F413984

General Info

Members Datasets Scaffolds Average Seq Length
339 224 678 115

Family's Representative Sequence

Representative Sequence 3300031649|Ga0307514_10530163|Ga0307514_105301631
Length 127
Sequence MLRPAVRRQGLLLMQLPVAVEALSALAHAIRLAVFRLLVRAGPEGMAAGDIAREVGALPNTLSTHLTILGHAGLVQSRRDGRSVIYSADYDGMRDLLGFLVADCCAGRAEICGSLAEVASGAGCCPS

Samples

Sample ID Description Type Environment
1 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
16 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
17 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
28 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
160 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
161 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
162 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
163 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
164 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
165 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
166 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
167 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
168 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
169 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
170 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
171 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
172 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
173 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
174 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
175 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
185 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
186 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
187 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
208 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
209 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
210 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
211 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
214 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
215 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
219 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
222 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
223 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
224 2643221622 Sphingomonas sp. Root241 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.63
Nodule 0.29
Rhizoplane 0.88
Rhizosphere 79.06
Stem 0
Stem Tuber 0
Unclassified 2.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307514_10530163 3300031649 Bacteria 550
2 ARcpr5oldR_c001967 3300000041 Bacteria 1962
3 JGI24752J21851_1000905 3300001976 Bacteria 4035
4 JGI24739J22299_10000550 3300001989 Bacteria 13408
5 JGI24739J22299_10042301 3300001989 Bacteria 1511
6 JGI24739J22299_10054581 3300001989 Bacteria 1279
7 JGI24737J22298_10007565 3300001990 Bacteria 3662
8 JGI24737J22298_10132257 3300001990 Bacteria 737
9 JGI24743J22301_10099238 3300001991 Bacteria 626
10 JGI24735J21928_10020608 3300002067 Bacteria 2018
11 JGI24735J21928_10055144 3300002067 Bacteria 1145
12 JGI24735J21928_10063090 3300002067 Bacteria 1064
13 JGI24735J21928_10138755 3300002067 Bacteria 701
14 JGI24750J21931_1000018 3300002070 Bacteria 20458
15 JGI24749J21850_1000698 3300002076 Bacteria 4823
16 JGI24744J21845_10009843 3300002077 Bacteria 1962
17 JGI24742J22300_10066923 3300002244 Bacteria 666
18 JGI24751J29686_10000731 3300002459 Bacteria 7933
19 JGI25165J46597_1000073 3300003214 Bacteria 192140
20 JGI25153J46596_10000070 3300003215 Bacteria 117125
21 rootH1_10001906 3300003316 Bacteria 1636
22 rootH2_10205111 3300003320 Bacteria 1538
23 Ga0055537_1001397 3300003773 Bacteria 9564
24 Ga0055524_1001171 3300003775 Bacteria 15663
25 Ga0055530_10007115 3300003791 Bacteria 4794
26 Ga0055531_10010833 3300003794 Bacteria 4481
27 Ga0065165_1022354 3300005262 Bacteria 2170
