F413708

General Info

Members Datasets Scaffolds Average Seq Length
338 246 676 169

Family's Representative Sequence

Representative Sequence 3300049581|Ga0501047_0040443|Ga0501047_0040443_1531_2157
Length 208
Sequence VVRGRPQALTAAEAVCRLAAYAAVVRLLLTTDTHLPKRAKELPAPLLAELPRADVVFHAGDWVDTDTLDLLEARSRRLVAVYGNNDGPALRARLPEVAYAELDGLRFAVVHETGAAQGREARCAARFPDLDVLVFGHSHIPWDTTAPNGLRLLNPGSPTDRRRQPHCTYMTATVADGLLTDVRLHRLPPRRPPVSGQRGRAPDDRDRA

Samples

Sample ID Description Type Environment
1 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
11 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
12 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
167 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
174 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
175 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
176 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
177 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
181 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
182 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
183 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
186 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
187 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
193 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
199 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
200 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
201 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
216 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
217 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
218 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
240 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
241 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
242 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
243 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
244 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
245 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
246 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.22
Metatranscriptomes 0.3
Isolates 1.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.4
Nodule 0.3
Rhizoplane 6.21
Rhizosphere 84.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501047_0040443 3300049581 Bacteria 4509
2 CNXas_1006529 3300000545 Bacteria 822
3 LJQas_1003013 3300000549 Bacteria 2285
4 JGI24737J22298_10011557 3300001990 Bacteria 2891
5 JGI24748J21848_1004777 3300002074 Bacteria 1559
6 JGI24749J21850_1008695 3300002076 Bacteria 1417
7 JGI24744J21845_10003950 3300002077 Bacteria 3057
8 JGI24034J26672_10002857 3300002239 Bacteria 2387
9 JGI24742J22300_10001403 3300002244 Bacteria 3799
10 JGI25162J39368_1005137 3300002737 Bacteria 2695
11 JGI25164J39214_1000786 3300002772 Bacteria 11449
12 JGI25165J46597_1000004 3300003214 Bacteria 667510
13 Ga0070676_10014167 3300005328 Bacteria 4379
14 Ga0070690_100259539 3300005330 Bacteria 1232
15 Ga0070670_100176514 3300005331 Bacteria 1854
16 Ga0070680_100342185 3300005336 Bacteria 1271
17 Ga0070682_100012230 3300005337 Bacteria 4915
18 Ga0068868_100001482 3300005338 Bacteria 16198
19 Ga0070689_100003628 3300005340 Bacteria 10294
20 Ga0070691_10003004 3300005341 Bacteria 7548
21 Ga0070687_100445253 3300005343 Bacteria 860
22 Ga0070668_100001723 3300005347 Bacteria 15891
23 Ga0070668_100482425 3300005347 Bacteria 1071
24 Ga0070675_100385577 3300005354 Bacteria 1248
25 Ga0070671_100002188 3300005355 Bacteria 15095
