F413855
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 339 | 190 | 339 | 416 |
Family's Representative Sequence
| Representative Sequence | 3300005983|Ga0081540_1000111|Ga0081540_100011117 |
| Length | 478 |
| Sequence | MNGISFARIKQATNSDVFTPRTPPPMHQTVSTPAXXXLTVKQRRARRKKQIFYGLIALVVLWIVGSIIWGKREKPIPVTTETAIRKTIVQTVSATGKIQPEVEVKISPEVAGEIIELPVEDGMRVKKGDLLVKIKPDSYKALLEQQEAAISAAKATNLQQKATMMKTEHDLKRAEDLFNKKLISEQEYNAGQAAYDVAKNTYESSLHEIERAEASSSQARDQLSKTTIYSPLDGTITILNSKLGERLVATGQFAGTEVMRVADLTHMQAIVDVNENDVVNVKLGDKASVKIDAYGDRKFKGVVQQIANTGKTTGAGTQEEVTNFEVKIRIDDHDVSLRPALSCTADIQTNEVKDAVAVPMQAVTIRTGESNLSPEEIEKKKQKVTQRDKGDNNAEFVDGRAEKAAQKEEREKLAKVVFLKKGGKAEMVKVTTGISDDTYTEIKSGIQPGAEVISGSYSAISRKLKEGAKVTLDKEGMK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 2 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 3 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 6 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 63 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 64 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 136 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 137 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 138 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 139 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 142 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 143 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 146 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 148 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 157 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 179 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 180 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 181 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 182 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 183 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 184 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 186 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.65 |
| Rhizosphere | 94.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.65 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000022 | 3300000545 | Bacteria | 32122 |
| 2 | JGI24035J26624_1000744 | 3300002126 | Bacteria | 3049 |
| 3 | Ga0065703_1020349 | 3300005272 | Unclassified | 1848 |
| 4 | Ga0065704_10009537 | 3300005289 | Unclassified | 2741 |
| 5 | Ga0065712_10007182 | 3300005290 | Bacteria | 3618 |
| 6 | Ga0065712_10102235 | 3300005290 | Bacteria | 2009 |
| 7 | Ga0065715_10002825 | 3300005293 | Bacteria | 5904 |
| 8 | Ga0065715_10091779 | 3300005293 | Bacteria | 5558 |
| 9 | Ga0065715_10092183 | 3300005293 | Bacteria | 5278 |
| 10 | Ga0065715_10108090 | 3300005293 | Unclassified | 2732 |
| 11 | Ga0065707_10124266 | 3300005295 | Bacteria | 2044 |
| 12 | Ga0070658_10156424 | 3300005327 | Unclassified | 1911 |
| 13 | Ga0070676_10005723 | 3300005328 | Bacteria | 6624 |
| 14 | Ga0070676_10054388 | 3300005328 | Bacteria | 2360 |
| 15 | Ga0070683_100000044 | 3300005329 | Bacteria | 102122 |
| 16 | Ga0070683_100148993 | 3300005329 | Unclassified | 2218 |
| 17 | Ga0070690_100013449 | 3300005330 | Bacteria | 4836 |
| 18 | Ga0070670_100001232 | 3300005331 | Bacteria | 20355 |
| 19 | Ga0070670_100031913 | 3300005331 | Bacteria | 4535 |
| 20 | Ga0070670_100062417 | 3300005331 | Bacteria | 3199 |
| 21 | Ga0070680_100251376 | 3300005336 | Bacteria | 1494 |
| 22 | Ga0068868_100000142 | 3300005338 | Bacteria | 46351 |
| 23 | Ga0068868_100001479 | 3300005338 | Bacteria | 16205 |
| 24 | Ga0068868_100072215 | 3300005338 | Bacteria | 2753 |
| 25 | Ga0070689_100000260 | 3300005340 | Bacteria | 30408 |
| 26 | Ga0070689_100023735 | 3300005340 | Bacteria | 4596 |
| 27 | Ga0070689_100036173 | 3300005340 | Bacteria | 3776 |
| 28 | Ga0070689_100097361 | 3300005340 | Bacteria | 2326 |
| 29 | Ga0070687_100002227 | 3300005343 | Bacteria | 7190 |
| 30 | Ga0070668_100007088 | 3300005347 | Bacteria | 8304 |
| 31 | Ga0070669_100011294 | 3300005353 | Bacteria | 6341 |
| 32 | Ga0070675_100003374 | 3300005354 | Bacteria | 12098 |
| 33 | Ga0070675_100042853 | 3300005354 | Unclassified | 3698 |
| 34 | Ga0070671_100019906 | 3300005355 | Bacteria | 5467 |
| 35 | Ga0070671_100083016 | 3300005355 | Bacteria | 2679 |
| 36 | Ga0070671_100154077 | 3300005355 | Bacteria | 1941 |
| 37 | Ga0070674_100026325 | 3300005356 | Bacteria | 3797 |
| 38 | Ga0070673_100036483 | 3300005364 | Bacteria | 3737 |
| 39 | Ga0070667_100004159 | 3300005367 | Bacteria | 12231 |
| 40 | Ga0070667_100132137 | 3300005367 | Unclassified | 2180 |
| 41 | Ga0070714_100059262 | 3300005435 | Bacteria | 3282 |
| 42 | Ga0070713_100033556 | 3300005436 | Bacteria | 4113 |
| 43 | Ga0070701_10000989 | 3300005438 | Bacteria | 10311 |
| 44 | Ga0070711_100002697 | 3300005439 | Bacteria | 10188 |
| 45 | Ga0070711_100017729 | 3300005439 | Bacteria | 4536 |
| 46 | Ga0070705_100032960 | 3300005440 | Bacteria | 2883 |
| 47 | Ga0070700_100060343 | 3300005441 | Bacteria | 2390 |
| 48 | Ga0070694_100084167 | 3300005444 | Bacteria | 2218 |
| 49 | Ga0070708_100031528 | 3300005445 | Bacteria | 4589 |
| 50 | Ga0070708_100031799 | 3300005445 | Bacteria | 4571 |
| 51 | Ga0070708_100075157 | 3300005445 | Bacteria | 3049 |
| 52 | Ga0070708_100102828 | 3300005445 | Bacteria | 2618 |
| 53 | Ga0070708_100119564 | 3300005445 | Bacteria | 2429 |
| 54 | Ga0070708_100163064 | 3300005445 | Unclassified | 2078 |
| 55 | Ga0070708_100178298 | 3300005445 | Bacteria | 1985 |
| 56 | Ga0070708_100256252 | 3300005445 | Bacteria | 1644 |
| 57 | Ga0070678_100059040 | 3300005456 | Unclassified | 2818 |
| 58 | Ga0070678_100070408 | 3300005456 | Unclassified | 2614 |
| 59 | Ga0070662_100005938 | 3300005457 | Bacteria | 7831 |
| 60 | Ga0070662_100094678 | 3300005457 | Bacteria | 2249 |
| 61 | Ga0070681_10040739 | 3300005458 | Bacteria | 4653 |
| 62 | Ga0070706_100000210 | 3300005467 | Bacteria | 71893 |
| 63 | Ga0070706_100005046 | 3300005467 | Bacteria | 12615 |
