F413658

General Info

Members Datasets Scaffolds Average Seq Length
338 169 676 261

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0000028|Ga0495643_0000028_176954_177784
Length 276
Sequence MTTNQLKDNKMVQATAGEKKPMVYATYPSLAEKRVLITGGGTGIGAAIVDAFVKQGAQVFFIDIVAEASRELAESLSGAKYPPKYFHCDLTDLDALAKVFAQIESDHGAVEILINNAANDHRHNVQDVTPKYWDDSLAVNLRHQFFCAQAVAPGMKKAGGGVILNFGSISWHLALGNLTLYVTAKAAIEGMTRGLARDLGVDGIRVNCVIPGSVRTPRQMALWHTPEGEQEILNAQCLHERVEPEDIAAMALFLSSDNAGRCSGRDYFVDAGWYGA

Samples

Sample ID Description Type Environment
1 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
12 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
15 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
28 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
29 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
33 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
34 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
35 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
39 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
40 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
41 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
42 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
43 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
45 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
46 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
48 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
55 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
56 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
57 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
58 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
61 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
62 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
68 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
69 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
70 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
71 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
74 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
75 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
76 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
77 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
78 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
79 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
80 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
81 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
82 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
83 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
84 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
85 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
86 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
87 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
92 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
93 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
94 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
95 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
96 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
97 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
98 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
99 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
100 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
101 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
102 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
103 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
104 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
105 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
106 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
107 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
108 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
109 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
110 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
111 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
112 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
113 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
114 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
115 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
116 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