26 Ga0070674_100002593 3300005356 Bacteria 10004
27 Ga0070688_100002930 3300005365 Bacteria 8702
28 Ga0070659_100365643 3300005366 Bacteria 1213
29 Ga0070667_100007035 3300005367 Bacteria 9353
30 Ga0070667_100010032 3300005367 Bacteria 7848
31 Ga0070667_100225964 3300005367 Bacteria 1667
32 Ga0070703_10143323 3300005406 Bacteria 890
33 Ga0070710_10001436 3300005437 Bacteria 11253
34 Ga0070710_10085586 3300005437 Bacteria 1849
35 Ga0070701_10000976 3300005438 Bacteria 10351
36 Ga0070711_100002959 3300005439 Bacteria 9801
37 Ga0070711_100023952 3300005439 Bacteria 3977
38 Ga0070705_100023427 3300005440 Bacteria 3315
39 Ga0070705_100287609 3300005440 Bacteria 1172
40 Ga0070700_100002170 3300005441 Bacteria 9958
41 Ga0070694_100010800 3300005444 Bacteria 5647
42 Ga0070663_100008297 3300005455 Bacteria 6381
43 Ga0070663_100144998 3300005455 Bacteria 1816
44 Ga0070678_100000469 3300005456 Bacteria 19283
45 Ga0070678_100059245 3300005456 Bacteria 2813
46 Ga0070662_100004382 3300005457 Bacteria 8917
47 Ga0068867_100000767 3300005459 Bacteria 21667
48 Ga0068867_101912709 3300005459 Bacteria 559
49 Ga0070685_10287540 3300005466 Bacteria 1103
50 Ga0068853_100001450 3300005539 Bacteria 17185
51 Ga0070672_100217379 3300005543 Bacteria 1602
52 Ga0070686_100737125 3300005544 Bacteria 789
53 Ga0070695_100065952 3300005545 Bacteria 2359
54 Ga0070696_100006033 3300005546 Bacteria 8084
55 Ga0070693_100002376 3300005547 Bacteria 8654
56 Ga0070665_100002445 3300005548 Bacteria 20475
57 Ga0070665_100016457 3300005548 Bacteria 7413
58 Ga0070665_100516034 3300005548 Bacteria 1207
59 Ga0070704_100000569 3300005549 Bacteria 17800
60 Ga0070704_100381697 3300005549 Bacteria 1197
61 Ga0068855_100005967 3300005563 Bacteria 14859
62 Ga0068855_100036683 3300005563 Bacteria 5832
63 Ga0068855_100369934 3300005563 Bacteria 1576
64 Ga0068854_100000815 3300005578 Bacteria 18619
65 Ga0068854_100012590 3300005578 Bacteria 5541
66 Ga0068854_100245522 3300005578 Bacteria 1427
67 Ga0068856_100034289 3300005614 Bacteria 4971
68 Ga0070702_100000195 3300005615 Bacteria 19763
69 Ga0070702_101469825 3300005615 Bacteria 559
70 Ga0068852_100015867 3300005616 Bacteria 5859
71 Ga0068859_100002984 3300005617 Bacteria 17153
72 Ga0068859_100121123 3300005617 Bacteria 2682
73 Ga0068864_100202974 3300005618 Bacteria 1822
74 Ga0068866_10001156 3300005718 Bacteria 11598
75 Ga0068866_10163383 3300005718 Bacteria 1301
76 Ga0068861_100000969 3300005719 Bacteria 17503
77 Ga0068861_100422890 3300005719 Bacteria 1187
78 Ga0068863_100024750 3300005841 Bacteria 5726
79 Ga0068858_100002471 3300005842 Bacteria 18658
80 Ga0068858_100209817 3300005842 Bacteria 1843
81 Ga0068858_100573735 3300005842 Bacteria 1093
82 Ga0068860_100005581 3300005843 Bacteria 12717
83 Ga0068860_100396566 3300005843 Bacteria 1365
84 Ga0068862_100071396 3300005844 Bacteria 2998
85 Ga0068862_100160308 3300005844 Bacteria 2007
86 Ga0081455_10038552 3300005937 Bacteria 4230
87 Ga0081455_10052304 3300005937 Bacteria 3498
88 Ga0081538_10000362 3300005981 Bacteria 51774
89 Ga0075365_10549110 3300006038 Bacteria 817
90 Ga0075363_100032264 3300006048 Bacteria 2719
91 Ga0075363_100404020 3300006048 Bacteria 803
92 Ga0075364_10035572 3300006051 Bacteria 3219
93 Ga0075364_10436088 3300006051 Bacteria 895
94 Ga0070715_10004065 3300006163 Bacteria 4751
95 Ga0070716_100001880 3300006173 Bacteria 9538
96 Ga0070716_100050679 3300006173 Bacteria 2357
97 Ga0070712_100010502 3300006175 Bacteria 5845
