F413855

General Info

Members Datasets Scaffolds Average Seq Length
339 190 339 416

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1000111|Ga0081540_100011117
Length 478
Sequence MNGISFARIKQATNSDVFTPRTPPPMHQTVSTPAXXXLTVKQRRARRKKQIFYGLIALVVLWIVGSIIWGKREKPIPVTTETAIRKTIVQTVSATGKIQPEVEVKISPEVAGEIIELPVEDGMRVKKGDLLVKIKPDSYKALLEQQEAAISAAKATNLQQKATMMKTEHDLKRAEDLFNKKLISEQEYNAGQAAYDVAKNTYESSLHEIERAEASSSQARDQLSKTTIYSPLDGTITILNSKLGERLVATGQFAGTEVMRVADLTHMQAIVDVNENDVVNVKLGDKASVKIDAYGDRKFKGVVQQIANTGKTTGAGTQEEVTNFEVKIRIDDHDVSLRPALSCTADIQTNEVKDAVAVPMQAVTIRTGESNLSPEEIEKKKQKVTQRDKGDNNAEFVDGRAEKAAQKEEREKLAKVVFLKKGGKAEMVKVTTGISDDTYTEIKSGIQPGAEVISGSYSAISRKLKEGAKVTLDKEGMK

Samples

Sample ID Description Type Environment
1 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
2 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
3 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
138 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
139 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
163 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
189 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
190 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.65
Rhizosphere 94.69
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000022 3300000545 Bacteria 32122
2 JGI24035J26624_1000744 3300002126 Bacteria 3049
3 Ga0065703_1020349 3300005272 Unclassified 1848
4 Ga0065704_10009537 3300005289 Unclassified 2741
5 Ga0065712_10007182 3300005290 Bacteria 3618
6 Ga0065712_10102235 3300005290 Bacteria 2009
7 Ga0065715_10002825 3300005293 Bacteria 5904
8 Ga0065715_10091779 3300005293 Bacteria 5558
9 Ga0065715_10092183 3300005293 Bacteria 5278
10 Ga0065715_10108090 3300005293 Unclassified 2732
11 Ga0065707_10124266 3300005295 Bacteria 2044
12 Ga0070658_10156424 3300005327 Unclassified 1911
13 Ga0070676_10005723 3300005328 Bacteria 6624
14 Ga0070676_10054388 3300005328 Bacteria 2360
15 Ga0070683_100000044 3300005329 Bacteria 102122
16 Ga0070683_100148993 3300005329 Unclassified 2218
17 Ga0070690_100013449 3300005330 Bacteria 4836
18 Ga0070670_100001232 3300005331 Bacteria 20355
19 Ga0070670_100031913 3300005331 Bacteria 4535
20 Ga0070670_100062417 3300005331 Bacteria 3199
21 Ga0070680_100251376 3300005336 Bacteria 1494
22 Ga0068868_100000142 3300005338 Bacteria 46351
23 Ga0068868_100001479 3300005338 Bacteria 16205
24 Ga0068868_100072215 3300005338 Bacteria 2753
25 Ga0070689_100000260 3300005340 Bacteria 30408
26 Ga0070689_100023735 3300005340 Bacteria 4596
27 Ga0070689_100036173 3300005340 Bacteria 3776
28 Ga0070689_100097361 3300005340 Bacteria 2326
29 Ga0070687_100002227 3300005343 Bacteria 7190
30 Ga0070668_100007088 3300005347 Bacteria 8304
31 Ga0070669_100011294 3300005353 Bacteria 6341
32 Ga0070675_100003374 3300005354 Bacteria 12098
33 Ga0070675_100042853 3300005354 Unclassified 3698
34 Ga0070671_100019906 3300005355 Bacteria 5467
35 Ga0070671_100083016 3300005355 Bacteria 2679
36 Ga0070671_100154077 3300005355 Bacteria 1941
37 Ga0070674_100026325 3300005356 Bacteria 3797
38 Ga0070673_100036483 3300005364 Bacteria 3737
39 Ga0070667_100004159 3300005367 Bacteria 12231
40 Ga0070667_100132137 3300005367 Unclassified 2180
41 Ga0070714_100059262 3300005435 Bacteria 3282
42 Ga0070713_100033556 3300005436 Bacteria 4113
43 Ga0070701_10000989 3300005438 Bacteria 10311
44 Ga0070711_100002697 3300005439 Bacteria 10188
45 Ga0070711_100017729 3300005439 Bacteria 4536
46 Ga0070705_100032960 3300005440 Bacteria 2883
47 Ga0070700_100060343 3300005441 Bacteria 2390
48 Ga0070694_100084167 3300005444 Bacteria 2218
49 Ga0070708_100031528 3300005445 Bacteria 4589
50 Ga0070708_100031799 3300005445 Bacteria 4571
51 Ga0070708_100075157 3300005445 Bacteria 3049
52 Ga0070708_100102828 3300005445 Bacteria 2618
53 Ga0070708_100119564 3300005445 Bacteria 2429
54 Ga0070708_100163064 3300005445 Unclassified 2078
55 Ga0070708_100178298 3300005445 Bacteria 1985
56 Ga0070708_100256252 3300005445 Bacteria 1644
57 Ga0070678_100059040 3300005456 Unclassified 2818
58 Ga0070678_100070408 3300005456 Unclassified 2614
59 Ga0070662_100005938 3300005457 Bacteria 7831
60 Ga0070662_100094678 3300005457 Bacteria 2249
61 Ga0070681_10040739 3300005458 Bacteria 4653
62 Ga0070706_100000210 3300005467 Bacteria 71893
63 Ga0070706_100005046 3300005467 Bacteria 12615
64 Ga0070706_100005772 3300005467 Bacteria 11759
65 Ga0070706_100020133 3300005467 Bacteria 6149
66 Ga0070706_100023644 3300005467 Bacteria 5657