| 64 | Ga0070706_100005772 | 3300005467 | Bacteria | 11759 |
| 65 | Ga0070706_100020133 | 3300005467 | Bacteria | 6149 |
| 66 | Ga0070706_100023644 | 3300005467 | Bacteria | 5657 |
| 67 | Ga0070706_100036810 | 3300005467 | Bacteria | 4520 |
| 68 | Ga0070706_100039096 | 3300005467 | Bacteria | 4380 |
| 69 | Ga0070706_100053980 | 3300005467 | Bacteria | 3710 |
| 70 | Ga0070707_100000632 | 3300005468 | Bacteria | 35270 |
| 71 | Ga0070707_100013638 | 3300005468 | Bacteria | 7611 |
| 72 | Ga0070707_100015861 | 3300005468 | Bacteria | 7072 |
| 73 | Ga0070707_100042781 | 3300005468 | Bacteria | 4337 |
| 74 | Ga0070707_100153756 | 3300005468 | Bacteria | 2240 |
| 75 | Ga0070698_100000633 | 3300005471 | Bacteria | 37962 |
| 76 | Ga0070698_100003474 | 3300005471 | Bacteria | 17340 |
| 77 | Ga0070698_100011801 | 3300005471 | Bacteria | 9270 |
| 78 | Ga0070698_100029150 | 3300005471 | Bacteria | 5728 |
| 79 | Ga0070698_100055617 | 3300005471 | Unclassified | 4011 |
| 80 | Ga0070698_100062213 | 3300005471 | Bacteria | 3766 |
| 81 | Ga0070699_100033532 | 3300005518 | Bacteria | 4436 |
| 82 | Ga0070699_100165776 | 3300005518 | Bacteria | 1957 |
| 83 | Ga0070684_100000032 | 3300005535 | Bacteria | 104605 |
| 84 | Ga0070684_100000274 | 3300005535 | Bacteria | 35734 |
| 85 | Ga0070684_100137540 | 3300005535 | Unclassified | 2207 |
| 86 | Ga0070697_100005719 | 3300005536 | Bacteria | 9581 |
| 87 | Ga0070697_100016601 | 3300005536 | Bacteria | 5792 |
| 88 | Ga0070697_100016795 | 3300005536 | Bacteria | 5757 |
| 89 | Ga0070697_100018194 | 3300005536 | Bacteria | 5538 |
| 90 | Ga0070672_100145631 | 3300005543 | Unclassified | 1957 |
| 91 | Ga0070686_100082401 | 3300005544 | Unclassified | 2133 |
| 92 | Ga0070696_100030976 | 3300005546 | Bacteria | 3664 |
| 93 | Ga0070665_100016600 | 3300005548 | Bacteria | 7380 |
| 94 | Ga0070665_100048546 | 3300005548 | Bacteria | 4261 |
| 95 | Ga0070665_100164534 | 3300005548 | Bacteria | 2221 |
| 96 | Ga0070704_100036010 | 3300005549 | Bacteria | 3368 |
| 97 | Ga0068854_100011698 | 3300005578 | Bacteria | 5724 |
| 98 | Ga0068856_100254944 | 3300005614 | Unclassified | 1769 |
| 99 | Ga0068859_100084804 | 3300005617 | Bacteria | 3213 |
| 100 | Ga0068864_100076903 | 3300005618 | Bacteria | 2918 |
| 101 | Ga0068870_10045415 | 3300005840 | Unclassified | 2300 |
| 102 | Ga0068863_100033690 | 3300005841 | Bacteria | 4879 |
| 103 | Ga0068858_100000297 | 3300005842 | Bacteria | 53492 |
| 104 | Ga0068858_100008989 | 3300005842 | Bacteria | 9561 |
| 105 | Ga0068860_100013278 | 3300005843 | Bacteria | 8081 |
| 106 | Ga0068860_100109976 | 3300005843 | Bacteria | 2634 |
| 107 | Ga0068862_100011679 | 3300005844 | Bacteria | 7246 |
| 108 | Ga0081455_10000314 | 3300005937 | Bacteria | 63484 |
| 109 | Ga0081455_10011210 | 3300005937 | Bacteria | 9020 |
| 110 | Ga0081540_1000111 | 3300005983 | Bacteria | 86926 |
| 111 | Ga0081540_1003110 | 3300005983 | Bacteria | 13285 |
| 112 | Ga0070717_10000011 | 3300006028 | Bacteria | 233981 |
| 113 | Ga0070717_10000097 | 3300006028 | Bacteria | 67987 |
| 114 | Ga0070717_10002496 | 3300006028 | Bacteria | 12985 |
| 115 | Ga0070717_10014821 | 3300006028 | Bacteria | 5998 |
| 116 | Ga0070717_10037636 | 3300006028 | Bacteria | 3929 |
| 117 | Ga0070717_10073358 | 3300006028 | Bacteria | 2860 |
| 118 | Ga0070712_100002101 | 3300006175 | Bacteria | 12241 |
| 119 | Ga0097621_100077149 | 3300006237 | Bacteria | 2765 |
| 120 | Ga0068871_100042159 | 3300006358 | Bacteria | 3662 |
| 121 | Ga0068871_100162148 | 3300006358 | Unclassified | 1913 |
| 122 | Ga0075434_100117552 | 3300006871 | Bacteria | 2672 |
| 123 | Ga0068865_100087523 | 3300006881 | Bacteria | 2251 |
| 124 | Ga0075436_100003381 | 3300006914 | Bacteria | 10928 |
| 125 | Ga0097620_100084804 | 3300006931 | Bacteria | 3213 |
| 126 | Ga0075435_100000040 | 3300007076 | Bacteria | 66678 |
| 127 | Ga0075435_100019674 | 3300007076 | Bacteria | 5162 |
| 128 | Ga0105240_10005497 | 3300009093 | Bacteria | 18885 |
| 129 | Ga0111539_10248326 | 3300009094 | Bacteria | 2072 |
| 130 | Ga0105245_10000006 | 3300009098 | Bacteria | 330960 |
| 131 | Ga0105245_10001270 | 3300009098 | Bacteria | 22783 |
| 132 | Ga0105245_10115069 | 3300009098 | Bacteria | 2506 |
| 133 | Ga0114129_10019739 | 3300009147 | Bacteria | 9592 |
| 134 | Ga0105243_10008437 | 3300009148 | Bacteria | 7911 |
| 135 | Ga0105241_10058856 | 3300009174 | Bacteria | 2952 |
| 136 | Ga0105242_10185077 | 3300009176 | Unclassified | 1840 |
| 137 | Ga0105237_10285897 | 3300009545 | Unclassified | 1652 |
| 138 | Ga0105238_10000018 | 3300009551 | Bacteria | 223340 |
| 139 | Ga0105249_10001798 | 3300009553 | Bacteria | 18650 |
| 140 | Ga0105239_10040865 | 3300010375 | Bacteria | 5082 |
| 141 | Ga0157371_10205988 | 3300013102 | Bacteria | 1411 |
| 142 | Ga0157369_10000111 | 3300013105 | Bacteria | 114462 |
| 143 | Ga0157374_10000005 | 3300013296 | Bacteria | 646767 |
| 144 | Ga0157374_10008046 | 3300013296 | Bacteria | 9014 |
| 145 | Ga0157374_10038210 | 3300013296 | Bacteria | 4411 |
| 146 | Ga0157374_10056844 | 3300013296 | Bacteria | 3654 |
| 147 | Ga0157374_10106402 | 3300013296 | Bacteria | 2695 |
| 148 | Ga0157378_10003503 | 3300013297 | Bacteria | 13927 |
| 149 | Ga0157378_10006014 | 3300013297 | Bacteria | 10630 |
| 150 | Ga0157378_10007399 | 3300013297 | Bacteria | 9590 |
| 151 | Ga0157378_10008415 | 3300013297 | Bacteria | 8988 |
| 152 | Ga0157378_10008747 | 3300013297 | Bacteria | 8814 |
| 153 | Ga0157378_10009982 | 3300013297 | Bacteria | 8279 |
| 154 | Ga0157378_10077580 | 3300013297 | Unclassified | 2995 |
| 155 | Ga0163162_10004883 | 3300013306 | Bacteria | 12932 |
| 156 | Ga0163162_10035138 | 3300013306 | Bacteria | 4991 |
| 157 | Ga0163162_10099250 | 3300013306 | Bacteria | 3002 |
| 158 | Ga0163162_10152333 | 3300013306 | Unclassified | 2430 |
| 159 | Ga0163162_10212857 | 3300013306 | Bacteria | 2063 |