98 Ga0070712_100266138 3300006175 Bacteria 1375
99 Ga0075367_10184495 3300006178 Bacteria 1301
100 Ga0075369_10009608 3300006186 Bacteria 3763
101 Ga0075369_10285612 3300006186 Bacteria 769
102 Ga0075370_10001462 3300006353 Bacteria 10268
103 Ga0075370_10218627 3300006353 Bacteria 1126
104 Ga0075428_100004096 3300006844 Bacteria 16046
105 Ga0075430_100168638 3300006846 Bacteria 1821
106 Ga0075431_100180268 3300006847 Bacteria 2168
107 Ga0068865_100001248 3300006881 Bacteria 14791
108 Ga0068865_101084906 3300006881 Bacteria 704
109 Ga0097620_100002984 3300006931 Bacteria 17153
110 Ga0097620_100121125 3300006931 Bacteria 2682
111 Ga0105240_10134763 3300009093 Bacteria 2958
112 Ga0105245_10014268 3300009098 Bacteria 6924
113 Ga0105247_10000785 3300009101 Bacteria 24322
114 Ga0114129_10001921 3300009147 Bacteria 28370
115 Ga0105243_10003035 3300009148 Bacteria 13846
116 Ga0105241_10013198 3300009174 Bacteria 6058
117 Ga0105241_10014681 3300009174 Bacteria 5733
118 Ga0105242_10002859 3300009176 Bacteria 13532
119 Ga0105248_10003386 3300009177 Bacteria 17720
120 Ga0105238_10006486 3300009551 Bacteria 11636
121 Ga0105249_10001644 3300009553 Bacteria 19594
122 Ga0105249_10038864 3300009553 Bacteria 4319
123 Ga0105239_10008911 3300010375 Bacteria 11352
124 Ga0105239_10030561 3300010375 Bacteria 5922
125 Ga0105246_11159101 3300011119 Bacteria 709
126 Ga0157369_10000337 3300013105 Bacteria 62293
127 Ga0157369_10408833 3300013105 Bacteria 1407
128 Ga0157374_10016189 3300013296 Bacteria 6551
129 Ga0157378_10002471 3300013297 Bacteria 16439
130 Ga0163162_10031331 3300013306 Bacteria 5275
131 Ga0163162_10471675 3300013306 Bacteria 1387
132 Ga0157372_10907979 3300013307 Bacteria 1022
133 Ga0157375_10001214 3300013308 Bacteria 22203
134 Ga0157375_10261448 3300013308 Bacteria 1892
135 Ga0163163_10200647 3300014325 Bacteria 2043
136 Ga0163163_10666360 3300014325 Bacteria 1104
137 Ga0163163_12290478 3300014325 Bacteria 599
138 Ga0157380_10001419 3300014326 Bacteria 15675
139 Ga0157379_10000993 3300014968 Bacteria 23015
140 Ga0157376_10029669 3300014969 Bacteria 4359
141 Ga0182007_10002215 3300015262 Bacteria 9856
142 Ga0163161_10001939 3300017792 Bacteria 15080
143 Ga0224712_10089054 3300022467 Bacteria 1289
144 Ga0207427_100010 3300025231 Bacteria 648610
145 Ga0209437_101254 3300025233 Bacteria 7022
146 Ga0209233_1000001 3300025261 Bacteria 2992747
147 Ga0207697_10106877 3300025315 Bacteria 1196
148 Ga0207692_10006879 3300025898 Bacteria 4633
149 Ga0207642_10000336 3300025899 Bacteria 14078
150 Ga0207642_10020165 3300025899 Bacteria 2597
151 Ga0207710_10034376 3300025900 Bacteria 2227
152 Ga0207688_10001254 3300025901 Bacteria 13190
153 Ga0207680_10024102 3300025903 Bacteria 3334
154 Ga0207647_10019119 3300025904 Bacteria 4612
155 Ga0207647_10050549 3300025904 Bacteria 2573
156 Ga0207685_10004509 3300025905 Bacteria 3553
157 Ga0207685_10354212 3300025905 Bacteria 741
158 Ga0207645_10006793 3300025907 Bacteria 8168
159 Ga0207654_10010730 3300025911 Bacteria 4664
160 Ga0207654_10026264 3300025911 Bacteria 3151
161 Ga0207707_10708706 3300025912 Bacteria 845
162 Ga0207695_10019905 3300025913 Bacteria 7712
163 Ga0207671_10000682 3300025914 Bacteria 44147
164 Ga0207693_10001453 3300025915 Bacteria 20975
165 Ga0207693_10164502 3300025915 Bacteria 1746
166 Ga0207663_10005254 3300025916 Bacteria 6520
167 Ga0207663_10383384 3300025916 Bacteria 1071
168 Ga0207660_10208691 3300025917 Bacteria 1528
169 Ga0207662_10116511 3300025918 Bacteria 1671