67 Ga0070706_100036810 3300005467 Bacteria 4520
68 Ga0070706_100039096 3300005467 Bacteria 4380
69 Ga0070706_100053980 3300005467 Bacteria 3710
70 Ga0070707_100000632 3300005468 Bacteria 35270
71 Ga0070707_100013638 3300005468 Bacteria 7611
72 Ga0070707_100015861 3300005468 Bacteria 7072
73 Ga0070707_100042781 3300005468 Bacteria 4337
74 Ga0070707_100153756 3300005468 Bacteria 2240
75 Ga0070698_100000633 3300005471 Bacteria 37962
76 Ga0070698_100003474 3300005471 Bacteria 17340
77 Ga0070698_100011801 3300005471 Bacteria 9270
78 Ga0070698_100029150 3300005471 Bacteria 5728
79 Ga0070698_100055617 3300005471 Unclassified 4011
80 Ga0070698_100062213 3300005471 Bacteria 3766
81 Ga0070699_100033532 3300005518 Bacteria 4436
82 Ga0070699_100165776 3300005518 Bacteria 1957
83 Ga0070684_100000032 3300005535 Bacteria 104605
84 Ga0070684_100000274 3300005535 Bacteria 35734
85 Ga0070684_100137540 3300005535 Unclassified 2207
86 Ga0070697_100005719 3300005536 Bacteria 9581
87 Ga0070697_100016601 3300005536 Bacteria 5792
88 Ga0070697_100016795 3300005536 Bacteria 5757
89 Ga0070697_100018194 3300005536 Bacteria 5538
90 Ga0070672_100145631 3300005543 Unclassified 1957
91 Ga0070686_100082401 3300005544 Unclassified 2133
92 Ga0070696_100030976 3300005546 Bacteria 3664
93 Ga0070665_100016600 3300005548 Bacteria 7380
94 Ga0070665_100048546 3300005548 Bacteria 4261
95 Ga0070665_100164534 3300005548 Bacteria 2221
96 Ga0070704_100036010 3300005549 Bacteria 3368
97 Ga0068854_100011698 3300005578 Bacteria 5724
98 Ga0068856_100254944 3300005614 Unclassified 1769
99 Ga0068859_100084804 3300005617 Bacteria 3213
100 Ga0068864_100076903 3300005618 Bacteria 2918
101 Ga0068870_10045415 3300005840 Unclassified 2300
102 Ga0068863_100033690 3300005841 Bacteria 4879
103 Ga0068858_100000297 3300005842 Bacteria 53492
104 Ga0068858_100008989 3300005842 Bacteria 9561
105 Ga0068860_100013278 3300005843 Bacteria 8081
106 Ga0068860_100109976 3300005843 Bacteria 2634
107 Ga0068862_100011679 3300005844 Bacteria 7246
108 Ga0081455_10000314 3300005937 Bacteria 63484
109 Ga0081455_10011210 3300005937 Bacteria 9020
110 Ga0081540_1000111 3300005983 Bacteria 86926
111 Ga0081540_1003110 3300005983 Bacteria 13285
112 Ga0070717_10000011 3300006028 Bacteria 233981
113 Ga0070717_10000097 3300006028 Bacteria 67987
114 Ga0070717_10002496 3300006028 Bacteria 12985
115 Ga0070717_10014821 3300006028 Bacteria 5998
116 Ga0070717_10037636 3300006028 Bacteria 3929
117 Ga0070717_10073358 3300006028 Bacteria 2860
118 Ga0070712_100002101 3300006175 Bacteria 12241
119 Ga0097621_100077149 3300006237 Bacteria 2765
120 Ga0068871_100042159 3300006358 Bacteria 3662
121 Ga0068871_100162148 3300006358 Unclassified 1913
122 Ga0075434_100117552 3300006871 Bacteria 2672
123 Ga0068865_100087523 3300006881 Bacteria 2251
124 Ga0075436_100003381 3300006914 Bacteria 10928
125 Ga0097620_100084804 3300006931 Bacteria 3213
126 Ga0075435_100000040 3300007076 Bacteria 66678
127 Ga0075435_100019674 3300007076 Bacteria 5162
128 Ga0105240_10005497 3300009093 Bacteria 18885
129 Ga0111539_10248326 3300009094 Bacteria 2072
130 Ga0105245_10000006 3300009098 Bacteria 330960
131 Ga0105245_10001270 3300009098 Bacteria 22783
132 Ga0105245_10115069 3300009098 Bacteria 2506
133 Ga0114129_10019739 3300009147 Bacteria 9592
134 Ga0105243_10008437 3300009148 Bacteria 7911
135 Ga0105241_10058856 3300009174 Bacteria 2952
136 Ga0105242_10185077 3300009176 Unclassified 1840
137 Ga0105237_10285897 3300009545 Unclassified 1652
138 Ga0105238_10000018 3300009551 Bacteria 223340
139 Ga0105249_10001798 3300009553 Bacteria 18650
140 Ga0105239_10040865 3300010375 Bacteria 5082
141 Ga0157371_10205988 3300013102 Bacteria 1411
142 Ga0157369_10000111 3300013105 Bacteria 114462
143 Ga0157374_10000005 3300013296 Bacteria 646767
144 Ga0157374_10008046 3300013296 Bacteria 9014
145 Ga0157374_10038210 3300013296 Bacteria 4411
146 Ga0157374_10056844 3300013296 Bacteria 3654
147 Ga0157374_10106402 3300013296 Bacteria 2695
148 Ga0157378_10003503 3300013297 Bacteria 13927
149 Ga0157378_10006014 3300013297 Bacteria 10630
150 Ga0157378_10007399 3300013297 Bacteria 9590
151 Ga0157378_10008415 3300013297 Bacteria 8988
152 Ga0157378_10008747 3300013297 Bacteria 8814
153 Ga0157378_10009982 3300013297 Bacteria 8279
154 Ga0157378_10077580 3300013297 Unclassified 2995
155 Ga0163162_10004883 3300013306 Bacteria 12932
156 Ga0163162_10035138 3300013306 Bacteria 4991
