F413800

General Info

Members Datasets Scaffolds Average Seq Length
339 234 678 401

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100000321|Ga0070690_10000032122
Length 422
Sequence MSQPADPRLPLAGVRILAVEQYGAGPFGTLYLADLGAEVIKIENHKDGGDVGREVGPHFFGPGDSHFFQTFNRNKRSVTLDLKHPEGKAAFGALVKTADAVLDNLRGDLPDKLGLTYEHLKEVNPRIVCAHLSAYGRSGSRKAWPGYDYLMQAEAGHMSLTGEPGSPPTRYGLSIVDLMTGLAAAFGLLAGVLSARETGRGMDVDTSLFDVALHNLNYPGTWFLNAGAVTGRTPRSSHPSLTPSQLYRTRDGWIFIMCNKEKFWGLLAESLGKPEWTKDPAFATFKARLANRERVTQMLDAALMTRTTAEWIEHFAGKVPASPVYDVAQALQSDFVAERDGVVDYRYPDGRSARMIAGPIRVAGVGLPARAAPPMGADTDAELRAAGYSDARIAALRASGVISDSPKTKPGTSESIELAASG

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
75 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
76 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
112 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
113 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
114 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
118 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
119 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
120 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
127 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
128 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
129 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
130 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
144 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
149 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
152 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
153 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
157 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
158 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
163 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
170 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
171 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
172 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
198 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
203 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
207 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
225 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
226 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
227 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
228 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
229 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
230 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
231 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
232 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
233 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
234 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0
Isolates 2.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0.29
Rhizoplane 5.9
Rhizosphere 87.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100000321 3300005330 Bacteria 24690
2 Ga0068869_100000861 3300005334 Bacteria 17438
3 Ga0068869_100068592 3300005334 Bacteria 2620
4 Ga0070680_100000425 3300005336 Bacteria 28804
5 Ga0070682_100004549 3300005337 Bacteria 7709
6 Ga0068868_100000641 3300005338 Bacteria 23565
7 Ga0070689_100000304 3300005340 Bacteria 28624
8 Ga0070689_100024542 3300005340 Bacteria 4523
9 Ga0070689_100083403 3300005340 Bacteria 2512
10 Ga0070687_100000066 3300005343 Bacteria 34385
11 Ga0070671_100009995 3300005355 Bacteria 7619
12 Ga0070671_100076683 3300005355 Bacteria 2793
13 Ga0070673_100073225 3300005364 Bacteria 2757
14 Ga0070673_100141542 3300005364 Bacteria 2029
15 Ga0070688_100064932 3300005365 Bacteria 2318