170 Ga0207657_10278263 3300025919 Bacteria 1329
171 Ga0207681_10127112 3300025923 Bacteria 1879
172 Ga0207681_10431132 3300025923 Bacteria 1070
173 Ga0207694_10008820 3300025924 Bacteria 7607
174 Ga0207687_10003263 3300025927 Bacteria 10986
175 Ga0207644_10002788 3300025931 Bacteria 11258
176 Ga0207644_10179111 3300025931 Bacteria 1660
177 Ga0207690_10130855 3300025932 Bacteria 1836
178 Ga0207706_10078129 3300025933 Bacteria 2911
179 Ga0207686_10068581 3300025934 Bacteria 2272
180 Ga0207709_10099113 3300025935 Bacteria 1923
181 Ga0207670_10003022 3300025936 Bacteria 8881
182 Ga0207669_10004056 3300025937 Bacteria 6410
183 Ga0207704_10000648 3300025938 Bacteria 15379
184 Ga0207704_10400214 3300025938 Bacteria 1083
185 Ga0207665_10010757 3300025939 Bacteria 6009
186 Ga0207665_10016259 3300025939 Bacteria 4885
187 Ga0207691_10221694 3300025940 Bacteria 1639
188 Ga0207711_10027334 3300025941 Bacteria 4792
189 Ga0207689_10062732 3300025942 Bacteria 3057
190 Ga0207667_10035228 3300025949 Bacteria 5370
191 Ga0207651_10255444 3300025960 Bacteria 1436
192 Ga0207712_10042782 3300025961 Bacteria 3122
193 Ga0207668_10006198 3300025972 Bacteria 7060
194 Ga0207640_10005193 3300025981 Bacteria 7084
195 Ga0207640_10026709 3300025981 Bacteria 3509
196 Ga0207640_10867191 3300025981 Bacteria 786
197 Ga0207658_10005981 3300025986 Bacteria 8317
198 Ga0207658_10041584 3300025986 Bacteria 3329
199 Ga0207658_10058950 3300025986 Bacteria 2859
200 Ga0207658_10467881 3300025986 Bacteria 1118
201 Ga0207677_10002001 3300026023 Bacteria 10749
202 Ga0207677_11441509 3300026023 Bacteria 635
203 Ga0207703_10005398 3300026035 Bacteria 10291
204 Ga0207703_10218291 3300026035 Bacteria 1704
205 Ga0207639_10008265 3300026041 Bacteria 7130
206 Ga0207639_10463060 3300026041 Bacteria 1153
207 Ga0207639_11214254 3300026041 Bacteria 708
208 Ga0207678_10020036 3300026067 Bacteria 5877
209 Ga0207708_10003908 3300026075 Bacteria 10967
210 Ga0207708_10051762 3300026075 Bacteria 3127
211 Ga0207641_10008971 3300026088 Bacteria 8262
212 Ga0207648_10001187 3300026089 Bacteria 29149
213 Ga0207676_10281677 3300026095 Bacteria 1510
214 Ga0207675_100000909 3300026118 Bacteria 29571
215 Ga0207675_100062708 3300026118 Bacteria 3473
216 Ga0207683_10001040 3300026121 Bacteria 25287
217 Ga0207683_10313555 3300026121 Bacteria 1436
218 Ga0207683_10381151 3300026121 Bacteria 1296
219 Ga0207698_10570160 3300026142 Bacteria 1112
220 Ga0268266_10004912 3300028379 Bacteria 12668
221 Ga0268266_10049243 3300028379 Bacteria 3613
222 Ga0268265_10045594 3300028380 Bacteria 3272
223 Ga0268265_10432933 3300028380 Bacteria 1224
224 Ga0268264_10006313 3300028381 Bacteria 9993
225 Ga0307515_10252055 3300028794 Bacteria 1516
226 Ga0307513_10007316 3300031456 Bacteria 14335
227 Ga0307413_10037845 3300031824 Bacteria 2790
228 Ga0307518_10001920 3300031838 Bacteria 15375
229 Ga0307407_10256229 3300031903 Bacteria 1201
230 Ga0307409_100342429 3300031995 Bacteria 1407
231 Ga0307416_100374442 3300032002 Bacteria 1451
232 Ga0307416_100769426 3300032002 Bacteria 1057
233 Ga0307416_100782018 3300032002 Bacteria 1049
234 Ga0307415_100391357 3300032126 Bacteria 1184
235 Ga0373948_0084998 3300034817 Bacteria 727
236 Ga0373953_0219146 3300035117 Bacteria 824
237 Ga0373931_0036530 3300035691 Bacteria 2561
238 Ga0373931_0052583 3300035691 Bacteria 2172
239 Ga0373937_1106863 3300036401 Bacteria 741
240 Ga0395901_0094622 3300038443 Bacteria 3130
241 Ga0436365_0458779 3300039437 Bacteria 10972