| 160 | Ga0163162_10315197 | 3300013306 | Unclassified | 1697 |
| 161 | Ga0157372_10038070 | 3300013307 | Bacteria | 5307 |
| 162 | Ga0157372_10329787 | 3300013307 | Unclassified | 1777 |
| 163 | Ga0157372_10346825 | 3300013307 | Bacteria | 1730 |
| 164 | Ga0157375_10000014 | 3300013308 | Bacteria | 319231 |
| 165 | Ga0157375_10000047 | 3300013308 | Bacteria | 141526 |
| 166 | Ga0157375_10000774 | 3300013308 | Bacteria | 28045 |
| 167 | Ga0157375_10007640 | 3300013308 | Bacteria | 9458 |
| 168 | Ga0157375_10032301 | 3300013308 | Bacteria | 4963 |
| 169 | Ga0157375_10046910 | 3300013308 | Bacteria | 4215 |
| 170 | Ga0157375_10128002 | 3300013308 | Bacteria | 2657 |
| 171 | Ga0157377_10000001 | 3300014745 | Bacteria | 623098 |
| 172 | Ga0157377_10000072 | 3300014745 | Bacteria | 78456 |
| 173 | Ga0157376_10000022 | 3300014969 | Bacteria | 225272 |
| 174 | Ga0213873_10000153 | 3300021358 | Bacteria | 13197 |
| 175 | Ga0213876_10000386 | 3300021384 | Bacteria | 37226 |
| 176 | Ga0213876_10018646 | 3300021384 | Bacteria | 3665 |
| 177 | Ga0213876_10020780 | 3300021384 | Bacteria | 3471 |
| 178 | Ga0213871_10003292 | 3300021441 | Bacteria | 3096 |
| 179 | Ga0207666_1001647 | 3300025271 | Unclassified | 2650 |
| 180 | Ga0207673_1000337 | 3300025290 | Bacteria | 4709 |
| 181 | Ga0207697_10000048 | 3300025315 | Bacteria | 47739 |
| 182 | Ga0207697_10000154 | 3300025315 | Bacteria | 34024 |
| 183 | Ga0207697_10001046 | 3300025315 | Bacteria | 15346 |
| 184 | Ga0207697_10002394 | 3300025315 | Bacteria | 9769 |
| 185 | Ga0207697_10020105 | 3300025315 | Bacteria | 2734 |
| 186 | Ga0207697_10023481 | 3300025315 | Bacteria | 2525 |
| 187 | Ga0207653_10004871 | 3300025885 | Bacteria | 4193 |
| 188 | Ga0207647_10008527 | 3300025904 | Bacteria | 7339 |
| 189 | Ga0207645_10000452 | 3300025907 | Bacteria | 34086 |
| 190 | Ga0207643_10016302 | 3300025908 | Bacteria | 4052 |
| 191 | Ga0207705_10068808 | 3300025909 | Bacteria | 2564 |
| 192 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 193 | Ga0207684_10001402 | 3300025910 | Bacteria | 26187 |
| 194 | Ga0207684_10010800 | 3300025910 | Bacteria | 8015 |
| 195 | Ga0207684_10013890 | 3300025910 | Bacteria | 6955 |
| 196 | Ga0207684_10026831 | 3300025910 | Bacteria | 4912 |
| 197 | Ga0207684_10042985 | 3300025910 | Bacteria | 3831 |
| 198 | Ga0207684_10113859 | 3300025910 | Bacteria | 2316 |
| 199 | Ga0207684_10167123 | 3300025910 | Unclassified | 1896 |
| 200 | Ga0207707_10033066 | 3300025912 | Bacteria | 4526 |
| 201 | Ga0207695_10018183 | 3300025913 | Bacteria | 8133 |
| 202 | Ga0207695_10057235 | 3300025913 | Bacteria | 4051 |
| 203 | Ga0207693_10001024 | 3300025915 | Bacteria | 25029 |
| 204 | Ga0207693_10015348 | 3300025915 | Bacteria | 6146 |
| 205 | Ga0207693_10031288 | 3300025915 | Bacteria | 4204 |
| 206 | Ga0207663_10033014 | 3300025916 | Bacteria | 3079 |
| 207 | Ga0207663_10046166 | 3300025916 | Bacteria | 2683 |
| 208 | Ga0207662_10000206 | 3300025918 | Bacteria | 27413 |
| 209 | Ga0207662_10060357 | 3300025918 | Bacteria | 2274 |
| 210 | Ga0207657_10056868 | 3300025919 | Bacteria | 3373 |
| 211 | Ga0207657_10092018 | 3300025919 | Bacteria | 2528 |
| 212 | Ga0207646_10000130 | 3300025922 | Bacteria | 101961 |
| 213 | Ga0207646_10003322 | 3300025922 | Bacteria | 18296 |
| 214 | Ga0207646_10011030 | 3300025922 | Bacteria | 8774 |
| 215 | Ga0207646_10012823 | 3300025922 | Bacteria | 8033 |
| 216 | Ga0207646_10075742 | 3300025922 | Bacteria | 3006 |
| 217 | Ga0207646_10083871 | 3300025922 | Unclassified | 2850 |
| 218 | Ga0207646_10129070 | 3300025922 | Bacteria | 2274 |
| 219 | Ga0207681_10031032 | 3300025923 | Bacteria | 3487 |
| 220 | Ga0207694_10000001 | 3300025924 | Bacteria | 4078485 |
| 221 | Ga0207650_10001066 | 3300025925 | Bacteria | 20411 |
| 222 | Ga0207650_10109599 | 3300025925 | Bacteria | 2135 |
| 223 | Ga0207659_10024089 | 3300025926 | Bacteria | 4073 |
| 224 | Ga0207659_10089410 | 3300025926 | Bacteria | 2296 |
| 225 | Ga0207687_10000006 | 3300025927 | Bacteria | 641680 |
| 226 | Ga0207687_10003907 | 3300025927 | Bacteria | 9998 |
| 227 | Ga0207687_10005280 | 3300025927 | Bacteria | 8563 |
| 228 | Ga0207700_10038571 | 3300025928 | Bacteria | 3468 |
| 229 | Ga0207644_10004654 | 3300025931 | Bacteria | 8918 |
| 230 | Ga0207706_10000716 | 3300025933 | Bacteria | 34628 |
| 231 | Ga0207706_10070733 | 3300025933 | Bacteria | 3069 |
| 232 | Ga0207706_10078748 | 3300025933 | Bacteria | 2899 |
| 233 | Ga0207706_10082067 | 3300025933 | Bacteria | 2833 |
| 234 | Ga0207686_10073921 | 3300025934 | Unclassified | 2201 |
| 235 | Ga0207709_10061387 | 3300025935 | Bacteria | 2349 |
| 236 | Ga0207670_10000831 | 3300025936 | Bacteria | 16168 |
| 237 | Ga0207670_10030630 | 3300025936 | Bacteria | 3438 |
| 238 | Ga0207669_10003345 | 3300025937 | Bacteria | 6940 |
| 239 | Ga0207691_10000288 | 3300025940 | Bacteria | 49679 |
| 240 | Ga0207689_10007428 | 3300025942 | Bacteria | 9610 |
| 241 | Ga0207689_10040832 | 3300025942 | Bacteria | 3839 |
| 242 | Ga0207661_10000004 | 3300025944 | Bacteria | 606391 |
| 243 | Ga0207679_10041107 | 3300025945 | Bacteria | 3314 |
| 244 | Ga0207651_10035316 | 3300025960 | Unclassified | 3248 |
| 245 | Ga0207712_10008901 | 3300025961 | Bacteria | 6349 |
| 246 | Ga0207668_10002215 | 3300025972 | Bacteria | 11332 |
| 247 | Ga0207640_10012252 | 3300025981 | Bacteria | 4880 |
| 248 | Ga0207658_10039843 | 3300025986 | Bacteria | 3392 |
| 249 | Ga0207658_10081909 | 3300025986 | Bacteria | 2476 |
| 250 | Ga0207677_10000215 | 3300026023 | Bacteria | 45951 |
| 251 | Ga0207677_10000442 | 3300026023 | Bacteria | 28083 |
| 252 | Ga0207703_10000160 | 3300026035 | Bacteria | 77872 |
| 253 | Ga0207639_10000007 | 3300026041 | Bacteria | 451321 |
| 254 | Ga0207708_10035883 | 3300026075 | Bacteria | 3772 |
| 255 | Ga0207676_10000045 | 3300026095 | Bacteria | 153346 |
| 256 | Ga0207676_10036759 | 3300026095 | Bacteria | 3728 |