157 Ga0163162_10099250 3300013306 Bacteria 3002
158 Ga0163162_10152333 3300013306 Unclassified 2430
159 Ga0163162_10212857 3300013306 Bacteria 2063
160 Ga0163162_10315197 3300013306 Unclassified 1697
161 Ga0157372_10038070 3300013307 Bacteria 5307
162 Ga0157372_10329787 3300013307 Unclassified 1777
163 Ga0157372_10346825 3300013307 Bacteria 1730
164 Ga0157375_10000014 3300013308 Bacteria 319231
165 Ga0157375_10000047 3300013308 Bacteria 141526
166 Ga0157375_10000774 3300013308 Bacteria 28045
167 Ga0157375_10007640 3300013308 Bacteria 9458
168 Ga0157375_10032301 3300013308 Bacteria 4963
169 Ga0157375_10046910 3300013308 Bacteria 4215
170 Ga0157375_10128002 3300013308 Bacteria 2657
171 Ga0157377_10000001 3300014745 Bacteria 623098
172 Ga0157377_10000072 3300014745 Bacteria 78456
173 Ga0157376_10000022 3300014969 Bacteria 225272
174 Ga0213873_10000153 3300021358 Bacteria 13197
175 Ga0213876_10000386 3300021384 Bacteria 37226
176 Ga0213876_10018646 3300021384 Bacteria 3665
177 Ga0213876_10020780 3300021384 Bacteria 3471
178 Ga0213871_10003292 3300021441 Bacteria 3096
179 Ga0207666_1001647 3300025271 Unclassified 2650
180 Ga0207673_1000337 3300025290 Bacteria 4709
181 Ga0207697_10000048 3300025315 Bacteria 47739
182 Ga0207697_10000154 3300025315 Bacteria 34024
183 Ga0207697_10001046 3300025315 Bacteria 15346
184 Ga0207697_10002394 3300025315 Bacteria 9769
185 Ga0207697_10020105 3300025315 Bacteria 2734
186 Ga0207697_10023481 3300025315 Bacteria 2525
187 Ga0207653_10004871 3300025885 Bacteria 4193
188 Ga0207647_10008527 3300025904 Bacteria 7339
189 Ga0207645_10000452 3300025907 Bacteria 34086
190 Ga0207643_10016302 3300025908 Bacteria 4052
191 Ga0207705_10068808 3300025909 Bacteria 2564
192 Ga0207684_10000028 3300025910 Bacteria 306450
193 Ga0207684_10001402 3300025910 Bacteria 26187
194 Ga0207684_10010800 3300025910 Bacteria 8015
195 Ga0207684_10013890 3300025910 Bacteria 6955
196 Ga0207684_10026831 3300025910 Bacteria 4912
197 Ga0207684_10042985 3300025910 Bacteria 3831
198 Ga0207684_10113859 3300025910 Bacteria 2316
199 Ga0207684_10167123 3300025910 Unclassified 1896
200 Ga0207707_10033066 3300025912 Bacteria 4526
201 Ga0207695_10018183 3300025913 Bacteria 8133
202 Ga0207695_10057235 3300025913 Bacteria 4051
203 Ga0207693_10001024 3300025915 Bacteria 25029
204 Ga0207693_10015348 3300025915 Bacteria 6146
205 Ga0207693_10031288 3300025915 Bacteria 4204
206 Ga0207663_10033014 3300025916 Bacteria 3079
207 Ga0207663_10046166 3300025916 Bacteria 2683
208 Ga0207662_10000206 3300025918 Bacteria 27413
209 Ga0207662_10060357 3300025918 Bacteria 2274
210 Ga0207657_10056868 3300025919 Bacteria 3373
211 Ga0207657_10092018 3300025919 Bacteria 2528
212 Ga0207646_10000130 3300025922 Bacteria 101961
213 Ga0207646_10003322 3300025922 Bacteria 18296
214 Ga0207646_10011030 3300025922 Bacteria 8774
215 Ga0207646_10012823 3300025922 Bacteria 8033
216 Ga0207646_10075742 3300025922 Bacteria 3006
217 Ga0207646_10083871 3300025922 Unclassified 2850
218 Ga0207646_10129070 3300025922 Bacteria 2274
219 Ga0207681_10031032 3300025923 Bacteria 3487
220 Ga0207694_10000001 3300025924 Bacteria 4078485
221 Ga0207650_10001066 3300025925 Bacteria 20411
222 Ga0207650_10109599 3300025925 Bacteria 2135
223 Ga0207659_10024089 3300025926 Bacteria 4073
224 Ga0207659_10089410 3300025926 Bacteria 2296
225 Ga0207687_10000006 3300025927 Bacteria 641680
226 Ga0207687_10003907 3300025927 Bacteria 9998
227 Ga0207687_10005280 3300025927 Bacteria 8563
228 Ga0207700_10038571 3300025928 Bacteria 3468
229 Ga0207644_10004654 3300025931 Bacteria 8918
230 Ga0207706_10000716 3300025933 Bacteria 34628
231 Ga0207706_10070733 3300025933 Bacteria 3069
232 Ga0207706_10078748 3300025933 Bacteria 2899
233 Ga0207706_10082067 3300025933 Bacteria 2833
234 Ga0207686_10073921 3300025934 Unclassified 2201
235 Ga0207709_10061387 3300025935 Bacteria 2349
236 Ga0207670_10000831 3300025936 Bacteria 16168
237 Ga0207670_10030630 3300025936 Bacteria 3438
238 Ga0207669_10003345 3300025937 Bacteria 6940
239 Ga0207691_10000288 3300025940 Bacteria 49679
240 Ga0207689_10007428 3300025942 Bacteria 9610
241 Ga0207689_10040832 3300025942 Bacteria 3839
242 Ga0207661_10000004 3300025944 Bacteria 606391
243 Ga0207679_10041107 3300025945 Bacteria 3314
244 Ga0207651_10035316 3300025960 Unclassified 3248
245 Ga0207712_10008901 3300025961 Bacteria 6349
246 Ga0207668_10002215 3300025972 Bacteria 11332
247 Ga0207640_10012252 3300025981 Bacteria 4880
