_0001360 3300048925 Bacteria 39792
253 Ga0496123_0000262 3300048926 Bacteria 106366
254 Ga0496123_0005973 3300048926 Bacteria 11981
255 Ga0496123_0050585 3300048926 Bacteria 2775
256 Ga0496124_0054122 3300048927 Bacteria 3398
257 Ga0495678_000060 3300049459 Bacteria 142851
258 Ga0495678_000301 3300049459 Bacteria 53830
259 Ga0495678_008053 3300049459 Bacteria 5374
260 Ga0495678_011142 3300049459 Bacteria 4321
261 Ga0495682_0000035 3300049460 Bacteria 126349
262 Ga0495682_0000416 3300049460 Bacteria 30208
263 Ga0495682_0003421 3300049460 Bacteria 7058
264 Ga0501238_000911 3300049671 Bacteria 3373
265 nmdc:mga03683_36921_c1 3300050489 Bacteria 1989
266 nmdc:mga0k408_25746_c1 3300050493 Bacteria 3334
267 nmdc:mga0k408_413832_c1 3300050493 Bacteria 802
268 nmdc:mga0k408_5843_c1 3300050493 Bacteria 6557
269 nmdc:mga0k408_79922_c1 3300050493 Bacteria 1913
270 nmdc:mga07m45_10302_c1 3300050496 Bacteria 4878
271 nmdc:mga0sz30_13469_c2 3300050516 Bacteria 1558
272 nmdc:mga0sz30_55483_c1 3300050516 Bacteria 1686
273 Ga0500610_0212487 3300053079 Bacteria 923
274 Ga0500578_0078290 3300053086 Bacteria 2104
275 Ga0500643_000042 3300053087 Bacteria 158933
276 Ga0500644_0001702 3300053088 Bacteria 5728
277 Ga0500646_0026175 3300053090 Bacteria 1580
278 Ga0500583_0018820 3300053092 Bacteria 2816
279 Ga0500583_0238014 3300053092 Unclassified 900
280 Ga0500651_0012504 3300053093 Bacteria 5148
281 Ga0500651_0036165 3300053093 Bacteria 3112
282 Ga0500651_0073966 3300053093 Bacteria 2117
283 Ga0500651_0078415 3300053093 Bacteria 2048
284 Ga0500566_0109159 3300053094 Bacteria 1506
285 Ga0500650_0171711 3300053098 Bacteria 996
286 Ga0500555_002881 3300053103 Bacteria 4927
287 Ga0500569_003912 3300053109 Bacteria 3089
288 Ga0500569_006588 3300053109 Bacteria 2558
289 Ga0500592_003805 3300053116 Bacteria 2410
290 Ga0500593_000704 3300053117 Bacteria 12741
291 Ga0500594_0007848 3300053118 Bacteria 2421
292 Ga0500594_0091148 3300053118 Bacteria 926
293 Ga0500607_033969 3300053121 Bacteria 2793
294 Ga0500614_006547 3300053123 Bacteria 2447
295 Ga0500618_000087 3300053125 Bacteria 75294
296 Ga0500618_001006 3300053125 Bacteria 14215
297 Ga0500642_0006472 3300053130 Bacteria 3861
298 Ga0500652_000076 3300053131 Bacteria 42942
299 Ga0500655_048755 3300053133 Bacteria 841
300 Ga0500658_0129383 3300053134 Bacteria 1125
301 Ga0500559_0004128 3300053136 Bacteria 6963
302 Ga0500559_0053457 3300053136 Bacteria 1788
303 Ga0500559_0147933 3300053136 Bacteria 1102
304 Ga0500568_0009262 3300053139 Bacteria 4692
305 Ga0500568_0048748 3300053139 Bacteria 1673
306 Ga0500588_0036517 3300053146 Bacteria 1454
307 Ga0500588_0066251 3300053146 Bacteria 1172
308 Ga0500604_0004357 3300053151 Bacteria 3761
309 Ga0500604_0020265 3300053151 Bacteria 1870
310 Ga0500604_0032683 3300053151 Bacteria 1534
311 Ga0500619_032605 3300053154 Bacteria 1598
312 Ga0500622_0000236 3300053156 Bacteria 57393
313 Ga0500622_0039202 3300053156 Bacteria 2470
314 Ga0500627_0015672 3300053158 Bacteria 2937
315 Ga0500636_0007385 3300053177 Bacteria 6356
316 Ga0500601_000355 3300053737 Bacteria 8336
317 2511250408 2511231003 Bacteria 5606035
318 2585147861 2582581279 Bacteria 4980720
319 2585233142 2582581299 Bacteria 6518058
320 2587727633 2585428057 Bacteria 6737412
321 2587733007 2585428058 Bacteria 6853932
322 2588291310 2588253510 Bacteria 6901809
323 2601624116 2600255283 Bacteria 6061572
324 2725949704 2724679232 Bacteria 7646494
325 2738805476 2738541293 Bacteria 7065685
326 2806055798 2802429634 Bacteria 7083200
327 2806061247 2802429635 Bacteria 7650140
328 2819591690 2818991445 Bacteria 4955017
329 2819615826 2818991449 Bacteria 5518009
330 2819687556 2818991461 Bacteria 7026071
331 2821130825 2821123053 Bacteria 7836056
332 2821131685 2821131069 Bacteria 6108407
333 2842113906 2842110456 Bacteria 7656360