16 Ga0070667_100188614 3300005367 Bacteria 1826
17 Ga0070714_100156312 3300005435 Bacteria 2059
18 Ga0070713_100021485 3300005436 Bacteria 4967
19 Ga0070705_100000090 3300005440 Bacteria 50516
20 Ga0070700_100000660 3300005441 Bacteria 17043
21 Ga0070694_100000122 3300005444 Bacteria 38260
22 Ga0070708_100000493 3300005445 Bacteria 29763
23 Ga0070681_10001817 3300005458 Bacteria 19214
24 Ga0070681_10057740 3300005458 Bacteria 3861
25 Ga0068867_100001566 3300005459 Bacteria 15884
26 Ga0070706_100020115 3300005467 Bacteria 6151
27 Ga0070707_100008783 3300005468 Bacteria 9373
28 Ga0070698_100010188 3300005471 Bacteria 10043
29 Ga0070679_100019308 3300005530 Bacteria 6624
30 Ga0070686_100000292 3300005544 Bacteria 33649
31 Ga0070686_100119027 3300005544 Bacteria 1811
32 Ga0070695_100000095 3300005545 Bacteria 37826
33 Ga0070695_100004831 3300005545 Bacteria 7933
34 Ga0070695_100015093 3300005545 Bacteria 4662
35 Ga0070695_100102721 3300005545 Bacteria 1928
36 Ga0070696_100000133 3300005546 Bacteria 40142
37 Ga0070693_100000075 3300005547 Bacteria 41068
38 Ga0070704_100000230 3300005549 Bacteria 23696
39 Ga0068855_100001022 3300005563 Bacteria 34876
40 Ga0068854_100002816 3300005578 Bacteria 10816
41 Ga0068856_100007808 3300005614 Bacteria 10446
42 Ga0068856_100434536 3300005614 Bacteria 1333
43 Ga0070702_100000043 3300005615 Bacteria 34094
44 Ga0068852_100078376 3300005616 Bacteria 2923
45 Ga0068859_100001771 3300005617 Bacteria 21966
46 Ga0068859_100056674 3300005617 Bacteria 3945
47 Ga0068864_100067934 3300005618 Bacteria 3096
48 Ga0068864_100397047 3300005618 Bacteria 1310
49 Ga0068866_10000104 3300005718 Bacteria 36131
50 Ga0068861_100000193 3300005719 Bacteria 32735
51 Ga0068863_100211433 3300005841 Bacteria 1868
52 Ga0068863_100250242 3300005841 Bacteria 1712
53 Ga0068858_100001082 3300005842 Bacteria 28191
54 Ga0068858_100090730 3300005842 Bacteria 2844
55 Ga0068858_100102756 3300005842 Bacteria 2666
56 Ga0068860_100002214 3300005843 Bacteria 20454
57 Ga0068862_100001697 3300005844 Bacteria 19969
58 Ga0075363_100018844 3300006048 Bacteria 3443
59 Ga0075364_10031765 3300006051 Bacteria 3392
60 Ga0075364_10089167 3300006051 Bacteria 2045
61 Ga0075362_10009342 3300006177 Bacteria 3789
62 Ga0075366_10004233 3300006195 Bacteria 7690
63 Ga0097621_100000248 3300006237 Bacteria 36293
64 Ga0097621_100168839 3300006237 Bacteria 1885
65 Ga0068871_100000205 3300006358 Bacteria 40986
66 Ga0075428_100001683 3300006844 Bacteria 23566
67 Ga0075428_100010161 3300006844 Bacteria 10453
68 Ga0075428_100209627 3300006844 Bacteria 2106
69 Ga0075430_100007707 3300006846 Bacteria 9094
70 Ga0075431_100000058 3300006847 Bacteria 61801
71 Ga0075431_100043426 3300006847 Bacteria 4639
72 Ga0075431_100084799 3300006847 Bacteria 3270
73 Ga0075434_100024236 3300006871 Bacteria 5931
74 Ga0075429_100001141 3300006880 Bacteria 21427
75 Ga0075429_100006604 3300006880 Bacteria 10047
76 Ga0075429_100034093 3300006880 Bacteria 4423
77 Ga0075429_100090897 3300006880 Bacteria 2663
78 Ga0068865_100000833 3300006881 Bacteria 17410
79 Ga0068865_100034510 3300006881 Bacteria 3395
80 Ga0097620_100001771 3300006931 Bacteria 21966
81 Ga0097620_100056673 3300006931 Bacteria 3945
82 Ga0075435_100041692 3300007076 Bacteria 3670
83 Ga0111539_10004981 3300009094 Bacteria 17278
84 Ga0111539_10008784 3300009094 Bacteria 12812
85 Ga0111539_10258460 3300009094 Bacteria 2027
86 Ga0105245_10000478 3300009098 Bacteria 36680
87 Ga0105245_10076726 3300009098 Bacteria 3045
88 Ga0105247_10041537 3300009101 Bacteria 2815