248 Ga0207658_10039843 3300025986 Bacteria 3392
249 Ga0207658_10081909 3300025986 Bacteria 2476
250 Ga0207677_10000215 3300026023 Bacteria 45951
251 Ga0207677_10000442 3300026023 Bacteria 28083
252 Ga0207703_10000160 3300026035 Bacteria 77872
253 Ga0207639_10000007 3300026041 Bacteria 451321
254 Ga0207708_10035883 3300026075 Bacteria 3772
255 Ga0207676_10000045 3300026095 Bacteria 153346
256 Ga0207676_10036759 3300026095 Bacteria 3728
257 Ga0207683_10010873 3300026121 Bacteria 7762
258 Ga0207683_10046498 3300026121 Bacteria 3798
259 Ga0207683_10062464 3300026121 Bacteria 3280
260 Ga0209179_1005180 3300027512 Bacteria 2022
261 Ga0268266_10073696 3300028379 Unclassified 2963
262 Ga0268266_10150997 3300028379 Bacteria 2094
263 Ga0268264_10028608 3300028381 Bacteria 4560
264 Ga0268264_10150477 3300028381 Bacteria 2086
265 Ga0265319_1001013 3300028563 Bacteria 17557
266 Ga0265334_10002411 3300028573 Bacteria 8791
267 Ga0265318_10000002 3300028577 Bacteria 428208
268 Ga0265323_10000814 3300028653 Bacteria 16731
269 Ga0265322_10000533 3300028654 Bacteria 14627
270 Ga0265338_10022441 3300028800 Bacteria 6534
271 Ga0307511_10010013 3300030521 Bacteria 9430
272 Ga0265320_10000557 3300031240 Bacteria 28713
273 Ga0265331_10016764 3300031250 Bacteria 3838
274 Ga0265331_10028750 3300031250 Bacteria 2778
275 Ga0265316_10027709 3300031344 Bacteria 4684
276 Ga0265316_10035417 3300031344 Bacteria 4046
277 Ga0265313_10000016 3300031595 Bacteria 154004
278 Ga0265313_10001890 3300031595 Bacteria 19029
279 Ga0265314_10003608 3300031711 Bacteria 14888
280 Ga0373953_0056222 3300035117 Unclassified 1600
281 Ga0373957_0067525 3300035120 Bacteria 1394
282 Ga0373927_0080335 3300035695 Bacteria 2113
283 Ga0373947_0145222 3300035725 Bacteria 1525
284 Ga0373937_0002774 3300036401 Bacteria 14628
285 Ga0395900_0016785 3300037418 Bacteria 7468
286 Ga0395900_0043999 3300037418 Bacteria 4602
287 Ga0395898_0005648 3300037466 Bacteria 13485
288 Ga0395901_0007774 3300038443 Bacteria 10819
289 Ga0395901_0129915 3300038443 Bacteria 2647
290 Ga0395901_0133187 3300038443 Bacteria 2612
291 Ga0436365_0848588 3300039437 Bacteria 4192
292 Ga0436365_0887380 3300039437 Bacteria 42160
293 Ga0436365_1042279 3300039437 Bacteria 224225
294 Ga0436365_1094017 3300039437 Bacteria 14202
295 Ga0436365_1732936 3300039437 Unclassified 2817
296 Ga0436360_0921978 3300039438 Bacteria 1635
297 Ga0436362_0325181 3300039453 Bacteria 30390
298 Ga0451576_0000396 3300045051 Bacteria 101504
299 Ga0451576_0004772 3300045051 Bacteria 17380
300 Ga0451576_0051026 3300045051 Bacteria 4338
301 Ga0495592_0016807 3300046454 Bacteria 5555
302 Ga0495651_0054516 3300046462 Bacteria 3074
303 Ga0495580_0041604 3300046472 Bacteria 3277
304 Ga0495608_0142755 3300046511 Unclassified 1528
305 Ga0495628_0010496 3300046516 Bacteria 7865
306 Ga0495652_0023735 3300046529 Bacteria 5436
307 Ga0495586_0084542 3300046535 Unclassified 1747
308 Ga0495587_0060268 3300046536 Bacteria 2226
309 Ga0495645_0027961 3300046543 Bacteria 4096
310 Ga0495634_0006511 3300046642 Bacteria 8872
311 Ga0495634_0065275 3300046642 Bacteria 2413
312 Ga0495599_0005721 3300046678 Bacteria 7457
313 Ga0495623_0039331 3300046679 Bacteria 3023
314 Ga0495646_0032209 3300046680 Bacteria 3263
315 Ga0495669_0032197 3300046684 Bacteria 2304
316 Ga0495600_0064991 3300046809 Bacteria 2385
317 Ga0495604_0024601 3300047317 Bacteria 4804
318 Ga0495684_0026972 3300047471 Bacteria 4413
319 Ga0495593_0042099 3300047673 Bacteria 2453
320 Ga0495602_0026528 3300048088 Bacteria 5586
321 Ga0496104_0380043 3300048907 Unclassified 1325
322 Ga0496105_0139156 3300048908 Bacteria 1999
323 Ga0496105_0186811 3300048908 Bacteria 1696
324 Ga0496107_0033044 3300048910 Bacteria 3700
325 Ga0496108_0017306 3300048911 Bacteria 5896
326 Ga0496109_0051304 3300048912 Bacteria 3758
327 Ga0496112_0074395 3300048915 Bacteria 3359
328 Ga0496112_0088766 3300048915 Bacteria 3060
329 Ga0496112_0097221 3300048915 Unclassified 2915
330 Ga0501047_0051491 3300049581 Bacteria 3979
331 nmdc:mga05p37_27295_c1 3300050507 Bacteria 6951
332 nmdc:mga05p37_75010_c2 3300050507 Bacteria 2157
333 nmdc:mga0rr50_3734_c1 3300050513 Bacteria 8822
334 nmdc:mga0rr50_4046_c1 3300050513 Bacteria 8555
335 nmdc:mga08x19_6873_c1 3300050514 Bacteria 6753
336 Ga0495601_0003033 3300053077 Bacteria 9574
337 Ga0495601_0036520 3300053077 Bacteria 3069
338 Ga0495612_0057370 3300053078 Bacteria 1608
339 Ga0495655_0000376 3300053083 Bacteria 7717