117 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
118 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
119 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
120 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
121 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
122 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
123 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
138 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
139 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
140 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
141 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
144 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
145 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
151 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
152 2643221638 Duganella sp. Root336D2 Isolate Unclassified
153 2643221645 Massilia sp. Root351 Isolate Unclassified
154 2643221664 Massilia sp. Root418 Isolate Unclassified
155 2738541280 Massilia sp. GV090 Isolate Unclassified
156 2738541297 Duganella sp. GV083 Isolate Unclassified
157 2738541300 Massilia sp. GV016 Isolate Unclassified
158 2738541357 Duganella sp. GV053 Isolate Unclassified
159 2738543003 Duganella sp. GV066 Isolate Unclassified
160 2738543018 Massilia sp. GV045 Isolate Unclassified
161 2738543026 Duganella sp. GV089 Isolate Unclassified
162 2738543029 Duganella sp. GV039 Isolate Unclassified
163 2738543030 Massilia sp. GV097 Isolate Unclassified
164 2821131069 Duganella sp. 1224 Isolate Unclassified
165 2842711865 Duganella sp. R-73148 Isolate Unclassified
166 2857558681 Duganella sp. R-74565 Isolate Unclassified
167 2857564685 Duganella sp. R-74599 Isolate Unclassified
168 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
169 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.38
Metatranscriptomes 0
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.6
Nodule 0.59
Rhizoplane 1.18
Rhizosphere 67.16
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495643_0000028 3300046522 Bacteria 262886
2 JGI25158J39367_1000221 3300002739 Bacteria 13394
3 JGI25152J39213_1000002 3300002773 Bacteria 219237
4 JGI25150J39212_1000036 3300002774 Bacteria 89785
5 JGI25150J39212_1002130 3300002774 Bacteria 5118
6 JGI25150J39212_1007043 3300002774 Bacteria 2283
7 JGI25159J45721_1003138 3300002987 Bacteria 5950
8 JGI25159J45721_1010551 3300002987 Bacteria 2343
9 JGI25153J46596_10004757 3300003215 Bacteria 7234
10 rootL2_10213091 3300003322 Bacteria 1208
11 rootL2_10281957 3300003322 Bacteria 1353
12 JGI25160J50197_1016812 3300003354 Bacteria 2343
13 JGI25161J50226_1000162 3300003374 Bacteria 46749
14 JGI25161J50226_1002735 3300003374 Bacteria 4358
15 Ga0055529_1000341 3300003763 Bacteria 52197
16 Ga0055526_1000029 3300003771 Bacteria 148855
17 Ga0055526_1000163 3300003771 Bacteria 58968
18 Ga0055526_1000269 3300003771 Bacteria 43927
19 Ga0055526_1000925 3300003771 Bacteria 21792
20 Ga0055537_1000808 3300003773 Bacteria 15514
21 Ga0055524_1000025 3300003775 Bacteria 216427
22 Ga0055524_1000105 3300003775 Bacteria 104121
23 Ga0055524_1002322 3300003775 Bacteria 9895
24 Ga0055524_1003197 3300003775 Bacteria 8039
25 Ga0055524_1004127 3300003775 Bacteria 6808
26 Ga0055534_1000111 3300003784 Bacteria 60131
27 Ga0055534_1002886 3300003784 Bacteria 5707
28 Ga0055528_1000101 3300003790 Bacteria 68157
29 Ga0055528_1013191 3300003790 Bacteria 3151
30 Ga0055530_10000057 3300003791 Bacteria 100782
31 Ga0055543_1000927 3300004625 Bacteria 13651
32 Ga0065165_1000255 3300005262 Bacteria 92321
33 Ga0065165_1000351 3300005262 Bacteria 75383
34 Ga0070661_100264882 3300005344 Unclassified 1329
35 Ga0070711_100002406 3300005439 Bacteria 10676
36 Ga0070681_10570191 3300005458 Bacteria 1046
37 Ga0070706_100000594 3300005467 Bacteria 41898
38 Ga0070707_100645694 3300005468 Bacteria 1021
39 Ga0070679_100013651 3300005530 Bacteria 7782
40 Ga0070697_100000587 3300005536 Bacteria 27485
41 Ga0068856_100038000 3300005614 Bacteria 4725
42 Ga0099826_10000005 3300006948 Bacteria 465206
43 Ga0105244_10006947 3300009036 Bacteria 7252
44 Ga0105244_10008663 3300009036 Bacteria 6332
45 Ga0105239_10306639 3300010375 Bacteria 1789
46 Ga0157369_10330724 3300013105 Bacteria 1583