242 Ga0439461_0023214 3300041410 Bacteria 1247
243 Ga0439466_0001815 3300041411 Bacteria 8364
244 Ga0439465_0001975 3300041413 Bacteria 6732
245 Ga0451853_2143436 3300041512 Bacteria 1920
246 Ga0439442_007554 3300042002 Bacteria 2188
247 Ga0439448_0080287 3300042005 Bacteria 1095
248 Ga0439449_0129616 3300042007 Bacteria 937
249 Ga0450894_000303 3300042131 Bacteria 8822
250 Ga0450898_007762 3300042134 Bacteria 1677
251 Ga0450899_000203 3300042135 Bacteria 6126
252 Ga0450906_001692 3300042145 Bacteria 4829
253 Ga0439458_0064394 3300042157 Bacteria 919
254 Ga0466969_0013161 3300044656 Bacteria 4359
255 Ga0466972_0047926 3300044658 Bacteria 2065
256 Ga0466965_0005303 3300044683 Bacteria 5801
257 Ga0466965_0119991 3300044683 Bacteria 1357
258 Ga0466965_0284769 3300044683 Bacteria 893
259 Ga0466966_0064650 3300044684 Bacteria 2302
260 Ga0466961_0012880 3300044693 Bacteria 5351
261 Ga0466961_0020661 3300044693 Bacteria 4237
262 Ga0466961_0205781 3300044693 Bacteria 1216
263 Ga0466963_0115178 3300044694 Bacteria 1847
264 Ga0466964_0151868 3300044706 Bacteria 1074
265 Ga0466964_0375021 3300044706 Bacteria 737
266 Ga0466968_0196246 3300044735 Bacteria 944
267 Ga0466970_0020912 3300044765 Bacteria 3405
268 Ga0466960_0002375 3300044901 Bacteria 7081
269 Ga0466959_0039801 3300045049 Bacteria 3474
270 Ga0466959_0596484 3300045049 Bacteria 743
271 Ga0466967_0250410 3300045976 Bacteria 1692
272 Ga0466967_0826913 3300045976 Bacteria 920
273 Ga0466967_0954928 3300045976 Bacteria 853
274 Ga0495594_0080953 3300046499 Bacteria 1813
275 Ga0495610_0219009 3300046512 Bacteria 770
276 Ga0495622_0080134 3300046557 Bacteria 1503
277 Ga0495667_0534823 3300046559 Bacteria 733
278 Ga0495649_0386457 3300046694 Bacteria 704
279 Ga0495675_0163257 3300047444 Bacteria 1371
280 Ga0496100_0001156 3300048903 Bacteria 12839
281 Ga0496100_0412868 3300048903 Bacteria 1030
282 Ga0496100_0577266 3300048903 Bacteria 871
283 Ga0496101_0000709 3300048904 Bacteria 19933
284 Ga0496102_0002992 3300048905 Bacteria 14311
285 Ga0496102_0134489 3300048905 Bacteria 2316
286 Ga0496102_0793487 3300048905 Bacteria 869
287 Ga0496103_0001507 3300048906 Bacteria 15577
288 Ga0496104_0405270 3300048907 Bacteria 1276
289 Ga0496104_0660776 3300048907 Bacteria 954
290 Ga0496105_0011650 3300048908 Bacteria 6958
291 Ga0496106_0004257 3300048909 Bacteria 10653
292 Ga0496106_0106978 3300048909 Bacteria 2175
293 Ga0496107_0001893 3300048910 Bacteria 13264
294 Ga0496107_0735545 3300048910 Bacteria 724
295 Ga0496108_0271891 3300048911 Bacteria 1475
296 Ga0496109_0032662 3300048912 Bacteria 4680
297 Ga0496110_0578964 3300048913 Bacteria 1019
298 Ga0496112_0019004 3300048915 Bacteria 6477
299 Ga0496114_0002046 3300048917 Bacteria 15361
300 Ga0496115_0002978 3300048918 Bacteria 12168
301 Ga0496119_0136955 3300048922 Bacteria 1327
302 Ga0501031_0173259 3300049568 Bacteria 1410
303 Ga0501033_0186282 3300049570 Bacteria 1487
304 Ga0501036_0024520 3300049572 Bacteria 5086
305 Ga0501036_0050493 3300049572 Bacteria 3522
306 Ga0501036_0759148 3300049572 Bacteria 800
307 Ga0501037_0086580 3300049573 Bacteria 2268
308 Ga0501038_0001239 3300049574 Bacteria 23121
309 Ga0501043_0345174 3300049579 Bacteria 1132
310 Ga0501043_0802875 3300049579 Bacteria 680
311 Ga0501046_0012935 3300049580 Bacteria 7094
312 Ga0501047_0156999 3300049581 Bacteria 2148
313 Ga0501048_0177780 3300049582 Bacteria 1508
314 Ga0501070_0546370 3300049586 Bacteria 928