89 Ga0114129_10000046 3300009147 Bacteria 105492
90 Ga0114129_10054696 3300009147 Bacteria 5595
91 Ga0114129_10061963 3300009147 Bacteria 5227
92 Ga0105243_10000413 3300009148 Bacteria 44895
93 Ga0105241_10026014 3300009174 Bacteria 4353
94 Ga0105241_10068883 3300009174 Bacteria 2742
95 Ga0105242_10000394 3300009176 Bacteria 34588
96 Ga0105248_10065191 3300009177 Bacteria 4090
97 Ga0105249_10002974 3300009553 Bacteria 14613
98 Ga0105249_10250142 3300009553 Bacteria 1757
99 Ga0105239_10035354 3300010375 Bacteria 5487
100 Ga0105246_10023615 3300011119 Bacteria 3981
101 Ga0157371_10163720 3300013102 Bacteria 1588
102 Ga0157378_10000543 3300013297 Bacteria 35895
103 Ga0163162_10134687 3300013306 Bacteria 2581
104 Ga0163163_10226374 3300014325 Bacteria 1919
105 Ga0157380_10094858 3300014326 Bacteria 2470
106 Ga0157379_10051314 3300014968 Bacteria 3684
107 Ga0157379_10241760 3300014968 Bacteria 1637
108 Ga0157376_10019994 3300014969 Bacteria 5171
109 Ga0183361_10004 3300016635 Bacteria 484183
110 Ga0213875_10001724 3300021388 Bacteria 13716
111 Ga0207653_10031821 3300025885 Bacteria 1705
112 Ga0207642_10005973 3300025899 Bacteria 4016
113 Ga0207645_10041379 3300025907 Bacteria 2950
114 Ga0207643_10060397 3300025908 Bacteria 2164
115 Ga0207684_10019530 3300025910 Bacteria 5796
116 Ga0207654_10012917 3300025911 Bacteria 4284
117 Ga0207707_10012386 3300025912 Bacteria 7412
118 Ga0207660_10001853 3300025917 Bacteria 14083
119 Ga0207660_10182946 3300025917 Bacteria 1628
120 Ga0207662_10000113 3300025918 Bacteria 38841
121 Ga0207662_10050704 3300025918 Bacteria 2467
122 Ga0207652_10010553 3300025921 Bacteria 7435
123 Ga0207650_10008705 3300025925 Bacteria 6928
124 Ga0207687_10000273 3300025927 Bacteria 35393
125 Ga0207644_10001532 3300025931 Bacteria 14889
126 Ga0207644_10058032 3300025931 Bacteria 2796
127 Ga0207644_10129089 3300025931 Bacteria 1933
128 Ga0207686_10000675 3300025934 Bacteria 21125
129 Ga0207709_10001300 3300025935 Bacteria 17789
130 Ga0207670_10000407 3300025936 Bacteria 24598
131 Ga0207670_10105707 3300025936 Bacteria 2018
132 Ga0207704_10000625 3300025938 Bacteria 15619
133 Ga0207665_10115762 3300025939 Bacteria 1889
134 Ga0207691_10150710 3300025940 Bacteria 2045
135 Ga0207689_10000554 3300025942 Bacteria 35670
136 Ga0207689_10016206 3300025942 Bacteria 6312
137 Ga0207667_10005883 3300025949 Bacteria 14937
138 Ga0207651_10165245 3300025960 Bacteria 1739
139 Ga0207640_10001066 3300025981 Bacteria 15195
140 Ga0207677_10000391 3300026023 Bacteria 30176
141 Ga0207703_10008177 3300026035 Bacteria 8265
142 Ga0207703_10115990 3300026035 Bacteria 2292
143 Ga0207708_10000505 3300026075 Bacteria 30021
144 Ga0207702_10020045 3300026078 Bacteria 5542
145 Ga0207702_10230451 3300026078 Bacteria 1731
146 Ga0207641_10144898 3300026088 Bacteria 2147
147 Ga0207648_10000548 3300026089 Bacteria 42037
148 Ga0207674_10019697 3300026116 Bacteria 7304
149 Ga0207675_100000305 3300026118 Bacteria 47105
150 Ga0207675_100073307 3300026118 Bacteria 3203
151 Ga0207698_10057751 3300026142 Bacteria 3004
152 Ga0207428_10004515 3300027907 Bacteria 13203
153 Ga0268265_10001208 3300028380 Bacteria 22438
154 Ga0268264_10000882 3300028381 Bacteria 31650
155 Ga0316575_10008137 3300031665 Bacteria 3812
156 Ga0373938_0002276 3300034957 Bacteria 3085
157 Ga0373934_0011141 3300035086 Bacteria 3384
158 Ga0373939_0006145 3300035114 Bacteria 2887
159 Ga0373939_0020826 3300035114 Bacteria 1787
160 Ga0373954_0000012 3300035118 Bacteria 73616
161 Ga0373956_0009241 3300035119 Bacteria 4002
162 Ga0373955_0018676 3300035172 Bacteria 3453