47 Ga0157372_10068904 3300013307 Bacteria 3978
48 Ga0209436_100005 3300025208 Bacteria 151087
49 Ga0209436_100511 3300025208 Bacteria 16991
50 Ga0207425_1000001 3300025245 Bacteria 2525432
51 Ga0207425_1000211 3300025245 Bacteria 46314
52 Ga0207425_1000548 3300025245 Bacteria 22415
53 Ga0209129_1000001 3300025258 Bacteria 1452436
54 Ga0209129_1002631 3300025258 Bacteria 8538
55 Ga0209565_1000158 3300025263 Bacteria 90487
56 Ga0209565_1001242 3300025263 Bacteria 11957
57 Ga0209565_1002669 3300025263 Bacteria 6258
58 Ga0209455_1000037 3300025272 Bacteria 464097
59 Ga0209673_1000290 3300025273 Bacteria 93927
60 Ga0209673_1012726 3300025273 Bacteria 3369
61 Ga0209130_1000055 3300025284 Bacteria 211696
62 Ga0209130_1000239 3300025284 Bacteria 70591
63 Ga0209130_1003002 3300025284 Bacteria 7635
64 Ga0209675_1000152 3300025291 Bacteria 90579
65 Ga0209675_1000634 3300025291 Bacteria 24993
66 Ga0209675_1004781 3300025291 Bacteria 5887
67 Ga0209025_1002908 3300025294 Bacteria 17096
68 Ga0209564_1000009 3300025295 Bacteria 950196
69 Ga0209564_1000124 3300025295 Bacteria 202046
70 Ga0209564_1000339 3300025295 Bacteria 89599
71 Ga0209564_1006477 3300025295 Bacteria 6301
72 Ga0209758_1000020 3300025297 Bacteria 734220
73 Ga0209758_1001186 3300025297 Bacteria 32950
74 Ga0209050_1000292 3300025298 Bacteria 106140
75 Ga0209050_1000304 3300025298 Bacteria 100918
76 Ga0209050_1002275 3300025298 Bacteria 16997
77 Ga0209050_1025774 3300025298 Bacteria 1989
78 Ga0209256_1000028 3300025299 Bacteria 420213
79 Ga0209256_1000040 3300025299 Bacteria 366839
80 Ga0209256_1000278 3300025299 Bacteria 89714
81 Ga0209256_1000778 3300025299 Bacteria 41213
82 Ga0209256_1002789 3300025299 Bacteria 13388
83 Ga0209256_1006822 3300025299 Bacteria 5887
84 Ga0207426_1001705 3300025302 Bacteria 16886
85 Ga0209051_1014172 3300025303 Bacteria 3736
86 Ga0209257_1000295 3300025304 Bacteria 109542
87 Ga0207655_1033356 3300025728 Bacteria 2335
88 Ga0207655_1036466 3300025728 Bacteria 2179
89 Ga0207684_10089747 3300025910 Bacteria 2618
90 Ga0207707_10015875 3300025912 Bacteria 6568
91 Ga0207660_10091576 3300025917 Bacteria 2255
92 Ga0207652_10022023 3300025921 Bacteria 5267
93 Ga0207664_10068153 3300025929 Bacteria 2857
94 Ga0209282_1000003 3300027666 Bacteria 856377
95 Ga0265336_10072332 3300028666 Bacteria 1031
96 Ga0265338_10018483 3300028800 Bacteria 7461
97 Ga0316177_1218963 3300030731 Bacteria 1830
98 Ga0316180_1183752 3300030736 Bacteria 3207
99 Ga0265330_10019312 3300031235 Bacteria 3125
100 Ga0265330_10025061 3300031235 Bacteria 2705
101 Ga0265332_10016754 3300031238 Bacteria 3234
102 Ga0265325_10018129 3300031241 Bacteria 3904
103 Ga0265325_10095369 3300031241 Bacteria 1462
104 Ga0265316_10150269 3300031344 Bacteria 1745
105 Ga0307408_100000022 3300031548 Bacteria 310242
106 Ga0307408_100004450 3300031548 Bacteria 9515
107 Ga0307408_100098615 3300031548 Bacteria 2221
108 Ga0265313_10055322 3300031595 Bacteria 1880
109 Ga0265314_10027494 3300031711 Bacteria 4259
110 Ga0265314_10054792 3300031711 Bacteria 2757
111 Ga0265314_10103409 3300031711 Bacteria 1826
112 Ga0265342_10296401 3300031712 Bacteria 853
113 Ga0307518_10227094 3300031838 Bacteria 1212
114 Ga0395898_0352706 3300037466 Bacteria 1403
115 Ga0466965_0188064 3300044683 Bacteria 1091
116 Ga0466968_0019325 3300044735 Bacteria 2743
117 Ga0495617_000003 3300046452 Bacteria 541914
118 Ga0495617_000670 3300046452 Bacteria 17120
119 Ga0495617_006165 3300046452 Bacteria 4218
120 Ga0495617_017742 3300046452 Bacteria 2405
121 Ga0495590_0000014 3300046457 Bacteria 258314
122 Ga0495590_0006711 3300046457 Bacteria 4480
123 Ga0495590_0100902 3300046457 Bacteria 1025
124 Ga0495638_0000133 3300046460 Bacteria 119393
125 Ga0495638_0012591 3300046460 Bacteria 5789
126 Ga0495638_0342784 3300046460 Bacteria 791
127 Ga0495653_0000002 3300046463 Bacteria 507262
128 Ga0495650_0000019 3300046471 Bacteria 533849
129 Ga0495650_0000072 3300046471 Bacteria 257886
130 Ga0495650_0000267 3300046471 Bacteria 100234
131 Ga0495650_0000307 3300046471 Bacteria 88863
132 Ga0495650_0001047 3300046471 Bacteria 30813
133 Ga0495650_0007926 3300046471 Bacteria 6295
134 Ga0495650_0020578 3300046471 Bacteria 3213
135 Ga0495580_0014419 3300046472 Bacteria 5994