28 Ga0065707_10084417 3300005295 Bacteria 7223
29 Ga0070658_10000328 3300005327 Bacteria 40677
30 Ga0070658_10000972 3300005327 Bacteria 24584
31 Ga0070658_10145526 3300005327 Bacteria 1981
32 Ga0070658_10449616 3300005327 Bacteria 1110
33 Ga0070676_10006126 3300005328 Bacteria 6423
34 Ga0070690_100000005 3300005330 Bacteria 142006
35 Ga0070670_100000005 3300005331 Bacteria 351569
36 Ga0070670_101393310 3300005331 Unclassified 643
37 Ga0070677_10294535 3300005333 Bacteria 822
38 Ga0068869_100000306 3300005334 Bacteria 26133
39 Ga0068869_101611417 3300005334 Bacteria 578
40 Ga0070666_10000084 3300005335 Bacteria 66975
41 Ga0068868_100162689 3300005338 Bacteria 1844
42 Ga0070660_100000890 3300005339 Bacteria 19982
43 Ga0070660_100204121 3300005339 Bacteria 1604
44 Ga0070660_100506486 3300005339 Bacteria 1004
45 Ga0070660_100676756 3300005339 Bacteria 865
46 Ga0070660_101275794 3300005339 Bacteria 623
47 Ga0070660_101861665 3300005339 Bacteria 513
48 Ga0070661_100067715 3300005344 Bacteria 2624
49 Ga0070668_100114672 3300005347 Bacteria 2147
50 Ga0070668_100143481 3300005347 Bacteria 1926
51 Ga0070669_100000141 3300005353 Bacteria 64131
52 Ga0070669_100525351 3300005353 Bacteria 984
53 Ga0070675_100462836 3300005354 Bacteria 1139
54 Ga0070671_100052395 3300005355 Bacteria 3393
55 Ga0070671_100083695 3300005355 Bacteria 2668
56 Ga0070674_100008757 3300005356 Bacteria 6037
57 Ga0070673_100000022 3300005364 Bacteria 92156
58 Ga0070659_100031931 3300005366 Bacteria 4081
59 Ga0070659_100170539 3300005366 Bacteria 1782
60 Ga0070659_100495663 3300005366 Bacteria 1041
61 Ga0070659_100902657 3300005366 Bacteria 772
62 Ga0070667_100003022 3300005367 Bacteria 14455
63 Ga0070667_100006995 3300005367 Bacteria 9377
64 Ga0070663_102083148 3300005455 Unclassified 511
65 Ga0070678_100169782 3300005456 Bacteria 1775
66 Ga0070662_100051361 3300005457 Bacteria 2977
67 Ga0070662_101024882 3300005457 Unclassified 707
68 Ga0070681_10517142 3300005458 Bacteria 1107
69 Ga0068867_100000023 3300005459 Bacteria 92322
70 Ga0068867_101148832 3300005459 Bacteria 711
71 Ga0070685_10034769 3300005466 Bacteria 2840
72 Ga0070679_100299044 3300005530 Bacteria 1560
73 Ga0070679_101116366 3300005530 Bacteria 733
74 Ga0068853_100116719 3300005539 Bacteria 2377
75 Ga0068853_100348462 3300005539 Bacteria 1377
76 Ga0068853_100547725 3300005539 Bacteria 1096
77 Ga0068853_101506948 3300005539 Bacteria 651
78 Ga0070672_100013718 3300005543 Bacteria 5729
79 Ga0070672_100406671 3300005543 Bacteria 1167
80 Ga0070672_101006731 3300005543 Bacteria 738
81 Ga0070686_100000001 3300005544 Bacteria 515830
82 Ga0070664_102307377 3300005564 Bacteria 510
83 Ga0068857_100274105 3300005577 Bacteria 1551
84 Ga0068857_100356536 3300005577 Bacteria 1355
85 Ga0068854_100097559 3300005578 Bacteria 2197
86 Ga0068854_100209394 3300005578 Bacteria 1537
87 Ga0068856_100047153 3300005614 Bacteria 4245
88 Ga0068856_100226667 3300005614 Bacteria 1884
89 Ga0068852_100008765 3300005616 Bacteria 7481
90 Ga0068852_100084855 3300005616 Bacteria 2820
91 Ga0068852_102292346 3300005616 Bacteria 561
92 Ga0068859_100000375 3300005617 Bacteria 44582
93 Ga0068864_100000011 3300005618 Bacteria 350056
94 Ga0068861_100003145 3300005719 Bacteria 10912
95 Ga0068861_100100272 3300005719 Bacteria 2301
96 Ga0068863_100000046 3300005841 Bacteria 143895
97 Ga0068858_100005317 3300005842 Bacteria 12622
98 Ga0068860_100000333 3300005843 Bacteria 64236
99 Ga0068860_101554154 3300005843 Bacteria 683
100 Ga0068862_100000011 3300005844 Bacteria 270105
101 Ga0068862_100000953 3300005844 Bacteria 27817
102 Ga0075370_10078027 3300006353 Bacteria 1901
103 Ga0068871_100496473 3300006358 Bacteria 1099
104 Ga0068865_100000031 3300006881 Bacteria 88580
105 Ga0097620_100000375 3300006931 Bacteria 44582