163 Ga0373955_0067549 3300035172 Bacteria 1990
164 Ga0316574_0001852 3300035398 Bacteria 10312
165 Ga0373924_0039114 3300035410 Bacteria 1937
166 Ga0373931_0001976 3300035691 Bacteria 9024
167 Ga0373931_0007271 3300035691 Bacteria 5210
168 Ga0373931_0014631 3300035691 Bacteria 3838
169 Ga0373933_0001612 3300035724 Bacteria 13194
170 Ga0373937_0001052 3300036401 Bacteria 23314
171 Ga0373937_0001834 3300036401 Bacteria 17852
172 Ga0373925_0030008 3300037068 Bacteria 3989
173 Ga0373925_0172567 3300037068 Bacteria 1708
174 Ga0395900_0089010 3300037418 Bacteria 3174
175 Ga0395905_0020466 3300037471 Bacteria 6268
176 Ga0436364_1276734 3300037853 Bacteria 28890
177 Ga0395901_0306095 3300038443 Bacteria 1647
178 Ga0439441_000696 3300042001 Bacteria 3877
179 Ga0439435_0000065 3300042436 Bacteria 12662
180 Ga0439435_0004538 3300042436 Bacteria 3001
181 Ga0439444_0000652 3300042437 Bacteria 4025
182 Ga0451577_0044483 3300042876 Bacteria 3975
183 Ga0451576_0006531 3300045051 Bacteria 14270
184 Ga0466967_0049233 3300045976 Bacteria 3684
185 Ga0495592_0024367 3300046454 Bacteria 4601
186 Ga0495629_0004234 3300046459 Bacteria 10755
187 Ga0495629_0016192 3300046459 Bacteria 5352
188 Ga0495629_0062091 3300046459 Bacteria 2611
189 Ga0495651_0000606 3300046462 Bacteria 27884
190 Ga0495653_0002673 3300046463 Bacteria 14197
191 Ga0495650_0000785 3300046471 Bacteria 38956
192 Ga0495650_0024992 3300046471 Bacteria 2810
193 Ga0495580_0005139 3300046472 Bacteria 10884
194 Ga0495580_0008112 3300046472 Bacteria 8376
195 Ga0495582_0052881 3300046473 Bacteria 2240
196 Ga0495662_0004035 3300046476 Bacteria 7394
197 Ga0495607_0031295 3300046501 Bacteria 3258
198 Ga0495608_0000591 3300046511 Bacteria 24964
199 Ga0495610_0000131 3300046512 Bacteria 82558
200 Ga0495618_0001466 3300046514 Bacteria 15809
201 Ga0495628_0006762 3300046516 Bacteria 9984
202 Ga0495628_0034908 3300046516 Bacteria 4043
203 Ga0495628_0091275 3300046516 Bacteria 2357
204 Ga0495630_0082783 3300046517 Bacteria 2422
205 Ga0495637_0021547 3300046520 Bacteria 2954
206 Ga0495643_0008467 3300046522 Bacteria 6508
207 Ga0495644_0054212 3300046523 Bacteria 1506
208 Ga0495652_0003497 3300046529 Bacteria 15467
209 Ga0495652_0074599 3300046529 Bacteria 2820
210 Ga0495665_0000077 3300046531 Bacteria 42404
211 Ga0495665_0048689 3300046531 Bacteria 2247
212 Ga0495640_0002454 3300046533 Bacteria 14898
213 Ga0495640_0014998 3300046533 Bacteria 5843
214 Ga0495645_0001808 3300046543 Bacteria 14530
215 Ga0495645_0052095 3300046543 Bacteria 2978
216 Ga0495667_0005199 3300046559 Bacteria 8796
217 Ga0495667_0055140 3300046559 Bacteria 2614
218 Ga0495656_0041167 3300046615 Bacteria 1929
219 Ga0495634_0002842 3300046642 Bacteria 14216
220 Ga0495635_0003751 3300046663 Bacteria 10547
221 Ga0495635_0007363 3300046663 Bacteria 7679
222 Ga0495588_0010874 3300046674 Bacteria 4253
223 Ga0495657_0003270 3300046675 Bacteria 13307
224 Ga0495599_0000564 3300046678 Bacteria 21162
225 Ga0495599_0040896 3300046678 Bacteria 2911
226 Ga0495623_0001431 3300046679 Bacteria 16178
227 Ga0495646_0004951 3300046680 Bacteria 8412
228 Ga0495658_0047841 3300046683 Bacteria 2410
229 Ga0495613_0024361 3300046689 Bacteria 4510
230 Ga0495613_0194635 3300046689 Bacteria 1432
231 Ga0495624_0012093 3300046690 Bacteria 5910
232 Ga0495670_0045100 3300046691 Bacteria 2201
233 Ga0495671_0014316 3300046692 Bacteria 4272
234 Ga0495649_0000551 3300046694 Bacteria 31839
235 Ga0495600_0004060 3300046809 Bacteria 8704
236 Ga0495600_0023305 3300046809 Bacteria 3982