136 Ga0495580_0263063 3300046472 Bacteria 1180
137 Ga0495605_0000068 3300046474 Bacteria 137743
138 Ga0495605_0001469 3300046474 Bacteria 15394
139 Ga0495639_0004035 3300046475 Bacteria 6289
140 Ga0495584_0009203 3300046491 Bacteria 5094
141 Ga0495584_0029272 3300046491 Bacteria 2791
142 Ga0495584_0039443 3300046491 Bacteria 2385
143 Ga0495585_0000075 3300046492 Bacteria 102563
144 Ga0495585_0002761 3300046492 Bacteria 12243
145 Ga0495585_0013058 3300046492 Bacteria 4871
146 Ga0495585_0013059 3300046492 Bacteria 4871
147 Ga0495585_0082911 3300046492 Bacteria 1735
148 Ga0495596_0015524 3300046500 Bacteria 3186
149 Ga0495607_0000360 3300046501 Bacteria 47044
150 Ga0495607_0047725 3300046501 Bacteria 2507
151 Ga0495607_0051831 3300046501 Bacteria 2380
152 Ga0495607_0076086 3300046501 Bacteria 1858
153 Ga0495583_0000044 3300046506 Bacteria 226264
154 Ga0495583_0000330 3300046506 Bacteria 74846
155 Ga0495583_0061694 3300046506 Bacteria 1671
156 Ga0495606_0000001 3300046507 Bacteria 592123
157 Ga0495606_0000030 3300046507 Bacteria 249484
158 Ga0495606_0000337 3300046507 Bacteria 80941
159 Ga0495606_0000476 3300046507 Bacteria 65896
160 Ga0495606_0000545 3300046507 Bacteria 60465
161 Ga0495606_0000969 3300046507 Bacteria 42004
162 Ga0495606_0002860 3300046507 Bacteria 19101
163 Ga0495606_0003166 3300046507 Bacteria 17805
164 Ga0495606_0045965 3300046507 Bacteria 2888
165 Ga0495610_0000003 3300046512 Bacteria 1203910
166 Ga0495610_0000449 3300046512 Bacteria 42537
167 Ga0495610_0010578 3300046512 Bacteria 5720
168 Ga0495616_0000602 3300046513 Bacteria 27144
169 Ga0495616_0005982 3300046513 Bacteria 7422
170 Ga0495616_0006992 3300046513 Bacteria 6793
171 Ga0495637_0000937 3300046520 Bacteria 18653
172 Ga0495637_0009319 3300046520 Bacteria 4792
173 Ga0495643_0000139 3300046522 Bacteria 117261
174 Ga0495643_0016507 3300046522 Bacteria 4337
175 Ga0495643_0104779 3300046522 Bacteria 1445
176 Ga0495648_0000006 3300046524 Bacteria 361208
177 Ga0495648_0000599 3300046524 Bacteria 38548
178 Ga0495648_0002607 3300046524 Bacteria 16486
179 Ga0495648_0060433 3300046524 Bacteria 2254
180 Ga0495663_0086089 3300046525 Bacteria 1018
181 Ga0495642_0001570 3300046528 Bacteria 10031
182 Ga0495642_0125872 3300046528 Bacteria 1101
183 Ga0495654_0000037 3300046530 Bacteria 188218
184 Ga0495654_0007595 3300046530 Bacteria 6042
185 Ga0495609_0000152 3300046538 Bacteria 71861
186 Ga0495609_0006201 3300046538 Bacteria 6147
187 Ga0495609_0031957 3300046538 Bacteria 2392
188 Ga0495609_0034650 3300046538 Bacteria 2287
189 Ga0495609_0054875 3300046538 Bacteria 1768
190 Ga0495609_0085180 3300046538 Bacteria 1378
191 Ga0495597_0000072 3300046542 Bacteria 87914
192 Ga0495597_0000120 3300046542 Bacteria 70808
193 Ga0495597_0068119 3300046542 Bacteria 1538
194 Ga0495622_0000001 3300046557 Bacteria 365248
195 Ga0495622_0000007 3300046557 Bacteria 239352
196 Ga0495622_0000136 3300046557 Bacteria 62960
197 Ga0495622_0068664 3300046557 Bacteria 1637
198 Ga0495633_0000055 3300046558 Bacteria 151013
199 Ga0495633_0000509 3300046558 Bacteria 39153
200 Ga0495633_0002901 3300046558 Bacteria 11755
201 Ga0495633_0005401 3300046558 Bacteria 7828
202 Ga0495633_0007794 3300046558 Bacteria 6118
203 Ga0495633_0115547 3300046558 Bacteria 1243
204 Ga0495656_0024798 3300046615 Bacteria 2372
205 Ga0495656_0039070 3300046615 Bacteria 1969
206 Ga0495656_0131900 3300046615 Bacteria 1190
207 Ga0495668_0000018 3300046616 Bacteria 417480
208 Ga0495668_0000452 3300046616 Bacteria 52507
209 Ga0495668_0000527 3300046616 Bacteria 47676
210 Ga0495668_0002400 3300046616 Bacteria 15521
211 Ga0495668_0259923 3300046616 Bacteria 950
212 Ga0495611_0001905 3300046648 Bacteria 9927
213 Ga0495611_0001917 3300046648 Bacteria 9885
214 Ga0495625_0000220 3300046660 Bacteria 90406
215 Ga0495625_0000697 3300046660 Bacteria 47751
216 Ga0495625_0017335 3300046660 Bacteria 5641
217 Ga0495625_0018308 3300046660 Bacteria 5471
218 Ga0495625_0022198 3300046660 Bacteria 4870
219 Ga0495625_0027985 3300046660 Bacteria 4232
220 Ga0495625_0043367 3300046660 Bacteria 3262
221 Ga0495625_0123403 3300046660 Bacteria 1760
222 Ga0495625_0174649 3300046660 Bacteria 1432
223 Ga0495659_0000004 3300046664 Bacteria 143914
224 Ga0495659_0003108 3300046664 Bacteria 5331