315 Ga0501202_043158 3300049652 Bacteria 980
316 Ga0501080_0116457 3300049742 Bacteria 2477
317 Ga0501035_0063509 3300049822 Bacteria 3284
318 Ga0501035_0171622 3300049822 Bacteria 1873
319 Ga0501044_0007670 3300049823 Bacteria 11864
320 Ga0501044_0533974 3300049823 Bacteria 1072
321 nmdc:mga03n38_2189_c1 3300050490 Bacteria 5959
322 nmdc:mga03n38_298853_c1 3300050490 Bacteria 864
323 nmdc:mga03n38_47631_c1 3300050490 Bacteria 1898
324 nmdc:mga00v17_221238_c1 3300050491 Bacteria 1226
325 nmdc:mga06z11_685907_c1 3300050494 Bacteria 624
326 nmdc:mga07m45_5313_c1 3300050496 Bacteria 6404
327 nmdc:mga05p37_4220_c1 3300050507 Bacteria 16787
328 nmdc:mga08y16_614629_c1 3300050511 Bacteria 1094
329 nmdc:mga0sz30_61231_c1 3300050516 Bacteria 1608
330 Ga0495619_0015446 3300053085 Bacteria 4832
331 Ga0500583_0305939 3300053092 Bacteria 777
332 Ga0500573_0186425 3300053140 Bacteria 1111
333 Ga0466962_0056782 3300061719 Bacteria 1869
334 2585320794 2582581314 Bacteria 11452267
335 2852680302 2852677369 Bacteria 3768884
336 2928124044 2928121344 Bacteria 3972376
337 8054613865 8054609563 Bacteria 5170090
338 8056832420 8056829672 Bacteria 9045328
339 Ga0501047_0040443
340 CNXas_1006529
341 LJQas_1003013
342 JGI24737J22298_10011557
343 JGI24748J21848_1004777
344 JGI24749J21850_1008695
345 JGI24744J21845_10003950
346 JGI24034J26672_10002857
347 JGI24742J22300_10001403
348 JGI25162J39368_1005137
349 JGI25164J39214_1000786
350 JGI25165J46597_1000004
351 Ga0070676_10014167
352 Ga0070690_100259539
353 Ga0070670_100176514
354 Ga0070680_100342185
355 Ga0070682_100012230
356 Ga0068868_100001482
357 Ga0070689_100003628
358 Ga0070691_10003004
359 Ga0070687_100445253
360 Ga0070668_100001723
361 Ga0070668_100482425
362 Ga0070675_100385577
363 Ga0070671_100002188
364 Ga0070674_100002593
365 Ga0070688_100002930
366 Ga0070659_100365643
367 Ga0070667_100007035
368 Ga0070667_100010032
369 Ga0070667_100225964
370 Ga0070703_10143323
371 Ga0070710_10001436
372 Ga0070710_10085586
373 Ga0070701_10000976
374 Ga0070711_100002959
375 Ga0070711_100023952
376 Ga0070705_100023427
377 Ga0070705_100287609
378 Ga0070700_100002170
379 Ga0070694_100010800
380 Ga0070663_100008297
381 Ga0070663_100144998
382 Ga0070678_100000469
383 Ga0070678_100059245
384 Ga0070662_100004382
385 Ga0068867_100000767
386 Ga0068867_101912709
387 Ga0070685_10287540
388 Ga0068853_100001450
389 Ga0070672_100217379
390 Ga0070686_100737125
391 Ga0070695_100065952
392 Ga0070696_100006033
393 Ga0070693_100002376
394 Ga0070665_100002445
395 Ga0070665_100016457
396 Ga0070665_100516034
397 Ga0070704_100000569
398 Ga0070704_100381697
399 Ga0068855_100005967
400 Ga0068855_100036683
401 Ga0068855_100369934
402 Ga0068854_100000815
403 Ga0068854_100012590
404 Ga0068854_100245522
405 Ga0068856_100034289
406 Ga0070702_100000195
407 Ga0070702_101469825
408 Ga0068852_100015867
409 Ga0068859_100002984
410 Ga0068859_100121123
411 Ga0068864_100202974
412 Ga0068866_10001156
413 Ga0068866_10163383
414 Ga0068861_100000969
415 Ga0068861_100422890
416 Ga0068863_100024750
417 Ga0068858_100002471
418 Ga0068858_100209817
419 Ga0068858_100573735
420 Ga0068860_100005581
421 Ga0068860_100396566
422 Ga0068862_100071396
423 Ga0068862_100160308
424 Ga0081455_10038552
425 Ga0081455_10052304
426 Ga0081538_10000362
427 Ga0075365_10549110
428 Ga0075363_100032264
429 Ga0075363_100404020
430 Ga0075364_10035572
431 Ga0075364_10436088
432 Ga0070715_10004065
433 Ga0070716_100001880
434 Ga0070716_100050679