106 Ga0099826_10421751 3300006948 Bacteria 642
107 Ga0105240_10994311 3300009093 Bacteria 897
108 Ga0105245_10009117 3300009098 Bacteria 8651
109 Ga0105245_10015460 3300009098 Bacteria 6654
110 Ga0105243_10000156 3300009148 Bacteria 78467
111 Ga0105243_10138374 3300009148 Bacteria 2074
112 Ga0105242_10007978 3300009176 Bacteria 8156
113 Ga0105242_10491001 3300009176 Bacteria 1166
114 Ga0105242_12221606 3300009176 Bacteria 594
115 Ga0105248_10000069 3300009177 Bacteria 120989
116 Ga0105237_10296590 3300009545 Bacteria 1619
117 Ga0105238_10009566 3300009551 Bacteria 9696
118 Ga0105249_10000353 3300009553 Bacteria 46052
119 Ga0105249_10333702 3300009553 Bacteria 1531
120 Ga0157373_10121988 3300013100 Bacteria 1832
121 Ga0157373_10370875 3300013100 Bacteria 1023
122 Ga0157371_10183342 3300013102 Bacteria 1497
123 Ga0157370_10000017 3300013104 Bacteria 169971
124 Ga0157369_10168637 3300013105 Bacteria 2308
125 Ga0157374_10013587 3300013296 Bacteria 7111
126 Ga0157378_10049461 3300013297 Bacteria 3740
127 Ga0157378_10069097 3300013297 Bacteria 3168
128 Ga0157372_10040515 3300013307 Bacteria 5146
129 Ga0157372_10436179 3300013307 Bacteria 1527
130 Ga0157372_11355100 3300013307 Unclassified 821
131 Ga0157375_10002652 3300013308 Bacteria 15491
132 Ga0163163_10234591 3300014325 Bacteria 1884
133 Ga0163163_12428191 3300014325 Unclassified 582
134 Ga0157380_10001128 3300014326 Bacteria 17241
135 Ga0157379_10097105 3300014968 Bacteria 2644
136 Ga0157376_10000124 3300014969 Bacteria 53299
137 Ga0163161_10000388 3300017792 Bacteria 36948
138 Ga0163161_10465523 3300017792 Bacteria 1024
139 Ga0207672_1000809 3300025223 Bacteria 3333
140 Ga0209437_103965 3300025233 Bacteria 2630
141 Ga0209148_1000059 3300025254 Bacteria 350224
142 Ga0209148_1004492 3300025254 Bacteria 3426
143 Ga0209148_1036970 3300025254 Bacteria 695
144 Ga0209233_1000142 3300025261 Bacteria 192193
145 Ga0209565_1000007 3300025263 Bacteria 784361
146 Ga0209455_1007020 3300025272 Bacteria 3241
147 Ga0209455_1020434 3300025272 Bacteria 1310
148 Ga0209673_1005398 3300025273 Bacteria 6442
149 Ga0209675_1004240 3300025291 Bacteria 6463
150 Ga0209564_1047786 3300025295 Bacteria 1074
151 Ga0209758_1000023 3300025297 Bacteria 612453
152 Ga0209758_1110252 3300025297 Bacteria 763
153 Ga0209050_1009345 3300025298 Bacteria 5034
154 Ga0209256_1000009 3300025299 Bacteria 922071
155 Ga0209256_1000010 3300025299 Bacteria 912110
156 Ga0209257_1023522 3300025304 Bacteria 2163
157 Ga0207656_10699386 3300025321 Bacteria 519
158 Ga0207682_10329206 3300025893 Bacteria 718
159 Ga0207688_10197819 3300025901 Bacteria 1204
160 Ga0207680_10000008 3300025903 Bacteria 518177
161 Ga0207647_10003125 3300025904 Bacteria 12436
162 Ga0207647_10138240 3300025904 Bacteria 1429
163 Ga0207647_10162042 3300025904 Bacteria 1304
164 Ga0207645_10010196 3300025907 Bacteria 6458
165 Ga0207705_10000046 3300025909 Bacteria 177574
166 Ga0207705_10000244 3300025909 Bacteria 53451
167 Ga0207705_10007676 3300025909 Bacteria 7929
168 Ga0207705_10169213 3300025909 Bacteria 1645
169 Ga0207671_10100099 3300025914 Bacteria 2194
170 Ga0207657_10003602 3300025919 Bacteria 16504
171 Ga0207657_10185020 3300025919 Bacteria 1682
172 Ga0207657_10289417 3300025919 Bacteria 1299
173 Ga0207657_10382975 3300025919 Bacteria 1107
174 Ga0207657_10531754 3300025919 Bacteria 920
175 Ga0207649_10036457 3300025920 Bacteria 2962
176 Ga0207652_10936562 3300025921 Bacteria 764
177 Ga0207681_10000001 3300025923 Bacteria 1105841
178 Ga0207681_10695704 3300025923 Bacteria 845
179 Ga0207694_10010185 3300025924 Bacteria 7085
180 Ga0207650_10000018 3300025925 Bacteria 352120
181 Ga0207650_10130357 3300025925 Bacteria 1967
182 Ga0207659_10012851 3300025926 Bacteria 5346
183 Ga0207687_10007954 3300025927 Bacteria 6942
184 Ga0207644_10008403 3300025931 Bacteria 6756