225 Ga0495659_0036608 3300046664 Bacteria 1734
226 Ga0495661_0011874 3300046665 Bacteria 5900
227 Ga0495661_0015607 3300046665 Bacteria 5066
228 Ga0495661_0020743 3300046665 Bacteria 4287
229 Ga0495661_0039461 3300046665 Bacteria 2934
230 Ga0495669_0001916 3300046684 Bacteria 8538
231 Ga0495670_0000089 3300046691 Bacteria 40658
232 Ga0495670_0013855 3300046691 Bacteria 3965
233 Ga0495670_0058732 3300046691 Bacteria 1931
234 Ga0495670_0071863 3300046691 Bacteria 1752
235 Ga0495671_0000010 3300046692 Bacteria 368641
236 Ga0495671_0000548 3300046692 Bacteria 28176
237 Ga0495671_0012948 3300046692 Bacteria 4538
238 Ga0495671_0033759 3300046692 Bacteria 2605
239 Ga0495671_0045622 3300046692 Bacteria 2193
240 Ga0495649_0026644 3300046694 Bacteria 3212
241 Ga0495649_0038768 3300046694 Bacteria 2613
242 Ga0495649_0058798 3300046694 Bacteria 2071
243 Ga0495649_0107827 3300046694 Bacteria 1478
244 Ga0495649_0108484 3300046694 Bacteria 1473
245 Ga0495589_0176044 3300046794 Bacteria 1016
246 Ga0495660_0009351 3300046810 Bacteria 5715
247 Ga0495660_0010810 3300046810 Bacteria 5300
248 Ga0495660_0019818 3300046810 Bacteria 3860
249 Ga0495636_0015813 3300047318 Bacteria 3008
250 Ga0495636_0017436 3300047318 Bacteria 2875
251 Ga0495636_0020111 3300047318 Bacteria 2688
252 Ga0495672_0000045 3300047320 Bacteria 255145
253 Ga0495672_0000212 3300047320 Bacteria 83026
254 Ga0495683_0000007 3300047323 Bacteria 268546
255 Ga0495683_0004946 3300047323 Bacteria 7457
256 Ga0495683_0038419 3300047323 Bacteria 2424
257 Ga0495683_0124129 3300047323 Bacteria 1223
258 Ga0495687_000498 3300047443 Bacteria 47324
259 Ga0495687_005886 3300047443 Bacteria 7671
260 Ga0495677_0001026 3300047445 Bacteria 11223
261 Ga0495677_0002406 3300047445 Bacteria 7349
262 Ga0495677_0034203 3300047445 Bacteria 1853
263 Ga0495679_009372 3300047446 Bacteria 3922
264 Ga0495679_013900 3300047446 Bacteria 3002
265 Ga0495685_000010 3300047447 Bacteria 84950
266 Ga0495685_039205 3300047447 Bacteria 1621
267 Ga0495673_0000003 3300047469 Bacteria 1491337
268 Ga0495673_0000016 3300047469 Bacteria 580643
269 Ga0495673_0000035 3300047469 Bacteria 316861
270 Ga0495673_0023608 3300047469 Bacteria 2988
271 Ga0495673_0139069 3300047469 Bacteria 948
272 Ga0495681_0002985 3300047470 Bacteria 11913
273 Ga0495686_0001368 3300047472 Bacteria 27185
274 Ga0495686_0001845 3300047472 Bacteria 21268
275 Ga0495686_0004957 3300047472 Bacteria 10710
276 Ga0495686_0008784 3300047472 Bacteria 7363
277 Ga0495686_0030938 3300047472 Bacteria 3474
278 Ga0495615_0000679 3300048090 Bacteria 4740
279 Ga0496103_0003582 3300048906 Bacteria 9475
280 Ga0496104_0000039 3300048907 Bacteria 177103
281 Ga0496104_0141829 3300048907 Bacteria 2308
282 Ga0496114_0061759 3300048917 Bacteria 3135
283 Ga0496116_0044582 3300048919 Bacteria 3011
284 Ga0496116_0183401 3300048919 Bacteria 1117
285 Ga0496120_0019690 3300048923 Bacteria 4310
286 Ga0496121_0013459 3300048924 Bacteria 8784
287 Ga0496121_0356321 3300048924 Bacteria 973
288 Ga0496122_0027295 3300048925 Bacteria 4886
289 Ga0496122_0203654 3300048925 Bacteria 1154
290 Ga0496123_0001782 3300048926 Bacteria 28366
291 Ga0496124_0110751 3300048927 Bacteria 2210
292 Ga0496124_0135066 3300048927 Bacteria 1954
293 Ga0496126_0000014 3300048929 Bacteria 686881
294 Ga0496126_0047830 3300048929 Bacteria 3914
295 Ga0495678_000029 3300049459 Bacteria 219803
296 Ga0495678_000525 3300049459 Bacteria 37357
297 Ga0495682_0000220 3300049460 Bacteria 44695
298 Ga0495682_0000524 3300049460 Bacteria 26395
299 Ga0501032_0009633 3300049569 Bacteria 6999
300 Ga0501033_0005534 3300049570 Bacteria 9991
301 Ga0501036_0033161 3300049572 Bacteria 4367
302 Ga0501037_0001771 3300049573 Bacteria 15679
303 Ga0501038_0000845 3300049574 Bacteria 27143
304 Ga0501046_0000290 3300049580 Bacteria 51062
305 Ga0501073_0020604 3300049589 Bacteria 4755
306 Ga0501074_0228163 3300049590 Bacteria 1326
307 Ga0501207_002944 3300049654 Bacteria 2227
308 Ga0501227_009514 3300049665 Bacteria 2096
309 Ga0501238_000498 3300049671 Bacteria 4489
310 Ga0501249_006282 3300049679 Bacteria 2444
311 Ga0501080_0099817 3300049742 Bacteria 2694
312 Ga0501269_000216 3300049766 Bacteria 17019
313 Ga0501279_023914 3300049775 Bacteria 882