| 257 | Ga0207683_10010873 | 3300026121 | Bacteria | 7762 |
| 258 | Ga0207683_10046498 | 3300026121 | Bacteria | 3798 |
| 259 | Ga0207683_10062464 | 3300026121 | Bacteria | 3280 |
| 260 | Ga0209179_1005180 | 3300027512 | Bacteria | 2022 |
| 261 | Ga0268266_10073696 | 3300028379 | Unclassified | 2963 |
| 262 | Ga0268266_10150997 | 3300028379 | Bacteria | 2094 |
| 263 | Ga0268264_10028608 | 3300028381 | Bacteria | 4560 |
| 264 | Ga0268264_10150477 | 3300028381 | Bacteria | 2086 |
| 265 | Ga0265319_1001013 | 3300028563 | Bacteria | 17557 |
| 266 | Ga0265334_10002411 | 3300028573 | Bacteria | 8791 |
| 267 | Ga0265318_10000002 | 3300028577 | Bacteria | 428208 |
| 268 | Ga0265323_10000814 | 3300028653 | Bacteria | 16731 |
| 269 | Ga0265322_10000533 | 3300028654 | Bacteria | 14627 |
| 270 | Ga0265338_10022441 | 3300028800 | Bacteria | 6534 |
| 271 | Ga0307511_10010013 | 3300030521 | Bacteria | 9430 |
| 272 | Ga0265320_10000557 | 3300031240 | Bacteria | 28713 |
| 273 | Ga0265331_10016764 | 3300031250 | Bacteria | 3838 |
| 274 | Ga0265331_10028750 | 3300031250 | Bacteria | 2778 |
| 275 | Ga0265316_10027709 | 3300031344 | Bacteria | 4684 |
| 276 | Ga0265316_10035417 | 3300031344 | Bacteria | 4046 |
| 277 | Ga0265313_10000016 | 3300031595 | Bacteria | 154004 |
| 278 | Ga0265313_10001890 | 3300031595 | Bacteria | 19029 |
| 279 | Ga0265314_10003608 | 3300031711 | Bacteria | 14888 |
| 280 | Ga0373953_0056222 | 3300035117 | Unclassified | 1600 |
| 281 | Ga0373957_0067525 | 3300035120 | Bacteria | 1394 |
| 282 | Ga0373927_0080335 | 3300035695 | Bacteria | 2113 |
| 283 | Ga0373947_0145222 | 3300035725 | Bacteria | 1525 |
| 284 | Ga0373937_0002774 | 3300036401 | Bacteria | 14628 |
| 285 | Ga0395900_0016785 | 3300037418 | Bacteria | 7468 |
| 286 | Ga0395900_0043999 | 3300037418 | Bacteria | 4602 |
| 287 | Ga0395898_0005648 | 3300037466 | Bacteria | 13485 |
| 288 | Ga0395901_0007774 | 3300038443 | Bacteria | 10819 |
| 289 | Ga0395901_0129915 | 3300038443 | Bacteria | 2647 |
| 290 | Ga0395901_0133187 | 3300038443 | Bacteria | 2612 |
| 291 | Ga0436365_0848588 | 3300039437 | Bacteria | 4192 |
| 292 | Ga0436365_0887380 | 3300039437 | Bacteria | 42160 |
| 293 | Ga0436365_1042279 | 3300039437 | Bacteria | 224225 |
| 294 | Ga0436365_1094017 | 3300039437 | Bacteria | 14202 |
| 295 | Ga0436365_1732936 | 3300039437 | Unclassified | 2817 |
| 296 | Ga0436360_0921978 | 3300039438 | Bacteria | 1635 |
| 297 | Ga0436362_0325181 | 3300039453 | Bacteria | 30390 |
| 298 | Ga0451576_0000396 | 3300045051 | Bacteria | 101504 |
| 299 | Ga0451576_0004772 | 3300045051 | Bacteria | 17380 |
| 300 | Ga0451576_0051026 | 3300045051 | Bacteria | 4338 |
| 301 | Ga0495592_0016807 | 3300046454 | Bacteria | 5555 |
| 302 | Ga0495651_0054516 | 3300046462 | Bacteria | 3074 |
| 303 | Ga0495580_0041604 | 3300046472 | Bacteria | 3277 |
| 304 | Ga0495608_0142755 | 3300046511 | Unclassified | 1528 |
| 305 | Ga0495628_0010496 | 3300046516 | Bacteria | 7865 |
| 306 | Ga0495652_0023735 | 3300046529 | Bacteria | 5436 |
| 307 | Ga0495586_0084542 | 3300046535 | Unclassified | 1747 |
| 308 | Ga0495587_0060268 | 3300046536 | Bacteria | 2226 |
| 309 | Ga0495645_0027961 | 3300046543 | Bacteria | 4096 |
| 310 | Ga0495634_0006511 | 3300046642 | Bacteria | 8872 |
| 311 | Ga0495634_0065275 | 3300046642 | Bacteria | 2413 |
| 312 | Ga0495599_0005721 | 3300046678 | Bacteria | 7457 |
| 313 | Ga0495623_0039331 | 3300046679 | Bacteria | 3023 |
| 314 | Ga0495646_0032209 | 3300046680 | Bacteria | 3263 |
| 315 | Ga0495669_0032197 | 3300046684 | Bacteria | 2304 |
| 316 | Ga0495600_0064991 | 3300046809 | Bacteria | 2385 |
| 317 | Ga0495604_0024601 | 3300047317 | Bacteria | 4804 |
| 318 | Ga0495684_0026972 | 3300047471 | Bacteria | 4413 |
| 319 | Ga0495593_0042099 | 3300047673 | Bacteria | 2453 |
| 320 | Ga0495602_0026528 | 3300048088 | Bacteria | 5586 |
| 321 | Ga0496104_0380043 | 3300048907 | Unclassified | 1325 |
| 322 | Ga0496105_0139156 | 3300048908 | Bacteria | 1999 |
| 323 | Ga0496105_0186811 | 3300048908 | Bacteria | 1696 |
| 324 | Ga0496107_0033044 | 3300048910 | Bacteria | 3700 |
| 325 | Ga0496108_0017306 | 3300048911 | Bacteria | 5896 |
| 326 | Ga0496109_0051304 | 3300048912 | Bacteria | 3758 |
| 327 | Ga0496112_0074395 | 3300048915 | Bacteria | 3359 |
| 328 | Ga0496112_0088766 | 3300048915 | Bacteria | 3060 |
| 329 | Ga0496112_0097221 | 3300048915 | Unclassified | 2915 |
| 330 | Ga0501047_0051491 | 3300049581 | Bacteria | 3979 |
| 331 | nmdc:mga05p37_27295_c1 | 3300050507 | Bacteria | 6951 |
| 332 | nmdc:mga05p37_75010_c2 | 3300050507 | Bacteria | 2157 |
| 333 | nmdc:mga0rr50_3734_c1 | 3300050513 | Bacteria | 8822 |
| 334 | nmdc:mga0rr50_4046_c1 | 3300050513 | Bacteria | 8555 |
| 335 | nmdc:mga08x19_6873_c1 | 3300050514 | Bacteria | 6753 |
| 336 | Ga0495601_0003033 | 3300053077 | Bacteria | 9574 |
| 337 | Ga0495601_0036520 | 3300053077 | Bacteria | 3069 |
| 338 | Ga0495612_0057370 | 3300053078 | Bacteria | 1608 |
| 339 | Ga0495655_0000376 | 3300053083 | Bacteria | 7717 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005445 | Ga0070708_100178298 | Ga0070708_1001782982 | 332 |
| 2 | 3300006028 | Ga0070717_10000011 | Ga0070717_10000011137 | 335 |
| 3 | 3300009093 | Ga0105240_10005497 | Ga0105240_100054978 | 338 |
| 4 | 3300025913 | Ga0207695_10057235 | Ga0207695_100572352 | 338 |
| 5 | 3300005467 | Ga0070706_100005772 | Ga0070706_1000057722 | 339 |
| 6 | 3300028800 | Ga0265338_10022441 | Ga0265338_100224412 | 339 |
| 7 | 3300005471 | Ga0070698_100011801 | Ga0070698_1000118012 | 341 |
| 8 | 3300005471 | Ga0070698_100062213 | Ga0070698_1000622134 | 341 |
| 9 | 3300021384 | Ga0213876_10020780 | Ga0213876_100207802 | 341 |
| 10 | 3300039437 | Ga0436365_0848588 | Ga0436365_0848588_1268_2614 | 341 |
| 11 | 3300006358 | Ga0068871_100162148 | Ga0068871_1001621482 | 344 |
| 12 | 3300031344 | Ga0265316_10035417 | Ga0265316_100354173 | 346 |