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005445 Ga0070708_100178298 Ga0070708_1001782982 332
2 3300006028 Ga0070717_10000011 Ga0070717_10000011137 335
3 3300009093 Ga0105240_10005497 Ga0105240_100054978 338
4 3300025913 Ga0207695_10057235 Ga0207695_100572352 338
5 3300005467 Ga0070706_100005772 Ga0070706_1000057722 339
6 3300028800 Ga0265338_10022441 Ga0265338_100224412 339
7 3300005471 Ga0070698_100011801 Ga0070698_1000118012 341
8 3300005471 Ga0070698_100062213 Ga0070698_1000622134 341
9 3300021384 Ga0213876_10020780 Ga0213876_100207802 341
10 3300039437 Ga0436365_0848588 Ga0436365_0848588_1268_2614 341
11 3300006358 Ga0068871_100162148 Ga0068871_1001621482 344
12 3300031344 Ga0265316_10035417 Ga0265316_100354173 346
13 3300039437 Ga0436365_1732936 Ga0436365_1732936_317_1624 346
14 3300039438 Ga0436360_0921978 Ga0436360_0921978_163_1416 346
15 3300045051 Ga0451576_0000396 Ga0451576_0000396_41780_43180 346
16 3300005578 Ga0068854_100011698 Ga0068854_1000116982 347
17 3300009551 Ga0105238_10000018 Ga0105238_1000001877 347
18 3300025924 Ga0207694_10000001 Ga0207694_10000001820 347
19 3300025981 Ga0207640_10012252 Ga0207640_100122524 347
20 3300037418 Ga0395900_0016785 Ga0395900_0016785_1932_3320 347
21 3300038443 Ga0395901_0133187 Ga0395901_0133187_414_1802 347
22 3300005289 Ga0065704_10009537 Ga0065704_100095371 349
23 3300005445 Ga0070708_100163064 Ga0070708_1001630642 350
24 3300005536 Ga0070697_100016601 Ga0070697_1000166012 350
25 3300046684 Ga0495669_0032197 Ga0495669_0032197_622_2025 352
26 3300025933 Ga0207706_10070733 Ga0207706_100707332 353
27 3300028381 Ga0268264_10150477 Ga0268264_101504772 353
28 3300005439 Ga0070711_100002697 Ga0070711_1000026976 354
29 3300006175 Ga0070712_100002101 Ga0070712_1000021019 354
30 3300013306 Ga0163162_10004883 Ga0163162_100048835 354
31 3300025915 Ga0207693_10001024 Ga0207693_1000102419 354
32 3300025916 Ga0207663_10033014 Ga0207663_100330142 354
33 3300013308 Ga0157375_10000774 Ga0157375_1000077419 355
34 3300021441 Ga0213871_10003292 Ga0213871_100032922 355
35 3300039437 Ga0436365_0887380 Ga0436365_0887380_31800_33209 357
36 3300013297 Ga0157378_10003503 Ga0157378_100035031 358
37 3300035695 Ga0373927_0080335 Ga0373927_0080335_302_1672 358
38 3300045051 Ga0451576_0051026 Ga0451576_0051026_2568_3959 358
39 3300046472 Ga0495580_0041604 Ga0495580_0041604_543_1913 358
40 3300048907 Ga0496104_0380043 Ga0496104_0380043_52_1290 358
41 3300005331 Ga0070670_100001232 Ga0070670_10000123214 359
42 3300005467 Ga0070706_100005046 Ga0070706_1000050464 359
43 3300005467 Ga0070706_100023644 Ga0070706_1000236444 359
44 3300005467 Ga0070706_100053980 Ga0070706_1000539801 359
45 3300005468 Ga0070707_100015861 Ga0070707_1000158612 359
46 3300025910 Ga0207684_10010800 Ga0207684_100108005 359
47 3300025910 Ga0207684_10042985 Ga0207684_100429852 359
48 3300025922 Ga0207646_10011030 Ga0207646_100110305 359
49 3300025925 Ga0207650_10001066 Ga0207650_1000106614 359
50 3300005445 Ga0070708_100031528 Ga0070708_1000315283 360
51 3300005367 Ga0070667_100132137 Ga0070667_1001321372 362
52 3300005458 Ga0070681_10040739 Ga0070681_100407393 362
53 3300005535 Ga0070684_100137540 Ga0070684_1001375402 362
54 3300005548 Ga0070665_100048546 Ga0070665_1000485464 362
55 3300009174 Ga0105241_10058856 Ga0105241_100588563 362
56 3300013296 Ga0157374_10000005 Ga0157374_10000005244 362
57 3300014745 Ga0157377_10000001 Ga0157377_10000001329 362
58 3300014969 Ga0157376_10000022 Ga0157376_1000002234 362
59 3300025912 Ga0207707_10033066 Ga0207707_100330663 362
60 3300046642 Ga0495634_0006511 Ga0495634_0006511_1496_2857 362
61 3300047471 Ga0495684_0026972 Ga0495684_0026972_96_1457 362
62 3300048908 Ga0496105_0139156 Ga0496105_0139156_298_1659 362
63 3300048915 Ga0496112_0074395 Ga0496112_0074395_781_2139 362
64 3300005456 Ga0070678_100070408 Ga0070678_1000704082 364
65 3300030521 Ga0307511_10010013 Ga0307511_100100134 364
66 3300005290 Ga0065712_10007182 Ga0065712_100071823 365
67 3300005329 Ga0070683_100148993 Ga0070683_1001489933 365
68 3300005467 Ga0070706_100000210 Ga0070706_10000021027 365
69 3300005471 Ga0070698_100029150 Ga0070698_1000291504 365
70 3300005544 Ga0070686_100082401 Ga0070686_1000824012 365
71 3300005614 Ga0068856_100254944 Ga0068856_1002549442 365
72 3300006028 Ga0070717_10014821 Ga0070717_100148212 365
73 3300013307 Ga0157372_10329787 Ga0157372_103297872 365
74 3300013308 Ga0157375_10046910 Ga0157375_100469103 365
75 3300025315 Ga0207697_10000154 Ga0207697_100001549 365
76 3300025910 Ga0207684_10000028 Ga0207684_1000002854 365
77 3300025919 Ga0207657_10056868 Ga0207657_100568682 365
78 3300005328 Ga0070676_10005723 Ga0070676_100057237 366
79 3300005338 Ga0068868_100072215 Ga0068868_1000722151 366
80 3300005340 Ga0070689_100023735 Ga0070689_1000237353 366
81 3300005343 Ga0070687_100002227 Ga0070687_1000022277 366
82 3300005347 Ga0070668_100007088 Ga0070668_1000070884 366
83 3300005353 Ga0070669_100011294 Ga0070669_1000112944 366
84 3300005354 Ga0070675_100003374 Ga0070675_1000033747 366
85 3300005367 Ga0070667_100004159 Ga0070667_1000041596 366
86 3300005457 Ga0070662_100005938 Ga0070662_1000059383 366
87 3300005840 Ga0068870_10045415 Ga0068870_100454151 366