314 Ga0501035_0014780 3300049822 Bacteria 7207
315 Ga0501044_0424368 3300049823 Bacteria 1239
316 Ga0500594_0019523 3300053118 Bacteria 1681
317 Ga0500618_000297 3300053125 Bacteria 37721
318 Ga0500586_004510 3300053145 Bacteria 3421
319 Ga0500586_007945 3300053145 Bacteria 2863
320 2643791662 2643221554 Bacteria 6603920
321 2644211294 2643221638 Bacteria 6579467
322 2644251407 2643221645 Bacteria 7207331
323 2644356452 2643221664 Bacteria 7272945
324 2738738909 2738541280 Bacteria 6630198
325 2738829820 2738541297 Bacteria 6549566
326 2738844810 2738541300 Bacteria 6675882
327 2739153616 2738541357 Bacteria 6549408
328 2739195536 2738543003 Bacteria 6549560
329 2739276335 2738543018 Bacteria 6718814
330 2739322012 2738543026 Bacteria 6549408
331 2739340253 2738543029 Bacteria 6549249
332 2739345141 2738543030 Bacteria 6719714
333 2821131778 2821131069 Bacteria 6108407
334 2842715442 2842711865 Bacteria 7155354
335 2857559199 2857558681 Bacteria 6617694
336 2857567003 2857564685 Bacteria 6290584
337 2884216966 2884215851 Bacteria 4554841
338 2904425044 2904424332 Bacteria 7633521
339 Ga0495643_0000028
340 JGI25158J39367_1000221
341 JGI25152J39213_1000002
342 JGI25150J39212_1000036
343 JGI25150J39212_1002130
344 JGI25150J39212_1007043
345 JGI25159J45721_1003138
346 JGI25159J45721_1010551
347 JGI25153J46596_10004757
348 rootL2_10213091
349 rootL2_10281957
350 JGI25160J50197_1016812
351 JGI25161J50226_1000162
352 JGI25161J50226_1002735
353 Ga0055529_1000341
354 Ga0055526_1000029
355 Ga0055526_1000163
356 Ga0055526_1000269
357 Ga0055526_1000925
358 Ga0055537_1000808
359 Ga0055524_1000025
360 Ga0055524_1000105
361 Ga0055524_1002322
362 Ga0055524_1003197
363 Ga0055524_1004127
364 Ga0055534_1000111
365 Ga0055534_1002886
366 Ga0055528_1000101
367 Ga0055528_1013191
368 Ga0055530_10000057
369 Ga0055543_1000927
370 Ga0065165_1000255
371 Ga0065165_1000351
372 Ga0070661_100264882
373 Ga0070711_100002406
374 Ga0070681_10570191
375 Ga0070706_100000594
376 Ga0070707_100645694
377 Ga0070679_100013651
378 Ga0070697_100000587
379 Ga0068856_100038000
380 Ga0099826_10000005
381 Ga0105244_10006947
382 Ga0105244_10008663
383 Ga0105239_10306639
384 Ga0157369_10330724
385 Ga0157372_10068904
386 Ga0209436_100005
387 Ga0209436_100511
388 Ga0207425_1000001
389 Ga0207425_1000211
390 Ga0207425_1000548
391 Ga0209129_1000001
392 Ga0209129_1002631
393 Ga0209565_1000158
394 Ga0209565_1001242
395 Ga0209565_1002669
396 Ga0209455_1000037
397 Ga0209673_1000290
398 Ga0209673_1012726
399 Ga0209130_1000055
400 Ga0209130_1000239
401 Ga0209130_1003002
402 Ga0209675_1000152
403 Ga0209675_1000634
404 Ga0209675_1004781
405 Ga0209025_1002908
406 Ga0209564_1000009
407 Ga0209564_1000124
408 Ga0209564_1000339
409 Ga0209564_1006477
410 Ga0209758_1000020
411 Ga0209758_1001186
412 Ga0209050_1000292
413 Ga0209050_1000304
414 Ga0209050_1002275
415 Ga0209050_1025774
416 Ga0209256_1000028
417 Ga0209256_1000040
418 Ga0209256_1000278
419 Ga0209256_1000778
420 Ga0209256_1002789
421 Ga0209256_1006822
422 Ga0207426_1001705
423 Ga0209051_1014172
424 Ga0209257_1000295
425 Ga0207655_1033356
426 Ga0207655_1036466
427 Ga0207684_10089747
428 Ga0207707_10015875
429 Ga0207660_10091576
430 Ga0207652_10022023
431 Ga0207664_10068153
432 Ga0209282_1000003
433 Ga0265336_10072332
434 Ga0265338_10018483
435 Ga0316177_1218963
436 Ga0316180_1183752
437 Ga0265330_10019312
438 Ga0265330_10025061
439 Ga0265332_10016754
440 Ga0265325_10018129
441 Ga0265325_10095369
442 Ga0265316_10150269
443 Ga0307408_100000022
444 Ga0307408_100004450
445 Ga0307408_100098615
446 Ga0265313_10055322
447 Ga0265314_10027494
448 Ga0265314_10054792
449 Ga0265314_10103409
450 Ga0265342_10296401
451 Ga0307518_10227094
452 Ga0395898_0352706
453 Ga0466965_0188064
454 Ga0466968_0019325
455 Ga0495617_000003
456 Ga0495617_000670
457 Ga0495617_006165
458 Ga0495617_017742
459 Ga0495590_0000014
460 Ga0495590_0006711
461 Ga0495590_0100902
462 Ga0495638_0000133
463 Ga0495638_0012591
464 Ga0495638_0342784
465 Ga0495653_0000002
466 Ga0495650_0000019
467 Ga0495650_0000072
468 Ga0495650_0000267
469 Ga0495650_0000307
470 Ga0495650_0001047
471 Ga0495650_0007926
472 Ga0495650_0020578
473 Ga0495580_0014419
474 Ga0495580_0263063
475 Ga0495605_0000068
476 Ga0495605_0001469
477 Ga0495639_0004035