435 Ga0070712_100010502
436 Ga0070712_100266138
437 Ga0075367_10184495
438 Ga0075369_10009608
439 Ga0075369_10285612
440 Ga0075370_10001462
441 Ga0075370_10218627
442 Ga0075428_100004096
443 Ga0075430_100168638
444 Ga0075431_100180268
445 Ga0068865_100001248
446 Ga0068865_101084906
447 Ga0097620_100002984
448 Ga0097620_100121125
449 Ga0105240_10134763
450 Ga0105245_10014268
451 Ga0105247_10000785
452 Ga0114129_10001921
453 Ga0105243_10003035
454 Ga0105241_10013198
455 Ga0105241_10014681
456 Ga0105242_10002859
457 Ga0105248_10003386
458 Ga0105238_10006486
459 Ga0105249_10001644
460 Ga0105249_10038864
461 Ga0105239_10008911
462 Ga0105239_10030561
463 Ga0105246_11159101
464 Ga0157369_10000337
465 Ga0157369_10408833
466 Ga0157374_10016189
467 Ga0157378_10002471
468 Ga0163162_10031331
469 Ga0163162_10471675
470 Ga0157372_10907979
471 Ga0157375_10001214
472 Ga0157375_10261448
473 Ga0163163_10200647
474 Ga0163163_10666360
475 Ga0163163_12290478
476 Ga0157380_10001419
477 Ga0157379_10000993
478 Ga0157376_10029669
479 Ga0182007_10002215
480 Ga0163161_10001939
481 Ga0224712_10089054
482 Ga0207427_100010
483 Ga0209437_101254
484 Ga0209233_1000001
485 Ga0207697_10106877
486 Ga0207692_10006879
487 Ga0207642_10000336
488 Ga0207642_10020165
489 Ga0207710_10034376
490 Ga0207688_10001254
491 Ga0207680_10024102
492 Ga0207647_10019119
493 Ga0207647_10050549
494 Ga0207685_10004509
495 Ga0207685_10354212
496 Ga0207645_10006793
497 Ga0207654_10010730
498 Ga0207654_10026264
499 Ga0207707_10708706
500 Ga0207695_10019905
501 Ga0207671_10000682
502 Ga0207693_10001453
503 Ga0207693_10164502
504 Ga0207663_10005254
505 Ga0207663_10383384
506 Ga0207660_10208691
507 Ga0207662_10116511
508 Ga0207657_10278263
509 Ga0207681_10127112
510 Ga0207681_10431132
511 Ga0207694_10008820
512 Ga0207687_10003263
513 Ga0207644_10002788
514 Ga0207644_10179111
515 Ga0207690_10130855
516 Ga0207706_10078129
517 Ga0207686_10068581
518 Ga0207709_10099113
519 Ga0207670_10003022
520 Ga0207669_10004056
521 Ga0207704_10000648
522 Ga0207704_10400214
523 Ga0207665_10010757
524 Ga0207665_10016259
525 Ga0207691_10221694
526 Ga0207711_10027334
527 Ga0207689_10062732
528 Ga0207667_10035228
529 Ga0207651_10255444
530 Ga0207712_10042782
531 Ga0207668_10006198
532 Ga0207640_10005193
533 Ga0207640_10026709
534 Ga0207640_10867191
535 Ga0207658_10005981
536 Ga0207658_10041584
537 Ga0207658_10058950
538 Ga0207658_10467881
539 Ga0207677_10002001
540 Ga0207677_11441509
541 Ga0207703_10005398
542 Ga0207703_10218291
543 Ga0207639_10008265
544 Ga0207639_10463060
545 Ga0207639_11214254
546 Ga0207678_10020036
547 Ga0207708_10003908
548 Ga0207708_10051762
549 Ga0207641_10008971
550 Ga0207648_10001187
551 Ga0207676_10281677
552 Ga0207675_100000909
553 Ga0207675_100062708
554 Ga0207683_10001040
555 Ga0207683_10313555
556 Ga0207683_10381151
557 Ga0207698_10570160
558 Ga0268266_10004912
559 Ga0268266_10049243
560 Ga0268265_10045594
561 Ga0268265_10432933
562 Ga0268264_10006313
563 Ga0307515_10252055
564 Ga0307513_10007316
565 Ga0307413_10037845
566 Ga0307518_10001920
567 Ga0307407_10256229
568 Ga0307409_100342429
569 Ga0307416_100374442
570 Ga0307416_100769426
571 Ga0307416_100782018
572 Ga0307415_100391357
573 Ga0373948_0084998
574 Ga0373953_0219146
575 Ga0373931_0036530
576 Ga0373931_0052583
577 Ga0373937_1106863
578 Ga0395901_0094622
579 Ga0436365_0458779
580 Ga0439461_0023214
581 Ga0439466_0001815
582 Ga0439465_0001975
583 Ga0451853_2143436
584 Ga0439442_007554
585 Ga0439448_0080287