237 Ga0495600_0161130 3300046809 Bacteria 1450
238 Ga0495581_0012527 3300047315 Bacteria 4913
239 Ga0495581_0025911 3300047315 Bacteria 3401
240 Ga0495604_0003818 3300047317 Bacteria 11995
241 Ga0495674_0024339 3300047319 Bacteria 5564
242 Ga0495674_0050144 3300047319 Bacteria 3684
243 Ga0495674_0054209 3300047319 Bacteria 3522
244 Ga0495674_0071071 3300047319 Bacteria 3006
245 Ga0495674_0095185 3300047319 Bacteria 2539
246 Ga0495676_0021794 3300047321 Bacteria 5588
247 Ga0495680_0001686 3300047322 Bacteria 23465
248 Ga0495680_0014417 3300047322 Bacteria 6843
249 Ga0495683_0000006 3300047323 Bacteria 272409
250 Ga0495683_0003703 3300047323 Bacteria 8851
251 Ga0495675_0043639 3300047444 Bacteria 2857
252 Ga0495675_0065342 3300047444 Bacteria 2301
253 Ga0495685_020159 3300047447 Bacteria 2291
254 Ga0495593_0004402 3300047673 Bacteria 8371
255 Ga0495593_0024841 3300047673 Bacteria 3317
256 Ga0495593_0053690 3300047673 Bacteria 2126
257 Ga0495593_0073890 3300047673 Bacteria 1768
258 Ga0495602_0010055 3300048088 Bacteria 9820
259 Ga0495602_0040592 3300048088 Bacteria 4263
260 Ga0495602_0097910 3300048088 Bacteria 2415
261 Ga0496100_0009694 3300048903 Bacteria 5418
262 Ga0496101_0002442 3300048904 Bacteria 11422
263 Ga0496102_0062873 3300048905 Bacteria 3399
264 Ga0496104_0008622 3300048907 Bacteria 9068
265 Ga0496104_0079951 3300048907 Bacteria 3116
266 Ga0496105_0044828 3300048908 Bacteria 3648
267 Ga0496105_0077166 3300048908 Bacteria 2751
268 Ga0496107_0047044 3300048910 Bacteria 3106
269 Ga0496108_0127260 3300048911 Bacteria 2188
270 Ga0496109_0139007 3300048912 Bacteria 2271
271 Ga0496109_0139796 3300048912 Bacteria 2264
272 Ga0496110_0044999 3300048913 Bacteria 3856
273 Ga0496110_0146253 3300048913 Bacteria 2138
274 Ga0496111_0163262 3300048914 Bacteria 1654
275 Ga0496112_0004419 3300048915 Bacteria 11904
276 Ga0496112_0206396 3300048915 Bacteria 1923
277 Ga0496113_0091255 3300048916 Bacteria 2348
278 Ga0496114_0022087 3300048917 Bacteria 5182
279 Ga0496115_0011356 3300048918 Bacteria 6677
280 Ga0496115_0034259 3300048918 Bacteria 4013
281 Ga0496122_0074114 3300048925 Bacteria 2410
282 Ga0496124_0000007 3300048927 Bacteria 883534
283 Ga0495682_0011313 3300049460 Bacteria 3435
284 Ga0501038_0095721 3300049574 Bacteria 2480
285 Ga0501040_0051481 3300049576 Bacteria 2817
286 Ga0501042_0123418 3300049578 Bacteria 1865
287 Ga0501048_0081507 3300049582 Bacteria 2283
288 Ga0501071_0081837 3300049587 Bacteria 2363
289 Ga0501071_0245451 3300049587 Bacteria 1351
290 Ga0501072_0042564 3300049588 Bacteria 3567
291 Ga0501072_0086110 3300049588 Bacteria 2493
292 Ga0501075_0096495 3300049591 Bacteria 2243
293 Ga0501076_0079935 3300049592 Bacteria 2624
294 Ga0501076_0114755 3300049592 Bacteria 2180
295 Ga0501083_0142388 3300049744 Bacteria 1570
296 nmdc:mga03683_18801_c1 3300050489 Bacteria 2632
297 nmdc:mga00v17_19188_c1 3300050491 Bacteria 3899
298 nmdc:mga00v17_33871_c1 3300050491 Bacteria 3030
299 nmdc:mga0yw44_12866_c1 3300050492 Bacteria 4380
300 nmdc:mga0k408_3477_c1 3300050493 Bacteria 8336
301 nmdc:mga05p37_11597_c1 3300050507 Bacteria 10502
302 nmdc:mga05p37_138_c1 3300050507 Bacteria 67838
303 nmdc:mga05p37_142285_c1 3300050507 Bacteria 2938
304 nmdc:mga05p37_52813_c1 3300050507 Bacteria 3681
305 nmdc:mga09592_1011_c1 3300050508 Bacteria 22343
306 nmdc:mga09592_20304_c1 3300050508 Bacteria 5461
307 nmdc:mga09592_36309_c1 3300050508 Bacteria 4127
308 nmdc:mga09592_62227_c1 3300050508 Bacteria 3157
309 nmdc:mga0qj67_2622_c1 3300050509 Bacteria 12887
310 nmdc:mga0qj67_376942_c1 3300050509 Bacteria 1146