478 Ga0495584_0009203
479 Ga0495584_0029272
480 Ga0495584_0039443
481 Ga0495585_0000075
482 Ga0495585_0002761
483 Ga0495585_0013058
484 Ga0495585_0013059
485 Ga0495585_0082911
486 Ga0495596_0015524
487 Ga0495607_0000360
488 Ga0495607_0047725
489 Ga0495607_0051831
490 Ga0495607_0076086
491 Ga0495583_0000044
492 Ga0495583_0000330
493 Ga0495583_0061694
494 Ga0495606_0000001
495 Ga0495606_0000030
496 Ga0495606_0000337
497 Ga0495606_0000476
498 Ga0495606_0000545
499 Ga0495606_0000969
500 Ga0495606_0002860
501 Ga0495606_0003166
502 Ga0495606_0045965
503 Ga0495610_0000003
504 Ga0495610_0000449
505 Ga0495610_0010578
506 Ga0495616_0000602
507 Ga0495616_0005982
508 Ga0495616_0006992
509 Ga0495637_0000937
510 Ga0495637_0009319
511 Ga0495643_0000139
512 Ga0495643_0016507
513 Ga0495643_0104779
514 Ga0495648_0000006
515 Ga0495648_0000599
516 Ga0495648_0002607
517 Ga0495648_0060433
518 Ga0495663_0086089
519 Ga0495642_0001570
520 Ga0495642_0125872
521 Ga0495654_0000037
522 Ga0495654_0007595
523 Ga0495609_0000152
524 Ga0495609_0006201
525 Ga0495609_0031957
526 Ga0495609_0034650
527 Ga0495609_0054875
528 Ga0495609_0085180
529 Ga0495597_0000072
530 Ga0495597_0000120
531 Ga0495597_0068119
532 Ga0495622_0000001
533 Ga0495622_0000007
534 Ga0495622_0000136
535 Ga0495622_0068664
536 Ga0495633_0000055
537 Ga0495633_0000509
538 Ga0495633_0002901
539 Ga0495633_0005401
540 Ga0495633_0007794
541 Ga0495633_0115547
542 Ga0495656_0024798
543 Ga0495656_0039070
544 Ga0495656_0131900
545 Ga0495668_0000018
546 Ga0495668_0000452
547 Ga0495668_0000527
548 Ga0495668_0002400
549 Ga0495668_0259923
550 Ga0495611_0001905
551 Ga0495611_0001917
552 Ga0495625_0000220
553 Ga0495625_0000697
554 Ga0495625_0017335
555 Ga0495625_0018308
556 Ga0495625_0022198
557 Ga0495625_0027985
558 Ga0495625_0043367
559 Ga0495625_0123403
560 Ga0495625_0174649
561 Ga0495659_0000004
562 Ga0495659_0003108
563 Ga0495659_0036608
564 Ga0495661_0011874
565 Ga0495661_0015607
566 Ga0495661_0020743
567 Ga0495661_0039461
568 Ga0495669_0001916
569 Ga0495670_0000089
570 Ga0495670_0013855
571 Ga0495670_0058732
572 Ga0495670_0071863
573 Ga0495671_0000010
574 Ga0495671_0000548
575 Ga0495671_0012948
576 Ga0495671_0033759
577 Ga0495671_0045622
578 Ga0495649_0026644
579 Ga0495649_0038768
580 Ga0495649_0058798
581 Ga0495649_0107827
582 Ga0495649_0108484
583 Ga0495589_0176044
584 Ga0495660_0009351
585 Ga0495660_0010810
586 Ga0495660_0019818
587 Ga0495636_0015813
588 Ga0495636_0017436
589 Ga0495636_0020111
590 Ga0495672_0000045
591 Ga0495672_0000212
592 Ga0495683_0000007
593 Ga0495683_0004946
594 Ga0495683_0038419
595 Ga0495683_0124129
596 Ga0495687_000498
597 Ga0495687_005886
598 Ga0495677_0001026
599 Ga0495677_0002406
600 Ga0495677_0034203
601 Ga0495679_009372
602 Ga0495679_013900
603 Ga0495685_000010
604 Ga0495685_039205
605 Ga0495673_0000003
606 Ga0495673_0000016
607 Ga0495673_0000035
608 Ga0495673_0023608
609 Ga0495673_0139069
610 Ga0495681_0002985
611 Ga0495686_0001368
612 Ga0495686_0001845
613 Ga0495686_0004957
614 Ga0495686_0008784
615 Ga0495686_0030938
616 Ga0495615_0000679
617 Ga0496103_0003582
618 Ga0496104_0000039
619 Ga0496104_0141829
620 Ga0496114_0061759
621 Ga0496116_0044582
622 Ga0496116_0183401
623 Ga0496120_0019690
624 Ga0496121_0013459
625 Ga0496121_0356321
626 Ga0496122_0027295
627 Ga0496122_0203654
628 Ga0496123_0001782
629 Ga0496124_0110751
630 Ga0496124_0135066
631 Ga0496126_0000014
632 Ga0496126_0047830
633 Ga0495678_000029
634 Ga0495678_000525
635 Ga0495682_0000220
636 Ga0495682_0000524
637 Ga0501032_0009633
638 Ga0501033_0005534
639 Ga0501036_0033161
640 Ga0501037_0001771
641 Ga0501038_0000845
642 Ga0501046_0000290
643 Ga0501073_0020604
644 Ga0501074_0228163
645 Ga0501207_002944
646 Ga0501227_009514
647 Ga0501238_000498
648 Ga0501249_006282
649 Ga0501080_0099817
650 Ga0501269_000216
651 Ga0501279_023914
652 Ga0501035_0014780
653 Ga0501044_0424368
654 Ga0500594_0019523
655 Ga0500618_000297
656 Ga0500586_004510
657 Ga0500586_007945
658 2643791662
659 2644211294
660 2644251407
661 2644356452
662 2738738909
663 2738829820
664 2738844810
665 2739153616
666 2739195536
667 2739276335
668 2739322012
669 2739340253
670 2739345141
671 2821131778
672 2842715442
673 2857559199
674 2857567003
675 2884216966
676 2904425044