586 Ga0439449_0129616
587 Ga0450894_000303
588 Ga0450898_007762
589 Ga0450899_000203
590 Ga0450906_001692
591 Ga0439458_0064394
592 Ga0466969_0013161
593 Ga0466972_0047926
594 Ga0466965_0005303
595 Ga0466965_0119991
596 Ga0466965_0284769
597 Ga0466966_0064650
598 Ga0466961_0012880
599 Ga0466961_0020661
600 Ga0466961_0205781
601 Ga0466963_0115178
602 Ga0466964_0151868
603 Ga0466964_0375021
604 Ga0466968_0196246
605 Ga0466970_0020912
606 Ga0466960_0002375
607 Ga0466959_0039801
608 Ga0466959_0596484
609 Ga0466967_0250410
610 Ga0466967_0826913
611 Ga0466967_0954928
612 Ga0495594_0080953
613 Ga0495610_0219009
614 Ga0495622_0080134
615 Ga0495667_0534823
616 Ga0495649_0386457
617 Ga0495675_0163257
618 Ga0496100_0001156
619 Ga0496100_0412868
620 Ga0496100_0577266
621 Ga0496101_0000709
622 Ga0496102_0002992
623 Ga0496102_0134489
624 Ga0496102_0793487
625 Ga0496103_0001507
626 Ga0496104_0405270
627 Ga0496104_0660776
628 Ga0496105_0011650
629 Ga0496106_0004257
630 Ga0496106_0106978
631 Ga0496107_0001893
632 Ga0496107_0735545
633 Ga0496108_0271891
634 Ga0496109_0032662
635 Ga0496110_0578964
636 Ga0496112_0019004
637 Ga0496114_0002046
638 Ga0496115_0002978
639 Ga0496119_0136955
640 Ga0501031_0173259
641 Ga0501033_0186282
642 Ga0501036_0024520
643 Ga0501036_0050493
644 Ga0501036_0759148
645 Ga0501037_0086580
646 Ga0501038_0001239
647 Ga0501043_0345174
648 Ga0501043_0802875
649 Ga0501046_0012935
650 Ga0501047_0156999
651 Ga0501048_0177780
652 Ga0501070_0546370
653 Ga0501202_043158
654 Ga0501080_0116457
655 Ga0501035_0063509
656 Ga0501035_0171622
657 Ga0501044_0007670
658 Ga0501044_0533974
659 nmdc:mga03n38_2189_c1
660 nmdc:mga03n38_298853_c1
661 nmdc:mga03n38_47631_c1
662 nmdc:mga00v17_221238_c1
663 nmdc:mga06z11_685907_c1
664 nmdc:mga07m45_5313_c1
665 nmdc:mga05p37_4220_c1
666 nmdc:mga08y16_614629_c1
667 nmdc:mga0sz30_61231_c1
668 Ga0495619_0015446
669 Ga0500583_0305939
670 Ga0500573_0186425
671 Ga0466962_0056782
672 2585320794
673 2852680302
674 2928124044
675 8054613865
676 8056832420

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

25

177

0.92

PF00149

Metallophos

Calcineurin-like phosphoesterase

25

113

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8218 2 163
1w24-assembly1.cif.gz_A crystal structure of human vps29 0.8212 1 163
5w8m-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8088 2 163
2kkn-assembly1.cif.gz_A solution nmr structure of themotoga maritima protein tm1076: northeast structural genomics consortium target vt57 0.8081 2 163
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.8038 1 163
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8811 1 161 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8706 1 161 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8218 2 163 3.60.21.10
2kknA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8081 2 163 3.60.21.10
af_Q5AB94_1_173_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8053 3 141 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7X5ZFR9-F1-model_v4 Putative phosphoesterase 0.9987 55 163
AF-A0A7R7GZ97-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9912 1 163 GO:0016787
GO:0046872
AF-A0A1I0DSY4-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9908 1 165 GO:0016787
GO:0046872
AF-A0A172UHX3-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9903 1 163 GO:0016787
GO:0046872
AF-A0A6J4JPC8-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9898 1 165 GO:0016787
GO:0046872

Map