88 3300005843 Ga0068860_100013278 Ga0068860_1000132782 366
89 3300005844 Ga0068862_100011679 Ga0068862_1000116794 366
90 3300009148 Ga0105243_10008437 Ga0105243_100084375 366
91 3300009553 Ga0105249_10001798 Ga0105249_1000179814 366
92 3300013102 Ga0157371_10205988 Ga0157371_102059881 366
93 3300013296 Ga0157374_10008046 Ga0157374_100080467 366
94 3300013297 Ga0157378_10009982 Ga0157378_100099825 366
95 3300025315 Ga0207697_10000048 Ga0207697_1000004825 366
96 3300025907 Ga0207645_10000452 Ga0207645_1000045227 366
97 3300025918 Ga0207662_10000206 Ga0207662_1000020613 366
98 3300025923 Ga0207681_10031032 Ga0207681_100310323 366
99 3300025926 Ga0207659_10024089 Ga0207659_100240893 366
100 3300025933 Ga0207706_10000716 Ga0207706_1000071626 366
101 3300025935 Ga0207709_10061387 Ga0207709_100613871 366
102 3300025937 Ga0207669_10003345 Ga0207669_100033452 366
103 3300025961 Ga0207712_10008901 Ga0207712_100089016 366
104 3300025972 Ga0207668_10002215 Ga0207668_100022158 366
105 3300025986 Ga0207658_10081909 Ga0207658_100819091 366
106 3300028381 Ga0268264_10028608 Ga0268264_100286082 366
107 3300045051 Ga0451576_0004772 Ga0451576_0004772_3539_4939 366
108 3300046535 Ga0495586_0084542 Ga0495586_0084542_63_1424 366
109 3300047673 Ga0495593_0042099 Ga0495593_0042099_104_1465 366
110 3300048910 Ga0496107_0033044 Ga0496107_0033044_255_1655 366
111 3300005293 Ga0065715_10108090 Ga0065715_101080902 367
112 3300005330 Ga0070690_100013449 Ga0070690_1000134493 367
113 3300005354 Ga0070675_100042853 Ga0070675_1000428532 367
114 3300005364 Ga0070673_100036483 Ga0070673_1000364833 367
115 3300005456 Ga0070678_100059040 Ga0070678_1000590403 367
116 3300005548 Ga0070665_100016600 Ga0070665_1000166004 367
117 3300009176 Ga0105242_10185077 Ga0105242_101850771 367
118 3300013296 Ga0157374_10106402 Ga0157374_101064023 367
119 3300013297 Ga0157378_10077580 Ga0157378_100775803 367
120 3300013306 Ga0163162_10152333 Ga0163162_101523332 367
121 3300013306 Ga0163162_10315197 Ga0163162_103151972 367
122 3300013308 Ga0157375_10032301 Ga0157375_100323013 367
123 3300025271 Ga0207666_1001647 Ga0207666_10016473 367
124 3300025290 Ga0207673_1000337 Ga0207673_10003374 367
125 3300025315 Ga0207697_10002394 Ga0207697_100023949 367
126 3300025910 Ga0207684_10001402 Ga0207684_1000140217 367
127 3300025934 Ga0207686_10073921 Ga0207686_100739212 367
128 3300025960 Ga0207651_10035316 Ga0207651_100353163 367
129 3300025986 Ga0207658_10039843 Ga0207658_100398433 367
130 3300028379 Ga0268266_10073696 Ga0268266_100736962 367
131 3300048915 Ga0496112_0097221 Ga0496112_0097221_1285_2643 367
132 3300005290 Ga0065712_10102235 Ga0065712_101022352 368
133 3300005293 Ga0065715_10091779 Ga0065715_100917792 368
134 3300005329 Ga0070683_100000044 Ga0070683_10000004458 368
135 3300005338 Ga0068868_100000142 Ga0068868_10000014227 368
136 3300005435 Ga0070714_100059262 Ga0070714_1000592622 368
137 3300005468 Ga0070707_100153756 Ga0070707_1001537561 368
138 3300005535 Ga0070684_100000032 Ga0070684_10000003234 368
139 3300005535 Ga0070684_100000274 Ga0070684_10000027418 368
140 3300005842 Ga0068858_100008989 Ga0068858_1000089897 368
141 3300013105 Ga0157369_10000111 Ga0157369_100001116 368
142 3300025904 Ga0207647_10008527 Ga0207647_100085272 368
143 3300025919 Ga0207657_10092018 Ga0207657_100920182 368
144 3300025928 Ga0207700_10038571 Ga0207700_100385713 368
145 3300025944 Ga0207661_10000004 Ga0207661_10000004388 368
146 3300025945 Ga0207679_10041107 Ga0207679_100411072 368
147 3300026023 Ga0207677_10000442 Ga0207677_100004424 368
148 3300026121 Ga0207683_10010873 Ga0207683_100108734 368
149 3300048908 Ga0496105_0186811 Ga0496105_0186811_92_1450 368
150 3300048912 Ga0496109_0051304 Ga0496109_0051304_963_2324 368
151 3300046679 Ga0495623_0039331 Ga0495623_0039331_1748_3001 369
152 3300053078 Ga0495612_0057370 Ga0495612_0057370_345_1598 369
153 3300005546 Ga0070696_100030976 Ga0070696_1000309763 370
154 3300025922 Ga0207646_10083871 Ga0207646_100838711 370
155 3300025922 Ga0207646_10129070 Ga0207646_101290702 370
156 3300005548 Ga0070665_100164534 Ga0070665_1001645342 371
157 3300006237 Ga0097621_100077149 Ga0097621_1000771492 371
158 3300025315 Ga0207697_10023481 Ga0207697_100234812 371
159 3300025931 Ga0207644_10004654 Ga0207644_100046546 371
160 3300028379 Ga0268266_10150997 Ga0268266_101509971 371
161 3300035725 Ga0373947_0145222 Ga0373947_0145222_35_1396 371
162 3300005438 Ga0070701_10000989 Ga0070701_100009894 372
163 3300006871 Ga0075434_100117552 Ga0075434_1001175522 372
164 3300013297 Ga0157378_10008747 Ga0157378_100087474 372
165 3300014745 Ga0157377_10000072 Ga0157377_1000007237 372
166 3300025942 Ga0207689_10040832 Ga0207689_100408322 372
167 3300035117 Ga0373953_0056222 Ga0373953_0056222_171_1529 372
168 3300046454 Ga0495592_0016807 Ga0495592_0016807_606_1964 372
169 3300046511 Ga0495608_0142755 Ga0495608_0142755_47_1405 372
170 3300046516 Ga0495628_0010496 Ga0495628_0010496_5383_6741 372
171 3300046536 Ga0495587_0060268 Ga0495587_0060268_255_1613 372
172 3300046543 Ga0495645_0027961 Ga0495645_0027961_1346_2704 372
173 3300046678 Ga0495599_0005721 Ga0495599_0005721_1929_3287 372