| 13 | 3300039437 | Ga0436365_1732936 | Ga0436365_1732936_317_1624 | 346 |
| 14 | 3300039438 | Ga0436360_0921978 | Ga0436360_0921978_163_1416 | 346 |
| 15 | 3300045051 | Ga0451576_0000396 | Ga0451576_0000396_41780_43180 | 346 |
| 16 | 3300005578 | Ga0068854_100011698 | Ga0068854_1000116982 | 347 |
| 17 | 3300009551 | Ga0105238_10000018 | Ga0105238_1000001877 | 347 |
| 18 | 3300025924 | Ga0207694_10000001 | Ga0207694_10000001820 | 347 |
| 19 | 3300025981 | Ga0207640_10012252 | Ga0207640_100122524 | 347 |
| 20 | 3300037418 | Ga0395900_0016785 | Ga0395900_0016785_1932_3320 | 347 |
| 21 | 3300038443 | Ga0395901_0133187 | Ga0395901_0133187_414_1802 | 347 |
| 22 | 3300005289 | Ga0065704_10009537 | Ga0065704_100095371 | 349 |
| 23 | 3300005445 | Ga0070708_100163064 | Ga0070708_1001630642 | 350 |
| 24 | 3300005536 | Ga0070697_100016601 | Ga0070697_1000166012 | 350 |
| 25 | 3300046684 | Ga0495669_0032197 | Ga0495669_0032197_622_2025 | 352 |
| 26 | 3300025933 | Ga0207706_10070733 | Ga0207706_100707332 | 353 |
| 27 | 3300028381 | Ga0268264_10150477 | Ga0268264_101504772 | 353 |
| 28 | 3300005439 | Ga0070711_100002697 | Ga0070711_1000026976 | 354 |
| 29 | 3300006175 | Ga0070712_100002101 | Ga0070712_1000021019 | 354 |
| 30 | 3300013306 | Ga0163162_10004883 | Ga0163162_100048835 | 354 |
| 31 | 3300025915 | Ga0207693_10001024 | Ga0207693_1000102419 | 354 |
| 32 | 3300025916 | Ga0207663_10033014 | Ga0207663_100330142 | 354 |
| 33 | 3300013308 | Ga0157375_10000774 | Ga0157375_1000077419 | 355 |
| 34 | 3300021441 | Ga0213871_10003292 | Ga0213871_100032922 | 355 |
| 35 | 3300039437 | Ga0436365_0887380 | Ga0436365_0887380_31800_33209 | 357 |
| 36 | 3300013297 | Ga0157378_10003503 | Ga0157378_100035031 | 358 |
| 37 | 3300035695 | Ga0373927_0080335 | Ga0373927_0080335_302_1672 | 358 |
| 38 | 3300045051 | Ga0451576_0051026 | Ga0451576_0051026_2568_3959 | 358 |
| 39 | 3300046472 | Ga0495580_0041604 | Ga0495580_0041604_543_1913 | 358 |
| 40 | 3300048907 | Ga0496104_0380043 | Ga0496104_0380043_52_1290 | 358 |
| 41 | 3300005331 | Ga0070670_100001232 | Ga0070670_10000123214 | 359 |
| 42 | 3300005467 | Ga0070706_100005046 | Ga0070706_1000050464 | 359 |
| 43 | 3300005467 | Ga0070706_100023644 | Ga0070706_1000236444 | 359 |
| 44 | 3300005467 | Ga0070706_100053980 | Ga0070706_1000539801 | 359 |
| 45 | 3300005468 | Ga0070707_100015861 | Ga0070707_1000158612 | 359 |
| 46 | 3300025910 | Ga0207684_10010800 | Ga0207684_100108005 | 359 |
| 47 | 3300025910 | Ga0207684_10042985 | Ga0207684_100429852 | 359 |
| 48 | 3300025922 | Ga0207646_10011030 | Ga0207646_100110305 | 359 |
| 49 | 3300025925 | Ga0207650_10001066 | Ga0207650_1000106614 | 359 |
| 50 | 3300005445 | Ga0070708_100031528 | Ga0070708_1000315283 | 360 |
| 51 | 3300005367 | Ga0070667_100132137 | Ga0070667_1001321372 | 362 |
| 52 | 3300005458 | Ga0070681_10040739 | Ga0070681_100407393 | 362 |
| 53 | 3300005535 | Ga0070684_100137540 | Ga0070684_1001375402 | 362 |
| 54 | 3300005548 | Ga0070665_100048546 | Ga0070665_1000485464 | 362 |
| 55 | 3300009174 | Ga0105241_10058856 | Ga0105241_100588563 | 362 |
| 56 | 3300013296 | Ga0157374_10000005 | Ga0157374_10000005244 | 362 |
| 57 | 3300014745 | Ga0157377_10000001 | Ga0157377_10000001329 | 362 |
| 58 | 3300014969 | Ga0157376_10000022 | Ga0157376_1000002234 | 362 |
| 59 | 3300025912 | Ga0207707_10033066 | Ga0207707_100330663 | 362 |
| 60 | 3300046642 | Ga0495634_0006511 | Ga0495634_0006511_1496_2857 | 362 |
| 61 | 3300047471 | Ga0495684_0026972 | Ga0495684_0026972_96_1457 | 362 |
| 62 | 3300048908 | Ga0496105_0139156 | Ga0496105_0139156_298_1659 | 362 |
| 63 | 3300048915 | Ga0496112_0074395 | Ga0496112_0074395_781_2139 | 362 |
| 64 | 3300005456 | Ga0070678_100070408 | Ga0070678_1000704082 | 364 |
| 65 | 3300030521 | Ga0307511_10010013 | Ga0307511_100100134 | 364 |
| 66 | 3300005290 | Ga0065712_10007182 | Ga0065712_100071823 | 365 |
| 67 | 3300005329 | Ga0070683_100148993 | Ga0070683_1001489933 | 365 |
| 68 | 3300005467 | Ga0070706_100000210 | Ga0070706_10000021027 | 365 |
| 69 | 3300005471 | Ga0070698_100029150 | Ga0070698_1000291504 | 365 |
| 70 | 3300005544 | Ga0070686_100082401 | Ga0070686_1000824012 | 365 |
| 71 | 3300005614 | Ga0068856_100254944 | Ga0068856_1002549442 | 365 |
| 72 | 3300006028 | Ga0070717_10014821 | Ga0070717_100148212 | 365 |
| 73 | 3300013307 | Ga0157372_10329787 | Ga0157372_103297872 | 365 |
| 74 | 3300013308 | Ga0157375_10046910 | Ga0157375_100469103 | 365 |
| 75 | 3300025315 | Ga0207697_10000154 | Ga0207697_100001549 | 365 |
| 76 | 3300025910 | Ga0207684_10000028 | Ga0207684_1000002854 | 365 |
| 77 | 3300025919 | Ga0207657_10056868 | Ga0207657_100568682 | 365 |
| 78 | 3300005328 | Ga0070676_10005723 | Ga0070676_100057237 | 366 |
| 79 | 3300005338 | Ga0068868_100072215 | Ga0068868_1000722151 | 366 |
| 80 | 3300005340 | Ga0070689_100023735 | Ga0070689_1000237353 | 366 |
| 81 | 3300005343 | Ga0070687_100002227 | Ga0070687_1000022277 | 366 |
| 82 | 3300005347 | Ga0070668_100007088 | Ga0070668_1000070884 | 366 |
| 83 | 3300005353 | Ga0070669_100011294 | Ga0070669_1000112944 | 366 |
| 84 | 3300005354 | Ga0070675_100003374 | Ga0070675_1000033747 | 366 |
| 85 | 3300005367 | Ga0070667_100004159 | Ga0070667_1000041596 | 366 |
| 86 | 3300005457 | Ga0070662_100005938 | Ga0070662_1000059383 | 366 |
| 87 | 3300005840 | Ga0068870_10045415 | Ga0068870_100454151 | 366 |
| 88 | 3300005843 | Ga0068860_100013278 | Ga0068860_1000132782 | 366 |
| 89 | 3300005844 | Ga0068862_100011679 | Ga0068862_1000116794 | 366 |
| 90 | 3300009148 | Ga0105243_10008437 | Ga0105243_100084375 | 366 |
| 91 | 3300009553 | Ga0105249_10001798 | Ga0105249_1000179814 | 366 |
| 92 | 3300013102 | Ga0157371_10205988 | Ga0157371_102059881 | 366 |
| 93 | 3300013296 | Ga0157374_10008046 | Ga0157374_100080467 | 366 |
| 94 | 3300013297 | Ga0157378_10009982 | Ga0157378_100099825 | 366 |
| 95 | 3300025315 | Ga0207697_10000048 | Ga0207697_1000004825 | 366 |