311 nmdc:mga0qj67_40280_c1 3300050509 Bacteria 3672
312 nmdc:mga0qj67_49473_c1 3300050509 Bacteria 3323
313 nmdc:mga06r32_15_c1 3300050510 Bacteria 106010
314 nmdc:mga06r32_16443_c1 3300050510 Bacteria 6744
315 nmdc:mga06r32_187753_c1 3300050510 Bacteria 2054
316 nmdc:mga06r32_215214_c1 3300050510 Bacteria 1909
317 nmdc:mga06r32_51926_c1 3300050510 Bacteria 2557
318 nmdc:mga06r32_62949_c1 3300050510 Bacteria 3574
319 nmdc:mga06r32_94547_c1 3300050510 Bacteria 2924
320 nmdc:mga08y16_91_c2 3300050511 Bacteria 43815
321 nmdc:mga0n895_6010_c1 3300050512 Bacteria 10226
322 nmdc:mga0rr50_7181_c1 3300050513 Bacteria 6843
323 Ga0495601_0062379 3300053077 Bacteria 2367
324 Ga0495612_0005722 3300053078 Bacteria 5133
325 Ga0495595_0000552 3300053084 Bacteria 14281
326 Ga0495619_0002169 3300053085 Bacteria 13003
327 Ga0500618_001134 3300053125 Bacteria 12907
328 Ga0501084_0318694 3300054114 Bacteria 1313
329 Ga0530510_0063773 3300061734 Bacteria 2668
330 2599106671 2597490356 Bacteria 7030811
331 2723878093 2721755763 Bacteria 4464185
332 2792832534 2791355137 Bacteria 9654227
333 2842334120 2842333319 Bacteria 8899485
334 2846958305 2846952575 Bacteria 6587527
335 2848864782 2848858292 Bacteria 7391279
336 2857543738 2857542790 Bacteria 5326616
337 2879086454 2879083081 Bacteria 8587928
338 2883088614 2883087390 Bacteria 9532701
339 2904623121 2904615490 Bacteria 10047340
340 Ga0070690_100000321
341 Ga0068869_100000861
342 Ga0068869_100068592
343 Ga0070680_100000425
344 Ga0070682_100004549
345 Ga0068868_100000641
346 Ga0070689_100000304
347 Ga0070689_100024542
348 Ga0070689_100083403
349 Ga0070687_100000066
350 Ga0070671_100009995
351 Ga0070671_100076683
352 Ga0070673_100073225
353 Ga0070673_100141542
354 Ga0070688_100064932
355 Ga0070667_100188614
356 Ga0070714_100156312
357 Ga0070713_100021485
358 Ga0070705_100000090
359 Ga0070700_100000660
360 Ga0070694_100000122
361 Ga0070708_100000493
362 Ga0070681_10001817
363 Ga0070681_10057740
364 Ga0068867_100001566
365 Ga0070706_100020115
366 Ga0070707_100008783
367 Ga0070698_100010188
368 Ga0070679_100019308
369 Ga0070686_100000292
370 Ga0070686_100119027
371 Ga0070695_100000095
372 Ga0070695_100004831
373 Ga0070695_100015093
374 Ga0070695_100102721
375 Ga0070696_100000133
376 Ga0070693_100000075
377 Ga0070704_100000230
378 Ga0068855_100001022
379 Ga0068854_100002816
380 Ga0068856_100007808
381 Ga0068856_100434536
382 Ga0070702_100000043
383 Ga0068852_100078376
384 Ga0068859_100001771
385 Ga0068859_100056674
386 Ga0068864_100067934
387 Ga0068864_100397047
388 Ga0068866_10000104
389 Ga0068861_100000193
390 Ga0068863_100211433
391 Ga0068863_100250242
392 Ga0068858_100001082
393 Ga0068858_100090730
394 Ga0068858_100102756
395 Ga0068860_100002214
396 Ga0068862_100001697
397 Ga0075363_100018844
398 Ga0075364_10031765
399 Ga0075364_10089167
400 Ga0075362_10009342
401 Ga0075366_10004233
402 Ga0097621_100000248
403 Ga0097621_100168839
404 Ga0068871_100000205
405 Ga0075428_100001683
406 Ga0075428_100010161
407 Ga0075428_100209627
408 Ga0075430_100007707
409 Ga0075431_100000058
410 Ga0075431_100043426
411 Ga0075431_100084799
412 Ga0075434_100024236
413 Ga0075429_100001141
414 Ga0075429_100006604
415 Ga0075429_100034093
416 Ga0075429_100090897
417 Ga0068865_100000833
418 Ga0068865_100034510
419 Ga0097620_100001771
420 Ga0097620_100056673
421 Ga0075435_100041692
422 Ga0111539_10004981
423 Ga0111539_10008784
424 Ga0111539_10258460
425 Ga0105245_10000478
426 Ga0105245_10076726
427 Ga0105247_10041537
428 Ga0114129_10000046
429 Ga0114129_10054696