334 2857560256 2857558681 Bacteria 6617694
335 2878030501 2878029506 Bacteria 6418441
336 2919047919 2919046199 Bacteria 5567169
337 2933589458 2933586486 Bacteria 7667493
338 8024493110 8024486573 Bacteria 6540512
339 Ga0451855_0279592
340 JGI25155J39150_1000109
341 JGI25156J39149_1000106
342 JGI25156J39149_1002595
343 JGI25154J39366_1000038
344 JGI25154J39366_1000128
345 JGI25157J39369_1000676
346 JGI25150J39212_1002809
347 JGI25151J46595_10043502
348 Ga0055539_1000955
349 Ga0055532_1000023
350 Ga0055535_1004221
351 Ga0065165_1002832
352 Ga0070658_10140789
353 Ga0070673_100205668
354 Ga0070663_100103172
355 Ga0068857_100013617
356 Ga0068856_101052905
357 Ga0075363_100142055
358 Ga0075362_10095870
359 Ga0075367_10431914
360 Ga0075369_10030492
361 Ga0075366_10001229
362 Ga0075366_10096954
363 Ga0075370_10024576
364 Ga0105251_10000884
365 Ga0105240_10007957
366 Ga0105240_10154449
367 Ga0105243_10303498
368 Ga0105237_10119545
369 Ga0105239_10145365
370 Ga0163162_10042922
371 Ga0163162_10220698
372 Ga0163162_10282744
373 Ga0182007_10002879
374 Ga0163161_10044182
375 Ga0163161_10070969
376 Ga0163161_10228047
377 Ga0209435_100013
378 Ga0209435_100131
379 Ga0209147_100030
380 Ga0209258_100429
381 Ga0207425_1003391
382 Ga0209646_1000034
383 Ga0209646_1000155
384 Ga0209026_1000022
385 Ga0209026_1001247
386 Ga0209677_100060
387 Ga0209759_1000018
388 Ga0209759_1000375
389 Ga0209129_1018704
390 Ga0209565_1004917
391 Ga0209455_1005934
392 Ga0209025_1039763
393 Ga0209256_1018872
394 Ga0209051_1018612
395 Ga0207655_1030989
396 Ga0207713_1000705
397 Ga0207695_10002671
398 Ga0207695_10252121
399 Ga0207651_10153714
400 Ga0207674_10032960
401 Ga0207674_10581832
402 Ga0207675_100000041
403 Ga0307515_10083127
404 Ga0307509_10425165
405 Ga0307408_100276554
406 Ga0307405_10091030
407 Ga0307405_10268722
408 Ga0307412_10005928
409 Ga0307414_10104166
410 Ga0307510_10105668
411 Ga0373931_0006607
412 Ga0439438_000450
413 Ga0439447_015924
414 Ga0439466_0009809
415 Ga0439465_0009028
416 Ga0451789_0620400
417 Ga0451798_0315603
418 Ga0451800_0782159
419 Ga0451802_1222012
420 Ga0451807_1172974
421 Ga0451833_1351731
422 Ga0451835_0281586
423 Ga0451837_1739032
424 Ga0451839_0436899
425 Ga0451841_0511162
426 Ga0451845_0127159
427 Ga0451847_0529332
428 Ga0451849_0316777
429 Ga0451851_1003024
430 Ga0451843_0146066
431 Ga0451853_0222309
432 Ga0451853_0647994
433 Ga0451853_0911215
434 Ga0439432_000556
435 Ga0439432_017976
436 Ga0439451_000424
437 Ga0439452_001012
438 Ga0439452_009334
439 Ga0450911_003919
440 Ga0450905_000011
441 Ga0495617_000888
442 Ga0495617_024900
443 Ga0495617_124665
444 Ga0495627_113245
445 Ga0495590_0000004
446 Ga0495590_0026469
447 Ga0495590_0045119
448 Ga0495591_018723
449 Ga0495638_0000023
450 Ga0495638_0000301
451 Ga0495638_0000629
452 Ga0495638_0002285
453 Ga0495638_0012644
454 Ga0495638_0018793
455 Ga0495638_0051019
456 Ga0495650_0000169
457 Ga0495650_0001357
458 Ga0495650_0022091
459 Ga0495605_0000148
460 Ga0495605_0002755
461 Ga0495605_0010497
462 Ga0495605_0018105
463 Ga0495639_0073316
464 Ga0495584_0028391
465 Ga0495584_0071113
466 Ga0495585_0007857
467 Ga0495594_0001248
468 Ga0495607_0000047
469 Ga0495607_0001338
470 Ga0495607_0001437
471 Ga0495607_0006062
472 Ga0495607_0048013
473 Ga0495607_0108435
474 Ga0495583_0000021
475 Ga0495583_0000606
476 Ga0495583_0003911
477 Ga0495606_0000043
478 Ga0495606_0000713
479 Ga0495606_0000972
480 Ga0495606_0002409
481 Ga0495606_0002464
482 Ga0495606_0005955
483 Ga0495606_0015819
484 Ga0495606_0066785
485 Ga0495610_0002408
486 Ga0495610_0003661
487 Ga0495610_0024117
488 Ga0495610_0024943
489 Ga0495610_0045187
490 Ga0495610_0056986
491 Ga0495616_0000150
492 Ga0495616_0007406
493 Ga0495616_0207120
494 Ga0495620_0005152
495 Ga0495628_0035202
496 Ga0495631_0000337
497 Ga0495632_0005519
498 Ga0495632_0035275
499 Ga0495637_0004374