174 3300046680 Ga0495646_0032209 Ga0495646_0032209_1612_2970 372
175 3300048088 Ga0495602_0026528 Ga0495602_0026528_2912_4270 372
176 3300053077 Ga0495601_0003033 Ga0495601_0003033_3116_4474 372
177 3300005445 Ga0070708_100031799 Ga0070708_1000317993 373
178 3300005467 Ga0070706_100039096 Ga0070706_1000390964 373
179 3300025918 Ga0207662_10060357 Ga0207662_100603572 373
180 3300005293 Ga0065715_10002825 Ga0065715_100028252 374
181 3300005340 Ga0070689_100000260 Ga0070689_10000026020 375
182 3300005842 Ga0068858_100000297 Ga0068858_10000029729 375
183 3300009098 Ga0105245_10001270 Ga0105245_1000127016 375
184 3300025927 Ga0207687_10005280 Ga0207687_100052802 375
185 3300025936 Ga0207670_10000831 Ga0207670_100008312 375
186 3300026035 Ga0207703_10000160 Ga0207703_1000016050 375
187 3300049581 Ga0501047_0051491 Ga0501047_0051491_2330_3676 375
188 3300005355 Ga0070671_100083016 Ga0070671_1000830162 376
189 3300005937 Ga0081455_10000314 Ga0081455_1000031418 376
190 3300025933 Ga0207706_10082067 Ga0207706_100820672 376
191 3300028653 Ga0265323_10000814 Ga0265323_100008149 376
192 3300028654 Ga0265322_10000533 Ga0265322_100005337 376
193 3300031344 Ga0265316_10027709 Ga0265316_100277093 376
194 3300047317 Ga0495604_0024601 Ga0495604_0024601_1720_3078 376
195 3300002126 JGI24035J26624_1000744 JGI24035J26624_10007441 377
196 3300005336 Ga0070680_100251376 Ga0070680_1002513761 377
197 3300013307 Ga0157372_10038070 Ga0157372_100380705 377
198 3300025913 Ga0207695_10018183 Ga0207695_100181832 377
199 3300026041 Ga0207639_10000007 Ga0207639_10000007241 377
200 3300026121 Ga0207683_10062464 Ga0207683_100624644 377
201 3300027512 Ga0209179_1005180 Ga0209179_10051802 377
202 3300050513 nmdc:mga0rr50_3734_c1 nmdc:mga0rr50_3734_c1_2622_3953 377
203 3300005328 Ga0070676_10054388 Ga0070676_100543882 378
204 3300005355 Ga0070671_100019906 Ga0070671_1000199063 378
205 3300005356 Ga0070674_100026325 Ga0070674_1000263251 378
206 3300005543 Ga0070672_100145631 Ga0070672_1001456312 378
207 3300006881 Ga0068865_100087523 Ga0068865_1000875232 378
208 3300021384 Ga0213876_10018646 Ga0213876_100186463 378
209 3300026121 Ga0207683_10046498 Ga0207683_100464984 378
210 3300039437 Ga0436365_1094017 Ga0436365_1094017_2094_3398 378
211 3300048911 Ga0496108_0017306 Ga0496108_0017306_1825_3180 378
212 3300005457 Ga0070662_100094678 Ga0070662_1000946782 379
213 3300005617 Ga0068859_100084804 Ga0068859_1000848042 379
214 3300006028 Ga0070717_10073358 Ga0070717_100733581 379
215 3300006931 Ga0097620_100084804 Ga0097620_1000848043 379
216 3300025315 Ga0207697_10020105 Ga0207697_100201051 379
217 3300025942 Ga0207689_10007428 Ga0207689_100074286 379
218 3300005340 Ga0070689_100097361 Ga0070689_1000973612 380
219 3300005355 Ga0070671_100154077 Ga0070671_1001540772 380
220 3300005440 Ga0070705_100032960 Ga0070705_1000329603 380
221 3300005441 Ga0070700_100060343 Ga0070700_1000603432 380
222 3300005444 Ga0070694_100084167 Ga0070694_1000841672 380
223 3300005549 Ga0070704_100036010 Ga0070704_1000360103 380
224 3300005618 Ga0068864_100076903 Ga0068864_1000769032 380
225 3300005841 Ga0068863_100033690 Ga0068863_1000336903 380
226 3300005843 Ga0068860_100109976 Ga0068860_1001099762 380
227 3300007076 Ga0075435_100019674 Ga0075435_1000196745 380
228 3300013308 Ga0157375_10128002 Ga0157375_101280023 380
229 3300025315 Ga0207697_10001046 Ga0207697_100010462 380
230 3300025885 Ga0207653_10004871 Ga0207653_100048712 380
231 3300025915 Ga0207693_10015348 Ga0207693_100153483 380
232 3300025933 Ga0207706_10078748 Ga0207706_100787482 380
233 3300026075 Ga0207708_10035883 Ga0207708_100358834 380
234 3300026095 Ga0207676_10036759 Ga0207676_100367593 380
235 3300053083 Ga0495655_0000376 Ga0495655_0000376_158_1477 380
236 3300005295 Ga0065707_10124266 Ga0065707_101242662 381
237 3300005536 Ga0070697_100018194 Ga0070697_1000181942 381
238 3300009098 Ga0105245_10000006 Ga0105245_10000006189 381
239 3300025908 Ga0207643_10016302 Ga0207643_100163022 381
240 3300025927 Ga0207687_10000006 Ga0207687_10000006251 381
241 3300005293 Ga0065715_10092183 Ga0065715_100921833 382
242 3300005468 Ga0070707_100000632 Ga0070707_10000063224 382
243 3300009094 Ga0111539_10248326 Ga0111539_102483262 382
244 3300013308 Ga0157375_10000014 Ga0157375_10000014156 382
245 3300025922 Ga0207646_10003322 Ga0207646_100033222 382
246 3300025940 Ga0207691_10000288 Ga0207691_1000028831 382
247 3300005331 Ga0070670_100031913 Ga0070670_1000319132 383
248 3300005445 Ga0070708_100075157 Ga0070708_1000751572 383
249 3300005467 Ga0070706_100036810 Ga0070706_1000368104 383
250 3300005468 Ga0070707_100013638 Ga0070707_1000136383 383
251 3300005471 Ga0070698_100000633 Ga0070698_10000063337 383
252 3300006358 Ga0068871_100042159 Ga0068871_1000421592 383
253 3300013296 Ga0157374_10056844 Ga0157374_100568443 383
254 3300013306 Ga0163162_10035138 Ga0163162_100351383 383
255 3300013308 Ga0157375_10007640 Ga0157375_100076406 383
256 3300025910 Ga0207684_10026831 Ga0207684_100268312 383
257 3300025910 Ga0207684_10113859 Ga0207684_101138592 383
258 3300025922 Ga0207646_10012823 Ga0207646_100128237 383
259 3300025925 Ga0207650_10109599 Ga0207650_101095992 383
260 3300048915 Ga0496112_0088766 Ga0496112_0088766_968_2323 383