| 96 | 3300025907 | Ga0207645_10000452 | Ga0207645_1000045227 | 366 |
| 97 | 3300025918 | Ga0207662_10000206 | Ga0207662_1000020613 | 366 |
| 98 | 3300025923 | Ga0207681_10031032 | Ga0207681_100310323 | 366 |
| 99 | 3300025926 | Ga0207659_10024089 | Ga0207659_100240893 | 366 |
| 100 | 3300025933 | Ga0207706_10000716 | Ga0207706_1000071626 | 366 |
| 101 | 3300025935 | Ga0207709_10061387 | Ga0207709_100613871 | 366 |
| 102 | 3300025937 | Ga0207669_10003345 | Ga0207669_100033452 | 366 |
| 103 | 3300025961 | Ga0207712_10008901 | Ga0207712_100089016 | 366 |
| 104 | 3300025972 | Ga0207668_10002215 | Ga0207668_100022158 | 366 |
| 105 | 3300025986 | Ga0207658_10081909 | Ga0207658_100819091 | 366 |
| 106 | 3300028381 | Ga0268264_10028608 | Ga0268264_100286082 | 366 |
| 107 | 3300045051 | Ga0451576_0004772 | Ga0451576_0004772_3539_4939 | 366 |
| 108 | 3300046535 | Ga0495586_0084542 | Ga0495586_0084542_63_1424 | 366 |
| 109 | 3300047673 | Ga0495593_0042099 | Ga0495593_0042099_104_1465 | 366 |
| 110 | 3300048910 | Ga0496107_0033044 | Ga0496107_0033044_255_1655 | 366 |
| 111 | 3300005293 | Ga0065715_10108090 | Ga0065715_101080902 | 367 |
| 112 | 3300005330 | Ga0070690_100013449 | Ga0070690_1000134493 | 367 |
| 113 | 3300005354 | Ga0070675_100042853 | Ga0070675_1000428532 | 367 |
| 114 | 3300005364 | Ga0070673_100036483 | Ga0070673_1000364833 | 367 |
| 115 | 3300005456 | Ga0070678_100059040 | Ga0070678_1000590403 | 367 |
| 116 | 3300005548 | Ga0070665_100016600 | Ga0070665_1000166004 | 367 |
| 117 | 3300009176 | Ga0105242_10185077 | Ga0105242_101850771 | 367 |
| 118 | 3300013296 | Ga0157374_10106402 | Ga0157374_101064023 | 367 |
| 119 | 3300013297 | Ga0157378_10077580 | Ga0157378_100775803 | 367 |
| 120 | 3300013306 | Ga0163162_10152333 | Ga0163162_101523332 | 367 |
| 121 | 3300013306 | Ga0163162_10315197 | Ga0163162_103151972 | 367 |
| 122 | 3300013308 | Ga0157375_10032301 | Ga0157375_100323013 | 367 |
| 123 | 3300025271 | Ga0207666_1001647 | Ga0207666_10016473 | 367 |
| 124 | 3300025290 | Ga0207673_1000337 | Ga0207673_10003374 | 367 |
| 125 | 3300025315 | Ga0207697_10002394 | Ga0207697_100023949 | 367 |
| 126 | 3300025910 | Ga0207684_10001402 | Ga0207684_1000140217 | 367 |
| 127 | 3300025934 | Ga0207686_10073921 | Ga0207686_100739212 | 367 |
| 128 | 3300025960 | Ga0207651_10035316 | Ga0207651_100353163 | 367 |
| 129 | 3300025986 | Ga0207658_10039843 | Ga0207658_100398433 | 367 |
| 130 | 3300028379 | Ga0268266_10073696 | Ga0268266_100736962 | 367 |
| 131 | 3300048915 | Ga0496112_0097221 | Ga0496112_0097221_1285_2643 | 367 |
| 132 | 3300005290 | Ga0065712_10102235 | Ga0065712_101022352 | 368 |
| 133 | 3300005293 | Ga0065715_10091779 | Ga0065715_100917792 | 368 |
| 134 | 3300005329 | Ga0070683_100000044 | Ga0070683_10000004458 | 368 |
| 135 | 3300005338 | Ga0068868_100000142 | Ga0068868_10000014227 | 368 |
| 136 | 3300005435 | Ga0070714_100059262 | Ga0070714_1000592622 | 368 |
| 137 | 3300005468 | Ga0070707_100153756 | Ga0070707_1001537561 | 368 |
| 138 | 3300005535 | Ga0070684_100000032 | Ga0070684_10000003234 | 368 |
| 139 | 3300005535 | Ga0070684_100000274 | Ga0070684_10000027418 | 368 |
| 140 | 3300005842 | Ga0068858_100008989 | Ga0068858_1000089897 | 368 |
| 141 | 3300013105 | Ga0157369_10000111 | Ga0157369_100001116 | 368 |
| 142 | 3300025904 | Ga0207647_10008527 | Ga0207647_100085272 | 368 |
| 143 | 3300025919 | Ga0207657_10092018 | Ga0207657_100920182 | 368 |
| 144 | 3300025928 | Ga0207700_10038571 | Ga0207700_100385713 | 368 |
| 145 | 3300025944 | Ga0207661_10000004 | Ga0207661_10000004388 | 368 |
| 146 | 3300025945 | Ga0207679_10041107 | Ga0207679_100411072 | 368 |
| 147 | 3300026023 | Ga0207677_10000442 | Ga0207677_100004424 | 368 |
| 148 | 3300026121 | Ga0207683_10010873 | Ga0207683_100108734 | 368 |
| 149 | 3300048908 | Ga0496105_0186811 | Ga0496105_0186811_92_1450 | 368 |
| 150 | 3300048912 | Ga0496109_0051304 | Ga0496109_0051304_963_2324 | 368 |
| 151 | 3300046679 | Ga0495623_0039331 | Ga0495623_0039331_1748_3001 | 369 |
| 152 | 3300053078 | Ga0495612_0057370 | Ga0495612_0057370_345_1598 | 369 |
| 153 | 3300005546 | Ga0070696_100030976 | Ga0070696_1000309763 | 370 |
| 154 | 3300025922 | Ga0207646_10083871 | Ga0207646_100838711 | 370 |
| 155 | 3300025922 | Ga0207646_10129070 | Ga0207646_101290702 | 370 |
| 156 | 3300005548 | Ga0070665_100164534 | Ga0070665_1001645342 | 371 |
| 157 | 3300006237 | Ga0097621_100077149 | Ga0097621_1000771492 | 371 |
| 158 | 3300025315 | Ga0207697_10023481 | Ga0207697_100234812 | 371 |
| 159 | 3300025931 | Ga0207644_10004654 | Ga0207644_100046546 | 371 |
| 160 | 3300028379 | Ga0268266_10150997 | Ga0268266_101509971 | 371 |
| 161 | 3300035725 | Ga0373947_0145222 | Ga0373947_0145222_35_1396 | 371 |
| 162 | 3300005438 | Ga0070701_10000989 | Ga0070701_100009894 | 372 |
| 163 | 3300006871 | Ga0075434_100117552 | Ga0075434_1001175522 | 372 |
| 164 | 3300013297 | Ga0157378_10008747 | Ga0157378_100087474 | 372 |
| 165 | 3300014745 | Ga0157377_10000072 | Ga0157377_1000007237 | 372 |
| 166 | 3300025942 | Ga0207689_10040832 | Ga0207689_100408322 | 372 |
| 167 | 3300035117 | Ga0373953_0056222 | Ga0373953_0056222_171_1529 | 372 |
| 168 | 3300046454 | Ga0495592_0016807 | Ga0495592_0016807_606_1964 | 372 |
| 169 | 3300046511 | Ga0495608_0142755 | Ga0495608_0142755_47_1405 | 372 |
| 170 | 3300046516 | Ga0495628_0010496 | Ga0495628_0010496_5383_6741 | 372 |
| 171 | 3300046536 | Ga0495587_0060268 | Ga0495587_0060268_255_1613 | 372 |
| 172 | 3300046543 | Ga0495645_0027961 | Ga0495645_0027961_1346_2704 | 372 |
| 173 | 3300046678 | Ga0495599_0005721 | Ga0495599_0005721_1929_3287 | 372 |
| 174 | 3300046680 | Ga0495646_0032209 | Ga0495646_0032209_1612_2970 | 372 |
| 175 | 3300048088 | Ga0495602_0026528 | Ga0495602_0026528_2912_4270 | 372 |
| 176 | 3300053077 | Ga0495601_0003033 | Ga0495601_0003033_3116_4474 | 372 |
| 177 | 3300005445 | Ga0070708_100031799 | Ga0070708_1000317993 | 373 |