500 Ga0495637_0078507
501 Ga0495637_0142034
502 Ga0495643_0000134
503 Ga0495643_0000182
504 Ga0495643_0000496
505 Ga0495644_0000347
506 Ga0495644_0011918
507 Ga0495648_0000084
508 Ga0495648_0000326
509 Ga0495648_0021064
510 Ga0495648_0049194
511 Ga0495663_0178262
512 Ga0495654_0001816
513 Ga0495609_0012432
514 Ga0495609_0048693
515 Ga0495609_0075077
516 Ga0495597_0000022
517 Ga0495597_0000339
518 Ga0495622_0000454
519 Ga0495622_0020962
520 Ga0495633_0000113
521 Ga0495633_0000421
522 Ga0495633_0006119
523 Ga0495656_0003608
524 Ga0495656_0037932
525 Ga0495668_0000369
526 Ga0495668_0096415
527 Ga0495668_0290331
528 Ga0495611_0002187
529 Ga0495611_0009567
530 Ga0495625_0004936
531 Ga0495625_0008678
532 Ga0495625_0069717
533 Ga0495625_0181743
534 Ga0495625_0298642
535 Ga0495659_0000414
536 Ga0495661_0001046
537 Ga0495661_0093228
538 Ga0495661_0135001
539 Ga0495588_0125226
540 Ga0495624_0117803
541 Ga0495670_0003476
542 Ga0495670_0006733
543 Ga0495671_0000374
544 Ga0495671_0008605
545 Ga0495671_0012309
546 Ga0495649_0121150
547 Ga0495649_0134243
548 Ga0495649_0150880
549 Ga0495589_0000046
550 Ga0495660_0000040
551 Ga0495660_0011935
552 Ga0495660_0068430
553 Ga0495636_0000430
554 Ga0495672_0000154
555 Ga0495672_0003962
556 Ga0495672_0010999
557 Ga0495672_0059185
558 Ga0495672_0133779
559 Ga0495683_0000006
560 Ga0495683_0000479
561 Ga0495683_0001547
562 Ga0495683_0007540
563 Ga0495683_0010325
564 Ga0495687_000100
565 Ga0495687_000245
566 Ga0495687_002038
567 Ga0495677_0000371
568 Ga0495677_0002770
569 Ga0495677_0088854
570 Ga0495679_004903
571 Ga0495685_000045
572 Ga0495673_0000997
573 Ga0495673_0006271
574 Ga0495673_0012864
575 Ga0495673_0082410
576 Ga0495673_0156584
577 Ga0495681_0001998
578 Ga0495686_0000143
579 Ga0495686_0002474
580 Ga0495686_0004696
581 Ga0495626_0000328
582 Ga0495626_0023261
583 Ga0495626_0033078
584 Ga0496117_0125211
585 Ga0496118_0001619
586 Ga0496121_0000987
587 Ga0496121_0085346
588 Ga0496121_0105606
589 Ga0496121_0414871
590 Ga0496122_0001360
591 Ga0496123_0000262
592 Ga0496123_0005973
593 Ga0496123_0050585
594 Ga0496124_0054122
595 Ga0495678_000060
596 Ga0495678_000301
597 Ga0495678_008053
598 Ga0495678_011142
599 Ga0495682_0000035
600 Ga0495682_0000416
601 Ga0495682_0003421
602 Ga0501238_000911
603 nmdc:mga03683_36921_c1
604 nmdc:mga0k408_25746_c1
605 nmdc:mga0k408_413832_c1
606 nmdc:mga0k408_5843_c1
607 nmdc:mga0k408_79922_c1
608 nmdc:mga07m45_10302_c1
609 nmdc:mga0sz30_13469_c2
610 nmdc:mga0sz30_55483_c1
611 Ga0500610_0212487
612 Ga0500578_0078290
613 Ga0500643_000042
614 Ga0500644_0001702
615 Ga0500646_0026175
616 Ga0500583_0018820
617 Ga0500583_0238014
618 Ga0500651_0012504
619 Ga0500651_0036165
620 Ga0500651_0073966
621 Ga0500651_0078415
622 Ga0500566_0109159
623 Ga0500650_0171711
624 Ga0500555_002881
625 Ga0500569_003912
626 Ga0500569_006588
627 Ga0500592_003805
628 Ga0500593_000704
629 Ga0500594_0007848
630 Ga0500594_0091148
631 Ga0500607_033969
632 Ga0500614_006547
633 Ga0500618_000087
634 Ga0500618_001006
635 Ga0500642_0006472
636 Ga0500652_000076
637 Ga0500655_048755
638 Ga0500658_0129383
639 Ga0500559_0004128
640 Ga0500559_0053457
641 Ga0500559_0147933
642 Ga0500568_0009262
643 Ga0500568_0048748
644 Ga0500588_0036517
645 Ga0500588_0066251
646 Ga0500604_0004357
647 Ga0500604_0020265
648 Ga0500604_0032683
649 Ga0500619_032605
650 Ga0500622_0000236
651 Ga0500622_0039202
652 Ga0500627_0015672
653 Ga0500636_0007385
654 Ga0500601_000355
655 2511250408
656 2585147861
657 2585233142
658 2587727633
659 2587733007
660 2588291310
661 2601624116
662 2725949704
663 2738805476
664 2806055798
665 2806061247
666 2819591690
667 2819615826
668 2819687556
669 2821130825
670 2821131685
671 2842113906
672 2857560256
673 2878030501
674 2919047919
675 2933589458
676 8024493110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