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

227

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

274

0.94

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

35

142

0.81

PF08659

KR

KR domain

34

210

0.78

PF23441

24

244

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wwx-assembly1.cif.gz_A crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) 0.9819 6 257
5wjs-assembly1.cif.gz_B crystal structure of oxidoreductase (short chain dehydrogenase/reductase family) from burkholderia thailandensis complexed with nadh 0.9812 4 257
4lvu-assembly1.cif.gz_B-2 crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis 0.9797 8 257
4lvu-assembly1.cif.gz_A-2 crystal structure of a putative short chain dehydrogenase from burkholderia thailandensis 0.9706 8 257
7wwx-assembly1.cif.gz_A crystal structure of herbaspirillum huttiense l-arabinose 1-dehydrogenase (nad bound form) 0.9704 6 257
ID Description Score Start End Superfamily
4lvuA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9705 8 257 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9622 14 256 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.958 14 257 3.40.50.720
3grpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9549 14 256 3.40.50.720
3ennB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9517 11 260 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A0L0MBF5-F1-model_v4 D-xylose 1-dehydrogenase (EC 1.1.1.175) 0.9913 6 257 GO:0047838
AF-A0A1M5K9F9-F1-model_v4 NAD(P)-dependent dehydrogenase, short-chain alcohol dehydrogenase family 0.9897 5 257 GO:0016491
AF-A0A158JRL2-F1-model_v4 Short-chain dehydrogenase/reductase SDR 0.9893 6 188
AF-A0A2T2PSP7-F1-model_v4 3-oxoacyl-ACP reductase 0.9865 6 257 GO:0016491
AF-A0A2G6YA75-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9863 9 257 GO:0016491

Map