185 Ga0207644_10064197 3300025931 Bacteria 2668
186 Ga0207690_10049302 3300025932 Bacteria 2807
187 Ga0207690_10222986 3300025932 Bacteria 1443
188 Ga0207690_10346881 3300025932 Bacteria 1173
189 Ga0207706_10053928 3300025933 Bacteria 3549
190 Ga0207706_10187379 3300025933 Bacteria 1817
191 Ga0207686_10010088 3300025934 Bacteria 5138
192 Ga0207686_10326987 3300025934 Bacteria 1148
193 Ga0207709_10000100 3300025935 Bacteria 135080
194 Ga0207669_10343034 3300025937 Bacteria 1151
195 Ga0207704_10000008 3300025938 Bacteria 204682
196 Ga0207691_10168793 3300025940 Bacteria 1917
197 Ga0207711_10001189 3300025941 Bacteria 24690
198 Ga0207689_10000349 3300025942 Bacteria 43180
199 Ga0207689_10685195 3300025942 Bacteria 864
200 Ga0207667_11909741 3300025949 Bacteria 556
201 Ga0207651_10000008 3300025960 Bacteria 204538
202 Ga0207712_10000009 3300025961 Bacteria 518177
203 Ga0207712_10215758 3300025961 Bacteria 1531
204 Ga0207712_11274739 3300025961 Unclassified 656
205 Ga0207668_10106454 3300025972 Bacteria 2095
206 Ga0207668_10460170 3300025972 Bacteria 1087
207 Ga0207640_10469692 3300025981 Bacteria 1041
208 Ga0207658_10000956 3300025986 Bacteria 23857
209 Ga0207658_10009398 3300025986 Bacteria 6632
210 Ga0207677_10000091 3300026023 Bacteria 74163
211 Ga0207677_10049160 3300026023 Bacteria 2844
212 Ga0207703_10005709 3300026035 Bacteria 9983
213 Ga0207639_10079488 3300026041 Bacteria 2592
214 Ga0207639_10525766 3300026041 Bacteria 1084
215 Ga0207639_10716931 3300026041 Bacteria 929
216 Ga0207678_11378003 3300026067 Bacteria 624
217 Ga0207702_10063598 3300026078 Bacteria 3156
218 Ga0207702_10086195 3300026078 Bacteria 2738
219 Ga0207641_10000145 3300026088 Bacteria 100817
220 Ga0207648_10000009 3300026089 Bacteria 204229
221 Ga0207648_10661452 3300026089 Bacteria 966
222 Ga0207676_10000004 3300026095 Bacteria 725417
223 Ga0207676_10001200 3300026095 Bacteria 19451
224 Ga0207674_10071880 3300026116 Bacteria 3476
225 Ga0207674_10417406 3300026116 Bacteria 1297
226 Ga0207674_11365513 3300026116 Bacteria 678
227 Ga0207674_11809832 3300026116 Bacteria 578
228 Ga0207675_100002198 3300026118 Bacteria 19378
229 Ga0207683_10012044 3300026121 Bacteria 7382
230 Ga0207683_11519126 3300026121 Unclassified 618
231 Ga0207698_10062077 3300026142 Bacteria 2916
232 Ga0207698_10510759 3300026142 Bacteria 1171
233 Ga0268265_10000002 3300028380 Bacteria 1035381
234 Ga0268265_10000489 3300028380 Bacteria 41369
235 Ga0268264_10000003 3300028381 Bacteria 1141976
236 Ga0268264_11385528 3300028381 Bacteria 714
237 Ga0307513_10002089 3300031456 Bacteria 28063
238 Ga0307513_10328777 3300031456 Bacteria 1284
239 Ga0307509_10116740 3300031507 Bacteria 2657
240 Ga0307508_10001675 3300031616 Bacteria 24607
241 Ga0307412_10035301 3300031911 Bacteria 3193
242 Ga0307416_100255699 3300032002 Bacteria 1708
243 Ga0307510_10078200 3300033180 Bacteria 3238
244 Ga0373931_0208211 3300035691 Bacteria 1172
245 Ga0395900_0087145 3300037418 Bacteria 3209
246 Ga0395905_0405578 3300037471 Bacteria 1258
247 Ga0395901_0020753 3300038443 Bacteria 6726
248 Ga0395901_0490360 3300038443 Bacteria 1252
249 Ga0436365_1821732 3300039437 Bacteria 1068
250 Ga0439447_109145 3300041407 Bacteria 635
251 Ga0439461_0000272 3300041410 Bacteria 7462
252 Ga0451800_0107021 3300041459 Bacteria 623
253 Ga0439431_0000160 3300041997 Bacteria 12587
254 Ga0439442_005185 3300042002 Bacteria 2611
255 Ga0439448_0000346 3300042005 Bacteria 10365
256 Ga0439448_0053359 3300042005 Bacteria 1326
257 Ga0439448_0062486 3300042005 Bacteria 1232
258 Ga0439432_000807 3300042006 Bacteria 11686
259 Ga0439449_0097313 3300042007 Bacteria 1087
260 Ga0439450_047888 3300042008 Bacteria 1008
261 Ga0439450_098307 3300042008 Bacteria 741
262 Ga0439455_0000331 3300042012 Bacteria 6039
263 Ga0439455_0025458 3300042012 Bacteria 1438