131

203

0.93

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

134

212

0.93

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

123

208

0.91

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

1

77

0.91

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

10

78

0.91

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

4

83

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9857 1 212
3erf-assembly1.cif.gz_A crystal structure of gtt2 from saccharomyces cerevisiae 0.9717 1 212
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9678 1 210
4n0v-assembly1.cif.gz_B crystal structure of a glutathione s-transferase domain-containing protein (marinobacter aquaeolei vt8), target efi-507332 0.9586 1 210
7miq-assembly1.cif.gz_B crystal structure of a glutathione s-transferase class gtt2 of vibrio parahaemolyticus (vpgstt2) 0.8887 1 217
ID Description Score Start End Superfamily
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9759 84 207 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9746 84 207 1.20.1050.10
3erfA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9678 84 207 1.20.1050.10
4n0vB02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9665 84 207 1.20.1050.10
af_Q9SRY6_37_122_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9433 2 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A353R401-F1-model_v4 Glutathione S-transferase 0.9935 1 106 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A353PCR2-F1-model_v4 Glutathione S-transferase 0.9926 1 97 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A7X2MU45-F1-model_v4 Glutathione S-transferase 0.9903 2 83 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A849E844-F1-model_v4 Glutathione S-transferase 0.9898 1 125 GO:0005737
GO:0016740
AF-A0A7Z0I9C3-F1-model_v4 deleted 0.987 1 212

Map