261 3300050507 nmdc:mga05p37_75010_c2 nmdc:mga05p37_75010_c2_144_1505 383
262 3300013297 Ga0157378_10008415 Ga0157378_100084154 384
263 3300028573 Ga0265334_10002411 Ga0265334_100024117 384
264 3300028577 Ga0265318_10000002 Ga0265318_10000002273 384
265 3300031250 Ga0265331_10016764 Ga0265331_100167643 384
266 3300031595 Ga0265313_10001890 Ga0265313_1000189016 384
267 3300031711 Ga0265314_10003608 Ga0265314_100036087 384
268 3300005467 Ga0070706_100020133 Ga0070706_1000201332 385
269 3300028563 Ga0265319_1001013 Ga0265319_100101313 385
270 3300031240 Ga0265320_10000557 Ga0265320_1000055712 385
271 3300031250 Ga0265331_10028750 Ga0265331_100287503 385
272 3300031595 Ga0265313_10000016 Ga0265313_1000001639 385
273 3300005937 Ga0081455_10011210 Ga0081455_100112103 386
274 3300006028 Ga0070717_10002496 Ga0070717_1000249610 386
275 3300009098 Ga0105245_10115069 Ga0105245_101150692 386
276 3300021358 Ga0213873_10000153 Ga0213873_1000015312 386
277 3300021384 Ga0213876_10000386 Ga0213876_1000038626 386
278 3300035120 Ga0373957_0067525 Ga0373957_0067525_12_1304 386
279 3300038443 Ga0395901_0129915 Ga0395901_0129915_296_1657 386
280 3300039437 Ga0436365_1042279 Ga0436365_1042279_207380_208720 386
281 3300039453 Ga0436362_0325181 Ga0436362_0325181_10408_11748 386
282 3300013307 Ga0157372_10346825 Ga0157372_103468252 387
283 3300025915 Ga0207693_10031288 Ga0207693_100312883 387
284 3300037418 Ga0395900_0043999 Ga0395900_0043999_2287_3723 387
285 3300037466 Ga0395898_0005648 Ga0395898_0005648_5652_7088 387
286 3300038443 Ga0395901_0007774 Ga0395901_0007774_4499_5935 387
287 3300005338 Ga0068868_100001479 Ga0068868_1000014794 388
288 3300005471 Ga0070698_100055617 Ga0070698_1000556171 388
289 3300013297 Ga0157378_10006014 Ga0157378_100060145 388
290 3300026023 Ga0207677_10000215 Ga0207677_1000021512 388
291 3300005327 Ga0070658_10156424 Ga0070658_101564241 389
292 3300005436 Ga0070713_100033556 Ga0070713_1000335563 389
293 3300006028 Ga0070717_10000097 Ga0070717_1000009751 389
294 3300006914 Ga0075436_100003381 Ga0075436_1000033816 389
295 3300007076 Ga0075435_100000040 Ga0075435_10000004041 389
296 3300013297 Ga0157378_10007399 Ga0157378_100073992 389
297 3300013308 Ga0157375_10000047 Ga0157375_1000004797 389
298 3300025909 Ga0207705_10068808 Ga0207705_100688082 389
299 3300026095 Ga0207676_10000045 Ga0207676_1000004535 389
300 3300050513 nmdc:mga0rr50_4046_c1 nmdc:mga0rr50_4046_c1_399_1718 389
301 3300050514 nmdc:mga08x19_6873_c1 nmdc:mga08x19_6873_c1_4804_6123 389
302 3300005536 Ga0070697_100016795 Ga0070697_1000167952 390
303 3300009545 Ga0105237_10285897 Ga0105237_102858972 390
304 3300010375 Ga0105239_10040865 Ga0105239_100408654 390
305 3300013306 Ga0163162_10099250 Ga0163162_100992502 390
306 3300025927 Ga0207687_10003907 Ga0207687_100039073 390
307 3300005518 Ga0070699_100165776 Ga0070699_1001657761 393
308 3300000545 CNXas_1000022 CNXas_100002229 396
309 3300005272 Ga0065703_1020349 Ga0065703_10203491 396
310 3300005331 Ga0070670_100062417 Ga0070670_1000624173 396
311 3300005340 Ga0070689_100036173 Ga0070689_1000361733 396
312 3300005439 Ga0070711_100017729 Ga0070711_1000177293 396
313 3300005445 Ga0070708_100102828 Ga0070708_1001028282 396
314 3300005445 Ga0070708_100119564 Ga0070708_1001195641 396
315 3300005445 Ga0070708_100256252 Ga0070708_1002562521 396
316 3300005468 Ga0070707_100042781 Ga0070707_1000427812 396
317 3300005471 Ga0070698_100003474 Ga0070698_10000347416 396
318 3300005518 Ga0070699_100033532 Ga0070699_1000335325 396
319 3300005536 Ga0070697_100005719 Ga0070697_1000057197 396
320 3300005983 Ga0081540_1000111 Ga0081540_100011117 396
321 3300005983 Ga0081540_1003110 Ga0081540_10031105 396
322 3300006028 Ga0070717_10037636 Ga0070717_100376364 396
323 3300009147 Ga0114129_10019739 Ga0114129_100197395 396
324 3300013296 Ga0157374_10038210 Ga0157374_100382102 396
325 3300013306 Ga0163162_10212857 Ga0163162_102128572 396
326 3300025910 Ga0207684_10013890 Ga0207684_100138903 396
327 3300025910 Ga0207684_10167123 Ga0207684_101671232 396
328 3300025916 Ga0207663_10046166 Ga0207663_100461662 396
329 3300025922 Ga0207646_10000130 Ga0207646_10000130106 396
330 3300025922 Ga0207646_10075742 Ga0207646_100757423 396
331 3300025926 Ga0207659_10089410 Ga0207659_100894102 396
332 3300025936 Ga0207670_10030630 Ga0207670_100306303 396
333 3300036401 Ga0373937_0002774 Ga0373937_0002774_4922_6274 396
334 3300046462 Ga0495651_0054516 Ga0495651_0054516_1687_3039 396
335 3300046529 Ga0495652_0023735 Ga0495652_0023735_1212_2564 396
336 3300046642 Ga0495634_0065275 Ga0495634_0065275_993_2345 396
337 3300046809 Ga0495600_0064991 Ga0495600_0064991_496_1848 396
338 3300050507 nmdc:mga05p37_27295_c1 nmdc:mga05p37_27295_c1_4810_6171 396
339 3300053077 Ga0495601_0036520 Ga0495601_0036520_925_2277 396

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13533

Biotin_lipoyl_2

Biotin-lipoyl like

99

151

0.95

PF13437

HlyD_3

HlyD family secretion protein

227

340

0.78

PF16576

HlyD_D23

Barrel-sandwich domain of CusB or HlyD membrane-fusion

87

342

0.75

Feature Viewer

pLDDT pTM Quality
74.22 0.39 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map