264 Ga0439455_0063990 3300042012 Bacteria 979
265 Ga0439462_0078493 3300042015 Bacteria 900
266 Ga0439446_0030898 3300042156 Bacteria 1549
267 Ga0439458_0000297 3300042157 Bacteria 12378
268 Ga0439458_0002161 3300042157 Bacteria 4858
269 Ga0439458_0006421 3300042157 Bacteria 2623
270 Ga0439434_0011880 3300042435 Bacteria 2574
271 Ga0439459_0159103 3300042438 Bacteria 595
272 Ga0466972_0000616 3300044658 Bacteria 17397
273 Ga0466970_0269567 3300044765 Bacteria 956
274 Ga0466957_0358092 3300044842 Bacteria 991
275 Ga0466960_0019163 3300044901 Bacteria 3010
276 Ga0495638_0000758 3300046460 Bacteria 34400
277 Ga0495662_0296077 3300046476 Bacteria 796
278 Ga0495584_0024303 3300046491 Bacteria 3073
279 Ga0495583_0000627 3300046506 Bacteria 47369
280 Ga0495583_0014811 3300046506 Bacteria 4276
281 Ga0495606_0000092 3300046507 Bacteria 152369
282 Ga0495616_0186439 3300046513 Bacteria 919
283 Ga0495618_0375990 3300046514 Bacteria 872
284 Ga0495643_0030668 3300046522 Bacteria 3000
285 Ga0495643_0088860 3300046522 Bacteria 1596
286 Ga0495643_0233342 3300046522 Bacteria 866
287 Ga0495663_0027811 3300046525 Bacteria 1661
288 Ga0495642_0041529 3300046528 Bacteria 1871
289 Ga0495652_0600535 3300046529 Bacteria 751
290 Ga0495587_0086813 3300046536 Bacteria 1811
291 Ga0495622_0005223 3300046557 Bacteria 6020
292 Ga0495668_0011742 3300046616 Bacteria 5229
293 Ga0495668_0030204 3300046616 Bacteria 3061
294 Ga0495625_0000083 3300046660 Bacteria 152144
295 Ga0495625_0062262 3300046660 Bacteria 2638
296 Ga0495625_0118903 3300046660 Bacteria 1800
297 Ga0495625_0304881 3300046660 Bacteria 1018
298 Ga0495670_0745019 3300046691 Bacteria 534
299 Ga0495589_0115171 3300046794 Bacteria 1296
300 Ga0495687_053127 3300047443 Bacteria 1708
301 Ga0495677_0000643 3300047445 Bacteria 14100
302 Ga0495686_0017966 3300047472 Bacteria 4755
303 Ga0495686_0101832 3300047472 Bacteria 1731
304 Ga0496101_1393840 3300048904 Bacteria 547
305 Ga0496107_1302206 3300048910 Bacteria 520
306 Ga0496118_0549822 3300048921 Bacteria 563
307 Ga0496121_0036607 3300048924 Bacteria 4371
308 Ga0496125_0146094 3300048928 Bacteria 1634
309 Ga0496126_0951065 3300048929 Unclassified 648
310 Ga0501073_0911232 3300049589 Bacteria 605
311 nmdc:mga07m45_144397_c1 3300050496 Bacteria 1379
312 nmdc:mga07m45_67759_c2 3300050496 Bacteria 1300
313 Ga0500643_001305 3300053087 Bacteria 14675
314 Ga0500643_006180 3300053087 Bacteria 5047
315 Ga0500643_216704 3300053087 Bacteria 514
316 Ga0500646_0139181 3300053090 Bacteria 795
317 Ga0500646_0271784 3300053090 Unclassified 601
318 Ga0500641_0002276 3300053096 Bacteria 6809
319 Ga0500641_0184139 3300053096 Bacteria 896
320 Ga0500556_0022778 3300053104 Bacteria 2038
321 Ga0500562_189478 3300053108 Bacteria 558
322 Ga0500594_0067451 3300053118 Bacteria 1045
323 Ga0500595_000551 3300053119 Bacteria 22467
324 Ga0500595_002194 3300053119 Bacteria 9916
325 Ga0500658_0014431 3300053134 Bacteria 2924
326 Ga0500559_0007196 3300053136 Bacteria 4954
327 Ga0500559_0065557 3300053136 Bacteria 1627
328 Ga0500568_0153352 3300053139 Bacteria 852
329 Ga0500604_0025689 3300053151 Bacteria 1694
330 Ga0500616_0005519 3300053153 Bacteria 8568
331 Ga0500616_0038094 3300053153 Bacteria 2599
332 Ga0500616_0166845 3300053153 Bacteria 1004
333 Ga0500619_002752 3300053154 Bacteria 3457
334 Ga0500624_000032 3300053157 Bacteria 104403
335 Ga0500627_0121061 3300053158 Bacteria 1180
336 Ga0500637_0001528 3300053178 Bacteria 9878
337 Ga0500645_045008 3300053730 Bacteria 1297
338 Ga0500596_000774 3300053735 Bacteria 6300
339 2644125350 2643221622 Bacteria 4212502
340 Ga0307514_10530163
341 ARcpr5oldR_c001967
342 JGI24752J21851_1000905
343 JGI24739J22299_10000550
344 JGI24739J22299_10042301
345 JGI24739J22299_10054581
346 JGI24737J22298_10007565
347 JGI24737J22298_10132257
348 JGI24743J22301_10099238