430 Ga0114129_10061963
431 Ga0105243_10000413
432 Ga0105241_10026014
433 Ga0105241_10068883
434 Ga0105242_10000394
435 Ga0105248_10065191
436 Ga0105249_10002974
437 Ga0105249_10250142
438 Ga0105239_10035354
439 Ga0105246_10023615
440 Ga0157371_10163720
441 Ga0157378_10000543
442 Ga0163162_10134687
443 Ga0163163_10226374
444 Ga0157380_10094858
445 Ga0157379_10051314
446 Ga0157379_10241760
447 Ga0157376_10019994
448 Ga0183361_10004
449 Ga0213875_10001724
450 Ga0207653_10031821
451 Ga0207642_10005973
452 Ga0207645_10041379
453 Ga0207643_10060397
454 Ga0207684_10019530
455 Ga0207654_10012917
456 Ga0207707_10012386
457 Ga0207660_10001853
458 Ga0207660_10182946
459 Ga0207662_10000113
460 Ga0207662_10050704
461 Ga0207652_10010553
462 Ga0207650_10008705
463 Ga0207687_10000273
464 Ga0207644_10001532
465 Ga0207644_10058032
466 Ga0207644_10129089
467 Ga0207686_10000675
468 Ga0207709_10001300
469 Ga0207670_10000407
470 Ga0207670_10105707
471 Ga0207704_10000625
472 Ga0207665_10115762
473 Ga0207691_10150710
474 Ga0207689_10000554
475 Ga0207689_10016206
476 Ga0207667_10005883
477 Ga0207651_10165245
478 Ga0207640_10001066
479 Ga0207677_10000391
480 Ga0207703_10008177
481 Ga0207703_10115990
482 Ga0207708_10000505
483 Ga0207702_10020045
484 Ga0207702_10230451
485 Ga0207641_10144898
486 Ga0207648_10000548
487 Ga0207674_10019697
488 Ga0207675_100000305
489 Ga0207675_100073307
490 Ga0207698_10057751
491 Ga0207428_10004515
492 Ga0268265_10001208
493 Ga0268264_10000882
494 Ga0316575_10008137
495 Ga0373938_0002276
496 Ga0373934_0011141
497 Ga0373939_0006145
498 Ga0373939_0020826
499 Ga0373954_0000012
500 Ga0373956_0009241
501 Ga0373955_0018676
502 Ga0373955_0067549
503 Ga0316574_0001852
504 Ga0373924_0039114
505 Ga0373931_0001976
506 Ga0373931_0007271
507 Ga0373931_0014631
508 Ga0373933_0001612
509 Ga0373937_0001052
510 Ga0373937_0001834
511 Ga0373925_0030008
512 Ga0373925_0172567
513 Ga0395900_0089010
514 Ga0395905_0020466
515 Ga0436364_1276734
516 Ga0395901_0306095
517 Ga0439441_000696
518 Ga0439435_0000065
519 Ga0439435_0004538
520 Ga0439444_0000652
521 Ga0451577_0044483
522 Ga0451576_0006531
523 Ga0466967_0049233
524 Ga0495592_0024367
525 Ga0495629_0004234
526 Ga0495629_0016192
527 Ga0495629_0062091
528 Ga0495651_0000606
529 Ga0495653_0002673
530 Ga0495650_0000785
531 Ga0495650_0024992
532 Ga0495580_0005139
533 Ga0495580_0008112
534 Ga0495582_0052881
535 Ga0495662_0004035
536 Ga0495607_0031295
537 Ga0495608_0000591
538 Ga0495610_0000131
539 Ga0495618_0001466
540 Ga0495628_0006762
541 Ga0495628_0034908
542 Ga0495628_0091275
543 Ga0495630_0082783
544 Ga0495637_0021547
545 Ga0495643_0008467
546 Ga0495644_0054212
547 Ga0495652_0003497
548 Ga0495652_0074599
549 Ga0495665_0000077
550 Ga0495665_0048689
551 Ga0495640_0002454
552 Ga0495640_0014998
553 Ga0495645_0001808
554 Ga0495645_0052095
555 Ga0495667_0005199
556 Ga0495667_0055140
557 Ga0495656_0041167
558 Ga0495634_0002842
559 Ga0495635_0003751
560 Ga0495635_0007363
561 Ga0495588_0010874
562 Ga0495657_0003270
563 Ga0495599_0000564
564 Ga0495599_0040896
565 Ga0495623_0001431
566 Ga0495646_0004951
567 Ga0495658_0047841
568 Ga0495613_0024361
569 Ga0495613_0194635
570 Ga0495624_0012093
571 Ga0495670_0045100
572 Ga0495671_0014316
573 Ga0495649_0000551
574 Ga0495600_0004060
575 Ga0495600_0023305
576 Ga0495600_0161130
577 Ga0495581_0012527
578 Ga0495581_0025911
579 Ga0495604_0003818
580 Ga0495674_0024339
581 Ga0495674_0050144
582 Ga0495674_0054209
583 Ga0495674_0071071
584 Ga0495674_0095185
585 Ga0495676_0021794
586 Ga0495680_0001686
587 Ga0495680_0014417