| 178 | 3300005467 | Ga0070706_100039096 | Ga0070706_1000390964 | 373 |
| 179 | 3300025918 | Ga0207662_10060357 | Ga0207662_100603572 | 373 |
| 180 | 3300005293 | Ga0065715_10002825 | Ga0065715_100028252 | 374 |
| 181 | 3300005340 | Ga0070689_100000260 | Ga0070689_10000026020 | 375 |
| 182 | 3300005842 | Ga0068858_100000297 | Ga0068858_10000029729 | 375 |
| 183 | 3300009098 | Ga0105245_10001270 | Ga0105245_1000127016 | 375 |
| 184 | 3300025927 | Ga0207687_10005280 | Ga0207687_100052802 | 375 |
| 185 | 3300025936 | Ga0207670_10000831 | Ga0207670_100008312 | 375 |
| 186 | 3300026035 | Ga0207703_10000160 | Ga0207703_1000016050 | 375 |
| 187 | 3300049581 | Ga0501047_0051491 | Ga0501047_0051491_2330_3676 | 375 |
| 188 | 3300005355 | Ga0070671_100083016 | Ga0070671_1000830162 | 376 |
| 189 | 3300005937 | Ga0081455_10000314 | Ga0081455_1000031418 | 376 |
| 190 | 3300025933 | Ga0207706_10082067 | Ga0207706_100820672 | 376 |
| 191 | 3300028653 | Ga0265323_10000814 | Ga0265323_100008149 | 376 |
| 192 | 3300028654 | Ga0265322_10000533 | Ga0265322_100005337 | 376 |
| 193 | 3300031344 | Ga0265316_10027709 | Ga0265316_100277093 | 376 |
| 194 | 3300047317 | Ga0495604_0024601 | Ga0495604_0024601_1720_3078 | 376 |
| 195 | 3300002126 | JGI24035J26624_1000744 | JGI24035J26624_10007441 | 377 |
| 196 | 3300005336 | Ga0070680_100251376 | Ga0070680_1002513761 | 377 |
| 197 | 3300013307 | Ga0157372_10038070 | Ga0157372_100380705 | 377 |
| 198 | 3300025913 | Ga0207695_10018183 | Ga0207695_100181832 | 377 |
| 199 | 3300026041 | Ga0207639_10000007 | Ga0207639_10000007241 | 377 |
| 200 | 3300026121 | Ga0207683_10062464 | Ga0207683_100624644 | 377 |
| 201 | 3300027512 | Ga0209179_1005180 | Ga0209179_10051802 | 377 |
| 202 | 3300050513 | nmdc:mga0rr50_3734_c1 | nmdc:mga0rr50_3734_c1_2622_3953 | 377 |
| 203 | 3300005328 | Ga0070676_10054388 | Ga0070676_100543882 | 378 |
| 204 | 3300005355 | Ga0070671_100019906 | Ga0070671_1000199063 | 378 |
| 205 | 3300005356 | Ga0070674_100026325 | Ga0070674_1000263251 | 378 |
| 206 | 3300005543 | Ga0070672_100145631 | Ga0070672_1001456312 | 378 |
| 207 | 3300006881 | Ga0068865_100087523 | Ga0068865_1000875232 | 378 |
| 208 | 3300021384 | Ga0213876_10018646 | Ga0213876_100186463 | 378 |
| 209 | 3300026121 | Ga0207683_10046498 | Ga0207683_100464984 | 378 |
| 210 | 3300039437 | Ga0436365_1094017 | Ga0436365_1094017_2094_3398 | 378 |
| 211 | 3300048911 | Ga0496108_0017306 | Ga0496108_0017306_1825_3180 | 378 |
| 212 | 3300005457 | Ga0070662_100094678 | Ga0070662_1000946782 | 379 |
| 213 | 3300005617 | Ga0068859_100084804 | Ga0068859_1000848042 | 379 |
| 214 | 3300006028 | Ga0070717_10073358 | Ga0070717_100733581 | 379 |
| 215 | 3300006931 | Ga0097620_100084804 | Ga0097620_1000848043 | 379 |
| 216 | 3300025315 | Ga0207697_10020105 | Ga0207697_100201051 | 379 |
| 217 | 3300025942 | Ga0207689_10007428 | Ga0207689_100074286 | 379 |
| 218 | 3300005340 | Ga0070689_100097361 | Ga0070689_1000973612 | 380 |
| 219 | 3300005355 | Ga0070671_100154077 | Ga0070671_1001540772 | 380 |
| 220 | 3300005440 | Ga0070705_100032960 | Ga0070705_1000329603 | 380 |
| 221 | 3300005441 | Ga0070700_100060343 | Ga0070700_1000603432 | 380 |
| 222 | 3300005444 | Ga0070694_100084167 | Ga0070694_1000841672 | 380 |
| 223 | 3300005549 | Ga0070704_100036010 | Ga0070704_1000360103 | 380 |
| 224 | 3300005618 | Ga0068864_100076903 | Ga0068864_1000769032 | 380 |
| 225 | 3300005841 | Ga0068863_100033690 | Ga0068863_1000336903 | 380 |
| 226 | 3300005843 | Ga0068860_100109976 | Ga0068860_1001099762 | 380 |
| 227 | 3300007076 | Ga0075435_100019674 | Ga0075435_1000196745 | 380 |
| 228 | 3300013308 | Ga0157375_10128002 | Ga0157375_101280023 | 380 |
| 229 | 3300025315 | Ga0207697_10001046 | Ga0207697_100010462 | 380 |
| 230 | 3300025885 | Ga0207653_10004871 | Ga0207653_100048712 | 380 |
| 231 | 3300025915 | Ga0207693_10015348 | Ga0207693_100153483 | 380 |
| 232 | 3300025933 | Ga0207706_10078748 | Ga0207706_100787482 | 380 |
| 233 | 3300026075 | Ga0207708_10035883 | Ga0207708_100358834 | 380 |
| 234 | 3300026095 | Ga0207676_10036759 | Ga0207676_100367593 | 380 |
| 235 | 3300053083 | Ga0495655_0000376 | Ga0495655_0000376_158_1477 | 380 |
| 236 | 3300005295 | Ga0065707_10124266 | Ga0065707_101242662 | 381 |
| 237 | 3300005536 | Ga0070697_100018194 | Ga0070697_1000181942 | 381 |
| 238 | 3300009098 | Ga0105245_10000006 | Ga0105245_10000006189 | 381 |
| 239 | 3300025908 | Ga0207643_10016302 | Ga0207643_100163022 | 381 |
| 240 | 3300025927 | Ga0207687_10000006 | Ga0207687_10000006251 | 381 |
| 241 | 3300005293 | Ga0065715_10092183 | Ga0065715_100921833 | 382 |
| 242 | 3300005468 | Ga0070707_100000632 | Ga0070707_10000063224 | 382 |
| 243 | 3300009094 | Ga0111539_10248326 | Ga0111539_102483262 | 382 |
| 244 | 3300013308 | Ga0157375_10000014 | Ga0157375_10000014156 | 382 |
| 245 | 3300025922 | Ga0207646_10003322 | Ga0207646_100033222 | 382 |
| 246 | 3300025940 | Ga0207691_10000288 | Ga0207691_1000028831 | 382 |
| 247 | 3300005331 | Ga0070670_100031913 | Ga0070670_1000319132 | 383 |
| 248 | 3300005445 | Ga0070708_100075157 | Ga0070708_1000751572 | 383 |
| 249 | 3300005467 | Ga0070706_100036810 | Ga0070706_1000368104 | 383 |
| 250 | 3300005468 | Ga0070707_100013638 | Ga0070707_1000136383 | 383 |
| 251 | 3300005471 | Ga0070698_100000633 | Ga0070698_10000063337 | 383 |
| 252 | 3300006358 | Ga0068871_100042159 | Ga0068871_1000421592 | 383 |
| 253 | 3300013296 | Ga0157374_10056844 | Ga0157374_100568443 | 383 |
| 254 | 3300013306 | Ga0163162_10035138 | Ga0163162_100351383 | 383 |
| 255 | 3300013308 | Ga0157375_10007640 | Ga0157375_100076406 | 383 |
| 256 | 3300025910 | Ga0207684_10026831 | Ga0207684_100268312 | 383 |
| 257 | 3300025910 | Ga0207684_10113859 | Ga0207684_101138592 | 383 |
| 258 | 3300025922 | Ga0207646_10012823 | Ga0207646_100128237 | 383 |
| 259 | 3300025925 | Ga0207650_10109599 | Ga0207650_101095992 | 383 |