349 JGI24735J21928_10020608
350 JGI24735J21928_10055144
351 JGI24735J21928_10063090
352 JGI24735J21928_10138755
353 JGI24750J21931_1000018
354 JGI24749J21850_1000698
355 JGI24744J21845_10009843
356 JGI24742J22300_10066923
357 JGI24751J29686_10000731
358 JGI25165J46597_1000073
359 JGI25153J46596_10000070
360 rootH1_10001906
361 rootH2_10205111
362 Ga0055537_1001397
363 Ga0055524_1001171
364 Ga0055530_10007115
365 Ga0055531_10010833
366 Ga0065165_1022354
367 Ga0065707_10084417
368 Ga0070658_10000328
369 Ga0070658_10000972
370 Ga0070658_10145526
371 Ga0070658_10449616
372 Ga0070676_10006126
373 Ga0070690_100000005
374 Ga0070670_100000005
375 Ga0070670_101393310
376 Ga0070677_10294535
377 Ga0068869_100000306
378 Ga0068869_101611417
379 Ga0070666_10000084
380 Ga0068868_100162689
381 Ga0070660_100000890
382 Ga0070660_100204121
383 Ga0070660_100506486
384 Ga0070660_100676756
385 Ga0070660_101275794
386 Ga0070660_101861665
387 Ga0070661_100067715
388 Ga0070668_100114672
389 Ga0070668_100143481
390 Ga0070669_100000141
391 Ga0070669_100525351
392 Ga0070675_100462836
393 Ga0070671_100052395
394 Ga0070671_100083695
395 Ga0070674_100008757
396 Ga0070673_100000022
397 Ga0070659_100031931
398 Ga0070659_100170539
399 Ga0070659_100495663
400 Ga0070659_100902657
401 Ga0070667_100003022
402 Ga0070667_100006995
403 Ga0070663_102083148
404 Ga0070678_100169782
405 Ga0070662_100051361
406 Ga0070662_101024882
407 Ga0070681_10517142
408 Ga0068867_100000023
409 Ga0068867_101148832
410 Ga0070685_10034769
411 Ga0070679_100299044
412 Ga0070679_101116366
413 Ga0068853_100116719
414 Ga0068853_100348462
415 Ga0068853_100547725
416 Ga0068853_101506948
417 Ga0070672_100013718
418 Ga0070672_100406671
419 Ga0070672_101006731
420 Ga0070686_100000001
421 Ga0070664_102307377
422 Ga0068857_100274105
423 Ga0068857_100356536
424 Ga0068854_100097559
425 Ga0068854_100209394
426 Ga0068856_100047153
427 Ga0068856_100226667
428 Ga0068852_100008765
429 Ga0068852_100084855
430 Ga0068852_102292346
431 Ga0068859_100000375
432 Ga0068864_100000011
433 Ga0068861_100003145
434 Ga0068861_100100272
435 Ga0068863_100000046
436 Ga0068858_100005317
437 Ga0068860_100000333
438 Ga0068860_101554154
439 Ga0068862_100000011
440 Ga0068862_100000953
441 Ga0075370_10078027
442 Ga0068871_100496473
443 Ga0068865_100000031
444 Ga0097620_100000375
445 Ga0099826_10421751
446 Ga0105240_10994311
447 Ga0105245_10009117
448 Ga0105245_10015460
449 Ga0105243_10000156
450 Ga0105243_10138374
451 Ga0105242_10007978
452 Ga0105242_10491001
453 Ga0105242_12221606
454 Ga0105248_10000069
455 Ga0105237_10296590
456 Ga0105238_10009566
457 Ga0105249_10000353
458 Ga0105249_10333702
459 Ga0157373_10121988
460 Ga0157373_10370875
461 Ga0157371_10183342
462 Ga0157370_10000017
463 Ga0157369_10168637
464 Ga0157374_10013587
465 Ga0157378_10049461
466 Ga0157378_10069097
467 Ga0157372_10040515
468 Ga0157372_10436179
469 Ga0157372_11355100
470 Ga0157375_10002652
471 Ga0163163_10234591
472 Ga0163163_12428191
473 Ga0157380_10001128
474 Ga0157379_10097105
475 Ga0157376_10000124
476 Ga0163161_10000388
477 Ga0163161_10465523
478 Ga0207672_1000809
479 Ga0209437_103965
480 Ga0209148_1000059
481 Ga0209148_1004492
482 Ga0209148_1036970
483 Ga0209233_1000142
484 Ga0209565_1000007
485 Ga0209455_1007020
486 Ga0209455_1020434
487 Ga0209673_1005398
488 Ga0209675_1004240
489 Ga0209564_1047786
490 Ga0209758_1000023
491 Ga0209758_1110252
492 Ga0209050_1009345
493 Ga0209256_1000009
494 Ga0209256_1000010
495 Ga0209257_1023522
496 Ga0207656_10699386
497 Ga0207682_10329206
498 Ga0207688_10197819
499 Ga0207680_10000008
500 Ga0207647_10003125
501 Ga0207647_10138240
502 Ga0207647_10162042
503 Ga0207645_10010196
504 Ga0207705_10000046
505 Ga0207705_10000244
506 Ga0207705_10007676
507 Ga0207705_10169213
508 Ga0207671_10100099
509 Ga0207657_10003602
510 Ga0207657_10185020
511 Ga0207657_10289417
512 Ga0207657_10382975
513 Ga0207657_10531754
514 Ga0207649_10036457
515 Ga0207652_10936562
516 Ga0207681_10000001
517 Ga0207681_10695704
518 Ga0207694_10010185
519 Ga0207650_10000018
520 Ga0207650_10130357
521 Ga0207659_10012851
522 Ga0207687_10007954
523 Ga0207644_10008403
524 Ga0207644_10064197
525 Ga0207690_10049302
526 Ga0207690_10222986
527 Ga0207690_10346881
528 Ga0207706_10053928
529 Ga0207706_10187379
530 Ga0207686_10010088
531 Ga0207686_10326987
532 Ga0207709_10000100
533 Ga0207669_10343034
534 Ga0207704_10000008
535 Ga0207691_10168793
536 Ga0207711_10001189
537 Ga0207689_10000349
538 Ga0207689_10685195
539 Ga0207667_11909741
540 Ga0207651_10000008
541 Ga0207712_10000009
542 Ga0207712_10215758
543 Ga0207712_11274739
544 Ga0207668_10106454
545 Ga0207668_10460170
546 Ga0207640_10469692
547 Ga0207658_10000956
548 Ga0207658_10009398
549 Ga0207677_10000091
550 Ga0207677_10049160
551 Ga0207703_10005709
552 Ga0207639_10079488
553 Ga0207639_10525766
554 Ga0207639_10716931
555 Ga0207678_11378003
556 Ga0207702_10063598
557 Ga0207702_10086195
558 Ga0207641_10000145
559 Ga0207648_10000009
560 Ga0207648_10661452
561 Ga0207676_10000004
562 Ga0207676_10001200
563 Ga0207674_10071880
564 Ga0207674_10417406
565 Ga0207674_11365513
566 Ga0207674_11809832
567 Ga0207675_100002198
568 Ga0207683_10012044
569 Ga0207683_11519126
570 Ga0207698_10062077
571 Ga0207698_10510759
572 Ga0268265_10000002
573 Ga0268265_10000489
574 Ga0268264_10000003
575 Ga0268264_11385528
576 Ga0307513_10002089
577 Ga0307513_10328777
578 Ga0307509_10116740
579 Ga0307508_10001675
580 Ga0307412_10035301
581 Ga0307416_100255699
582 Ga0307510_10078200
583 Ga0373931_0208211
584 Ga0395900_0087145
585 Ga0395905_0405578
586 Ga0395901_0020753
587 Ga0395901_0490360
588 Ga0436365_1821732
589 Ga0439447_109145
590 Ga0439461_0000272
591 Ga0451800_0107021
592 Ga0439431_0000160
593 Ga0439442_005185
594 Ga0439448_0000346
595 Ga0439448_0053359
596 Ga0439448_0062486
597 Ga0439432_000807
598 Ga0439449_0097313
599 Ga0439450_047888
600 Ga0439450_098307
601 Ga0439455_0000331
602 Ga0439455_0025458
603 Ga0439455_0063990
604 Ga0439462_0078493
605 Ga0439446_0030898
606 Ga0439458_0000297
607 Ga0439458_0002161
608 Ga0439458_0006421
609 Ga0439434_0011880
610 Ga0439459_0159103
611 Ga0466972_0000616
612 Ga0466970_0269567
613 Ga0466957_0358092
614 Ga0466960_0019163
615 Ga0495638_0000758
616 Ga0495662_0296077
617 Ga0495584_0024303
618 Ga0495583_0000627
619 Ga0495583_0014811
620 Ga0495606_0000092
621 Ga0495616_0186439
622 Ga0495618_0375990
623 Ga0495643_0030668
624 Ga0495643_0088860
625 Ga0495643_0233342
626 Ga0495663_0027811
627 Ga0495642_0041529
628 Ga0495652_0600535
629 Ga0495587_0086813
630 Ga0495622_0005223
631 Ga0495668_0011742
632 Ga0495668_0030204
633 Ga0495625_0000083
634 Ga0495625_0062262
635 Ga0495625_0118903
636 Ga0495625_0304881
637 Ga0495670_0745019
638 Ga0495589_0115171
639 Ga0495687_053127
640 Ga0495677_0000643
641 Ga0495686_0017966
642 Ga0495686_0101832
643 Ga0496101_1393840
644 Ga0496107_1302206
645 Ga0496118_0549822
646 Ga0496121_0036607
647 Ga0496125_0146094
648 Ga0496126_0951065
649 Ga0501073_0911232
650 nmdc:mga07m45_144397_c1
651 nmdc:mga07m45_67759_c2
652 Ga0500643_001305
653 Ga0500643_006180
654 Ga0500643_216704
655 Ga0500646_0139181
656 Ga0500646_0271784
657 Ga0500641_0002276
658 Ga0500641_0184139
659 Ga0500556_0022778
660 Ga0500562_189478
661 Ga0500594_0067451
662 Ga0500595_000551
663 Ga0500595_002194
664 Ga0500658_0014431
665 Ga0500559_0007196
666 Ga0500559_0065557
667 Ga0500568_0153352
668 Ga0500604_0025689
669 Ga0500616_0005519
670 Ga0500616_0038094
671 Ga0500616_0166845
672 Ga0500619_002752
673 Ga0500624_000032
674 Ga0500627_0121061
675 Ga0500637_0001528
676 Ga0500645_045008
677 Ga0500596_000774
678 2644125350

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12840

HTH_20

Helix-turn-helix domain

26

78

0.97

PF01022

HTH_5

Bacterial regulatory protein, arsR family

28

77

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8iuh-assembly1.cif.gz_P rna polymerase iii pre-initiation complex open complex 1 0.9463 18 75
6j05-assembly1.cif.gz_B structures of two arsr as(iii)-responsive repressors: implications for the mechanism of derepression 0.945 1 87
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.9392 15 75
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.9336 15 75
6cnf-assembly1.cif.gz_P yeast rna polymerase iii elongation complex 0.9098 15 75
ID Description Score Start End Superfamily
af_P32910_88_152_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9751 16 75 1.10.10.10
af_O94553_84_149_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9725 15 75 1.10.10.10
af_Q69XJ1_51_114_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.972 18 74 1.10.10.10
af_Q9VD25_77_142_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9702 15 75 1.10.10.10
af_Q58793_245_317_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.963 11 76 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F3YRF7-F1-model_v4 Transcriptional regulator 0.9992 1 87 GO:0003700
AF-A0A530K0I7-F1-model_v4 Helix-turn-helix transcriptional regulator 0.9977 1 84 GO:0003700
AF-A0A212JDE4-F1-model_v4 Transcriptional regulator, ArsR family, putative (Modular protein) 0.997 2 89 GO:0003700
AF-K9H3S7-F1-model_v4 Transcriptional regulator, ArsR family 0.995 1 87 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793
AF-A0A651FWF4-F1-model_v4 MarR family transcriptional regulator 0.9929 1 90 GO:0003700
GO:0004726
GO:0030946
GO:0046685
GO:0140793

Map