588 Ga0495683_0000006
589 Ga0495683_0003703
590 Ga0495675_0043639
591 Ga0495675_0065342
592 Ga0495685_020159
593 Ga0495593_0004402
594 Ga0495593_0024841
595 Ga0495593_0053690
596 Ga0495593_0073890
597 Ga0495602_0010055
598 Ga0495602_0040592
599 Ga0495602_0097910
600 Ga0496100_0009694
601 Ga0496101_0002442
602 Ga0496102_0062873
603 Ga0496104_0008622
604 Ga0496104_0079951
605 Ga0496105_0044828
606 Ga0496105_0077166
607 Ga0496107_0047044
608 Ga0496108_0127260
609 Ga0496109_0139007
610 Ga0496109_0139796
611 Ga0496110_0044999
612 Ga0496110_0146253
613 Ga0496111_0163262
614 Ga0496112_0004419
615 Ga0496112_0206396
616 Ga0496113_0091255
617 Ga0496114_0022087
618 Ga0496115_0011356
619 Ga0496115_0034259
620 Ga0496122_0074114
621 Ga0496124_0000007
622 Ga0495682_0011313
623 Ga0501038_0095721
624 Ga0501040_0051481
625 Ga0501042_0123418
626 Ga0501048_0081507
627 Ga0501071_0081837
628 Ga0501071_0245451
629 Ga0501072_0042564
630 Ga0501072_0086110
631 Ga0501075_0096495
632 Ga0501076_0079935
633 Ga0501076_0114755
634 Ga0501083_0142388
635 nmdc:mga03683_18801_c1
636 nmdc:mga00v17_19188_c1
637 nmdc:mga00v17_33871_c1
638 nmdc:mga0yw44_12866_c1
639 nmdc:mga0k408_3477_c1
640 nmdc:mga05p37_11597_c1
641 nmdc:mga05p37_138_c1
642 nmdc:mga05p37_142285_c1
643 nmdc:mga05p37_52813_c1
644 nmdc:mga09592_1011_c1
645 nmdc:mga09592_20304_c1
646 nmdc:mga09592_36309_c1
647 nmdc:mga09592_62227_c1
648 nmdc:mga0qj67_2622_c1
649 nmdc:mga0qj67_376942_c1
650 nmdc:mga0qj67_40280_c1
651 nmdc:mga0qj67_49473_c1
652 nmdc:mga06r32_15_c1
653 nmdc:mga06r32_16443_c1
654 nmdc:mga06r32_187753_c1
655 nmdc:mga06r32_215214_c1
656 nmdc:mga06r32_51926_c1
657 nmdc:mga06r32_62949_c1
658 nmdc:mga06r32_94547_c1
659 nmdc:mga08y16_91_c2
660 nmdc:mga0n895_6010_c1
661 nmdc:mga0rr50_7181_c1
662 Ga0495601_0062379
663 Ga0495612_0005722
664 Ga0495595_0000552
665 Ga0495619_0002169
666 Ga0500618_001134
667 Ga0501084_0318694
668 Ga0530510_0063773
669 2599106671
670 2723878093
671 2792832534
672 2842334120
673 2846958305
674 2848864782
675 2857543738
676 2879086454
677 2883088614
678 2904623121

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

11

379

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6j39-assembly1.cif.gz_A crystal structure of cmis2 with inhibitor 0.7668 14 43
6j38-assembly1.cif.gz_B-2 crystal structure of cmis2 0.7634 14 43
3nrn-assembly1.cif.gz_A crystal structure of pf1083 protein from pyrococcus furiosus, northeast structural genomics consortium target pfr223 0.7177 14 44
2q7x-assembly1.cif.gz_B crystal structure of a putative phospho transferase (sp_1565) from streptococcus pneumoniae tigr4 at 2.00 a resolution 0.6994 14 44
1ijh-assembly1.cif.gz_A cholesterol oxidase from streptomyces asn485leu mutant 0.6843 14 43
ID Description Score Start End Superfamily
4ed9A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9217 8 234 3.40.50.10540
af_Q4V9F2_1_227_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.9098 31 245 3.40.50.10540
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8879 238 322 3.30.1540.10
1x74D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8835 14 203 3.40.50.10540
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.8807 238 325 3.30.1540.10
ID Description Score Start End GO Terms
AF-A0A355S0Y2-F1-model_v4 CoA transferase 0.9476 6 196 GO:0008410
AF-A0A382RFY1-F1-model_v4 Carnitine dehydratase 0.9459 11 228 GO:0008410
AF-A0A316PNQ3-F1-model_v4 CoA transferase 0.9456 8 148 GO:0008410
AF-W7WZJ6-F1-model_v4 deleted 0.9447 11 183
AF-A0A355S0Y2-F1-model_v4 CoA transferase 0.9428 6 196 GO:0008410

Map