| 260 | 3300048915 | Ga0496112_0088766 | Ga0496112_0088766_968_2323 | 383 |
| 261 | 3300050507 | nmdc:mga05p37_75010_c2 | nmdc:mga05p37_75010_c2_144_1505 | 383 |
| 262 | 3300013297 | Ga0157378_10008415 | Ga0157378_100084154 | 384 |
| 263 | 3300028573 | Ga0265334_10002411 | Ga0265334_100024117 | 384 |
| 264 | 3300028577 | Ga0265318_10000002 | Ga0265318_10000002273 | 384 |
| 265 | 3300031250 | Ga0265331_10016764 | Ga0265331_100167643 | 384 |
| 266 | 3300031595 | Ga0265313_10001890 | Ga0265313_1000189016 | 384 |
| 267 | 3300031711 | Ga0265314_10003608 | Ga0265314_100036087 | 384 |
| 268 | 3300005467 | Ga0070706_100020133 | Ga0070706_1000201332 | 385 |
| 269 | 3300028563 | Ga0265319_1001013 | Ga0265319_100101313 | 385 |
| 270 | 3300031240 | Ga0265320_10000557 | Ga0265320_1000055712 | 385 |
| 271 | 3300031250 | Ga0265331_10028750 | Ga0265331_100287503 | 385 |
| 272 | 3300031595 | Ga0265313_10000016 | Ga0265313_1000001639 | 385 |
| 273 | 3300005937 | Ga0081455_10011210 | Ga0081455_100112103 | 386 |
| 274 | 3300006028 | Ga0070717_10002496 | Ga0070717_1000249610 | 386 |
| 275 | 3300009098 | Ga0105245_10115069 | Ga0105245_101150692 | 386 |
| 276 | 3300021358 | Ga0213873_10000153 | Ga0213873_1000015312 | 386 |
| 277 | 3300021384 | Ga0213876_10000386 | Ga0213876_1000038626 | 386 |
| 278 | 3300035120 | Ga0373957_0067525 | Ga0373957_0067525_12_1304 | 386 |
| 279 | 3300038443 | Ga0395901_0129915 | Ga0395901_0129915_296_1657 | 386 |
| 280 | 3300039437 | Ga0436365_1042279 | Ga0436365_1042279_207380_208720 | 386 |
| 281 | 3300039453 | Ga0436362_0325181 | Ga0436362_0325181_10408_11748 | 386 |
| 282 | 3300013307 | Ga0157372_10346825 | Ga0157372_103468252 | 387 |
| 283 | 3300025915 | Ga0207693_10031288 | Ga0207693_100312883 | 387 |
| 284 | 3300037418 | Ga0395900_0043999 | Ga0395900_0043999_2287_3723 | 387 |
| 285 | 3300037466 | Ga0395898_0005648 | Ga0395898_0005648_5652_7088 | 387 |
| 286 | 3300038443 | Ga0395901_0007774 | Ga0395901_0007774_4499_5935 | 387 |
| 287 | 3300005338 | Ga0068868_100001479 | Ga0068868_1000014794 | 388 |
| 288 | 3300005471 | Ga0070698_100055617 | Ga0070698_1000556171 | 388 |
| 289 | 3300013297 | Ga0157378_10006014 | Ga0157378_100060145 | 388 |
| 290 | 3300026023 | Ga0207677_10000215 | Ga0207677_1000021512 | 388 |
| 291 | 3300005327 | Ga0070658_10156424 | Ga0070658_101564241 | 389 |
| 292 | 3300005436 | Ga0070713_100033556 | Ga0070713_1000335563 | 389 |
| 293 | 3300006028 | Ga0070717_10000097 | Ga0070717_1000009751 | 389 |
| 294 | 3300006914 | Ga0075436_100003381 | Ga0075436_1000033816 | 389 |
| 295 | 3300007076 | Ga0075435_100000040 | Ga0075435_10000004041 | 389 |
| 296 | 3300013297 | Ga0157378_10007399 | Ga0157378_100073992 | 389 |
| 297 | 3300013308 | Ga0157375_10000047 | Ga0157375_1000004797 | 389 |
| 298 | 3300025909 | Ga0207705_10068808 | Ga0207705_100688082 | 389 |
| 299 | 3300026095 | Ga0207676_10000045 | Ga0207676_1000004535 | 389 |
| 300 | 3300050513 | nmdc:mga0rr50_4046_c1 | nmdc:mga0rr50_4046_c1_399_1718 | 389 |
| 301 | 3300050514 | nmdc:mga08x19_6873_c1 | nmdc:mga08x19_6873_c1_4804_6123 | 389 |
| 302 | 3300005536 | Ga0070697_100016795 | Ga0070697_1000167952 | 390 |
| 303 | 3300009545 | Ga0105237_10285897 | Ga0105237_102858972 | 390 |
| 304 | 3300010375 | Ga0105239_10040865 | Ga0105239_100408654 | 390 |
| 305 | 3300013306 | Ga0163162_10099250 | Ga0163162_100992502 | 390 |
| 306 | 3300025927 | Ga0207687_10003907 | Ga0207687_100039073 | 390 |
| 307 | 3300005518 | Ga0070699_100165776 | Ga0070699_1001657761 | 393 |
| 308 | 3300000545 | CNXas_1000022 | CNXas_100002229 | 396 |
| 309 | 3300005272 | Ga0065703_1020349 | Ga0065703_10203491 | 396 |
| 310 | 3300005331 | Ga0070670_100062417 | Ga0070670_1000624173 | 396 |
| 311 | 3300005340 | Ga0070689_100036173 | Ga0070689_1000361733 | 396 |
| 312 | 3300005439 | Ga0070711_100017729 | Ga0070711_1000177293 | 396 |
| 313 | 3300005445 | Ga0070708_100102828 | Ga0070708_1001028282 | 396 |
| 314 | 3300005445 | Ga0070708_100119564 | Ga0070708_1001195641 | 396 |
| 315 | 3300005445 | Ga0070708_100256252 | Ga0070708_1002562521 | 396 |
| 316 | 3300005468 | Ga0070707_100042781 | Ga0070707_1000427812 | 396 |
| 317 | 3300005471 | Ga0070698_100003474 | Ga0070698_10000347416 | 396 |
| 318 | 3300005518 | Ga0070699_100033532 | Ga0070699_1000335325 | 396 |
| 319 | 3300005536 | Ga0070697_100005719 | Ga0070697_1000057197 | 396 |
| 320 | 3300005983 | Ga0081540_1000111 | Ga0081540_100011117 | 396 |
| 321 | 3300005983 | Ga0081540_1003110 | Ga0081540_10031105 | 396 |
| 322 | 3300006028 | Ga0070717_10037636 | Ga0070717_100376364 | 396 |
| 323 | 3300009147 | Ga0114129_10019739 | Ga0114129_100197395 | 396 |
| 324 | 3300013296 | Ga0157374_10038210 | Ga0157374_100382102 | 396 |
| 325 | 3300013306 | Ga0163162_10212857 | Ga0163162_102128572 | 396 |
| 326 | 3300025910 | Ga0207684_10013890 | Ga0207684_100138903 | 396 |
| 327 | 3300025910 | Ga0207684_10167123 | Ga0207684_101671232 | 396 |
| 328 | 3300025916 | Ga0207663_10046166 | Ga0207663_100461662 | 396 |
| 329 | 3300025922 | Ga0207646_10000130 | Ga0207646_10000130106 | 396 |
| 330 | 3300025922 | Ga0207646_10075742 | Ga0207646_100757423 | 396 |
| 331 | 3300025926 | Ga0207659_10089410 | Ga0207659_100894102 | 396 |
| 332 | 3300025936 | Ga0207670_10030630 | Ga0207670_100306303 | 396 |
| 333 | 3300036401 | Ga0373937_0002774 | Ga0373937_0002774_4922_6274 | 396 |
| 334 | 3300046462 | Ga0495651_0054516 | Ga0495651_0054516_1687_3039 | 396 |
| 335 | 3300046529 | Ga0495652_0023735 | Ga0495652_0023735_1212_2564 | 396 |
| 336 | 3300046642 | Ga0495634_0065275 | Ga0495634_0065275_993_2345 | 396 |
| 337 | 3300046809 | Ga0495600_0064991 | Ga0495600_0064991_496_1848 | 396 |
| 338 | 3300050507 | nmdc:mga05p37_27295_c1 | nmdc:mga05p37_27295_c1_4810_6171 | 396 |
| 339 | 3300053077 | Ga0495601_0036520 | Ga0495601_0036520_925_2277 | 396 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar