F413998

General Info

Members Datasets Scaffolds Average Seq Length
339 196 678 190

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0000185|Ga0316582_0000185_15345_16031
Length 228
Sequence MSVARWATFTVYLRYRQLTTNHGHRAFLLGLKGGKMAAKKILLLAGDFVEDYEIMVPFQALQMVGHTVHAVCPDKKAGETVRTAVHDFEGDQTYSEKPGHNFTLNASFDEIKADDYDALVIPGGRAPEYIRLNNSVLKIVQHFAETQKPIAAICHGAQLLAAAGVLKSKSCSAYPAVGPDVKASGGEFVDIPVDQAHVDGNLVSAPAWPAHPDWLAKFLRVLGTKVEP

Samples

Sample ID Description Type Environment
1 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
9 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
10 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
11 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
14 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
15 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
16 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
17 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
26 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
27 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
28 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
29 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
30 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
31 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
32 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
33 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
34 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
35 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
36 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
37 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
38 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
39 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
48 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
49 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
51 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
52 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
55 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
56 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
57 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
58 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
59 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
60 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
61 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
62 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
66 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
67 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
68 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
69 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
70 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
71 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
72 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
73 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
74 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
75 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
76 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
77 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
78 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
79 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
82 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
83 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
84 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
85 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
86 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
87 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
92 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
95 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
96 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
97 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
98 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
99 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
100 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
104 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
107 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
116 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
117 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
118 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
119 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
120 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
121 2506520008 Serratia plymuthica AS12 Isolate Unclassified
122 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
123 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
124 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
125 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
126 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
127 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
128 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
129 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
130 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
131 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
132 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
133 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
134 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
135 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
136 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
137 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
138 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
139 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
140 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
141 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
142 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
143 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
144 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
145 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
146 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
147 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
148 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
149 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
150 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
151 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
152 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
153 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
154 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
155 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
156 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
157 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
158 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
159 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
160 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
161 2636415599 Klebsiella variicola DX120E Isolate Unclassified
162 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
163 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
164 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified
165 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
166 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
167 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
168 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
169 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
170 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
171 2751185917 Enterobacter sp. HK169 Isolate Unclassified
172 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
173 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
174 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
175 2775507074 Klebsiella sp. D5A Isolate Unclassified
176 2821118458 Enterobacter asburiae 609 Isolate Unclassified
177 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
178 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
179 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
180 2885266251 Ralstonia sp. SET104 Isolate Nodule
181 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
182 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
183 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
184 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
185 2937967321 Serratia sp. YC16 Isolate Unclassified
186 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
187 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
188 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
189 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
190 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
191 8004592986 Serratia sp. S119 Isolate Unclassified
192 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
193 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
194 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
195 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
196 8055092621 Silvania confinis H4N4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.93
Metatranscriptomes 2.36
Isolates 22.71

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 0.88
Nodule 1.47
Rhizoplane 13.86
Rhizosphere 58.11
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316582_0000185 3300036647 Bacteria 19514
2 SwRhRL2b_contig_1795684 2162886007 Bacteria 7259
3 rootH2_10045982 3300003320 Bacteria 32690
4 rootH1_10198924 3300003323 Bacteria 1755
5 Ga0058692_1000981 3300003856 Bacteria 11231
6 Ga0065704_10000240 3300005289 Bacteria 56098
7 Ga0065704_10132798 3300005289 Bacteria 1608
8 Ga0070659_100077850 3300005366 Bacteria 2645
9 Ga0070665_100000600 3300005548 Bacteria 49830
10 Ga0070704_100326052 3300005549 Bacteria 1288
11 Ga0070704_101478938 3300005549 Bacteria 624
12 Ga0068856_100239401 3300005614 Bacteria 1830
13 Ga0068851_10255740 3300005834 Bacteria 995
14 Ga0081455_10228829 3300005937 Bacteria 1373
15 Ga0075364_10006172 3300006051 Bacteria 7020
16 Ga0075366_10048347 3300006195 Bacteria 2522
17 Ga0075430_100022673 3300006846 Bacteria 5342
18 Ga0075431_100113102 3300006847 Bacteria 2802
19 Ga0075431_100505467 3300006847 Bacteria 1199
20 Ga0079104_1000907 3300006946 Bacteria 24005
21 Ga0079104_1001643 3300006946 Bacteria 14483
22 Ga0105251_10000002 3300009011 Bacteria 350843
23 Ga0105251_10000539 3300009011 Bacteria 35683
24 Ga0105251_10000549 3300009011 Bacteria 35334
25 Ga0105251_10001544 3300009011 Bacteria 19757
26 Ga0105251_10004257 3300009011 Bacteria 9863
27 Ga0105251_10108360 3300009011 Bacteria 1266
28 Ga0105251_10108520 3300009011 Bacteria 1265
29 Ga0105244_10003460 3300009036 Bacteria 11247
30 Ga0105250_10000330 3300009092 Bacteria 36615
31 Ga0105250_10016516 3300009092 Bacteria 3005
32 Ga0105240_10539733 3300009093 Bacteria 1292
33 Ga0105247_10000045 3300009101 Bacteria 153175
34 Ga0114129_10027409 3300009147 Bacteria 8066
35 Ga0105241_10000002 3300009174 Bacteria 869480
36 Ga0105248_10181375 3300009177 Bacteria 2372
37 Ga0105248_10901747 3300009177 Bacteria 998
38 Ga0105238_10793996 3300009551 Bacteria 962
39 Ga0105239_10418226 3300010375 Bacteria 1518
40 Ga0157373_10001547 3300013100 Bacteria 17560
41 Ga0157370_10007177 3300013104 Bacteria 12157
42 Ga0157372_11463882 3300013307 Bacteria 787
43 Ga0163163_10139414 3300014325 Bacteria 2467
44 Ga0182008_10007764 3300014497 Bacteria 5903
45 Ga0182006_1164325 3300015261 Bacteria 746
46 Ga0183366_1001 3300015679 Bacteria 2743932
47 Ga0183370_1001 3300015680 Bacteria 2743932
48 Ga0183369_1001 3300015685 Bacteria 2743932
49 Ga0183368_1001 3300015687 Bacteria 2743932
50 Ga0163161_10000001 3300017792 Bacteria 2041488
51 Ga0207696_1000001 3300025711 Bacteria 2579611
52 Ga0207696_1000003 3300025711 Bacteria 860639
53 Ga0207696_1000446 3300025711 Bacteria 36487
54 Ga0207655_1000064 3300025728 Bacteria 255782
55 Ga0207713_1000002 3300025735 Bacteria 1061749
56 Ga0207713_1000004 3300025735 Bacteria 702781
57 Ga0207713_1000008 3300025735 Bacteria 553952
58 Ga0207713_1000016 3300025735 Bacteria 421689
59 Ga0207713_1000533 3300025735 Bacteria 38234
60 Ga0207713_1023132 3300025735 Bacteria 2933
61 Ga0207713_1032097 3300025735 Bacteria 2311
62 Ga0207713_1034477 3300025735 Bacteria 2198
63 Ga0207710_10000780 3300025900 Bacteria 17362
64 Ga0207654_10000005 3300025911 Bacteria 869492
65 Ga0207695_10423523 3300025913 Bacteria 1215
66 Ga0207690_10369269 3300025932 Bacteria 1138
67 Ga0207711_10210346 3300025941 Bacteria 1776
68 Ga0209281_1000003 3300027111 Bacteria 1260089
69 Ga0209281_1001032 3300027111 Bacteria 21394
70 Ga0209371_1000001 3300027312 Bacteria 2771503
71 Ga0209371_1000301 3300027312 Bacteria 55150
72 Ga0209371_1001883 3300027312 Bacteria 12871
73 Ga0209371_1006269 3300027312 Bacteria 4449
74 Ga0209371_1034932 3300027312 Bacteria 1062
75 Ga0268266_10000762 3300028379 Bacteria 43072
76 Ga0268256_1000001 3300030500 Bacteria 2771065
77 Ga0268256_1000266 3300030500 Bacteria 55130
78 Ga0268256_1001620 3300030500 Bacteria 13032
79 Ga0268256_1004974 3300030500 Bacteria 5356
80 Ga0268256_1047952 3300030500 Bacteria 916
81 Ga0265325_10000929 3300031241 Bacteria 21157
82 Ga0265316_10012559 3300031344 Bacteria 7586
83 Ga0265316_10028289 3300031344 Bacteria 4626
84 Ga0307408_100308582 3300031548 Bacteria 1328
85 Ga0316575_10002981 3300031665 Bacteria 5765
86 Ga0316575_10154997 3300031665 Bacteria 946
87 Ga0316579_10003530 3300031691 Bacteria 6120
88 Ga0316579_10016216 3300031691 Bacteria 3250
89 Ga0316579_10028775 3300031691 Bacteria 2531
90 Ga0316579_10032165 3300031691 Bacteria 2405
91 Ga0316579_10046542 3300031691 Bacteria 2024
92 Ga0316579_10101034 3300031691 Bacteria 1381
93 Ga0316576_10028189 3300031727 Bacteria 3956
94 Ga0316576_10043208 3300031727 Bacteria 3251
95 Ga0316576_10054909 3300031727 Bacteria 2906
96 Ga0316576_10137095 3300031727 Bacteria 1842
97 Ga0316576_10173452 3300031727 Bacteria 1627
98 Ga0316576_10345973 3300031727 Bacteria 1107
99 Ga0316578_10000782 3300031728 Bacteria 11736
100 Ga0316578_10110452 3300031728 Bacteria 1651
101 Ga0316578_10306299 3300031728 Bacteria 949
102 Ga0316578_10363968 3300031728 Bacteria 860
103 Ga0316577_10008192 3300031733 Bacteria 5595
104 Ga0316577_10010850 3300031733 Bacteria 4926
105 Ga0316577_10021227 3300031733 Bacteria 3602
106 Ga0316577_10040196 3300031733 Unclassified 2616
107 Ga0316577_10043995 3300031733 Bacteria 2497
108 Ga0316577_10089628 3300031733 Bacteria 1722
109 Ga0316577_10118314 3300031733 Bacteria 1488
110 Ga0316577_10153745 3300031733 Bacteria 1297
111 Ga0316577_10323171 3300031733 Bacteria 875
112 Ga0316583_10004616 3300032133 Bacteria 4914
113 Ga0316583_10017586 3300032133 Bacteria 2572
114 Ga0316583_10031337 3300032133 Bacteria 1893
115 Ga0316583_10142365 3300032133 Bacteria 835
116 Ga0316585_10036216 3300032137 Bacteria 1564
117 Ga0316585_10040219 3300032137 Bacteria 1488
118 Ga0316585_10064615 3300032137 Bacteria 1185
119 Ga0316580_10006681 3300032139 Bacteria 3410
120 Ga0316580_10081016 3300032139 Bacteria 993
121 Ga0316580_10158810 3300032139 Bacteria 694
122 Ga0316593_10030591 3300032168 Bacteria 1749
123 Ga0316593_10114883 3300032168 Bacteria 963
124 Ga0316593_10190893 3300032168 Bacteria 755
125 Ga0316592_1025859 3300033524 Bacteria 1266
126 Ga0316586_1028113 3300033527 Bacteria 955
127 Ga0316596_1036172 3300033541 Bacteria 1290
128 Ga0316596_1053267 3300033541 Bacteria 1073
129 Ga0316596_1134073 3300033541 Bacteria 677
130 Ga0316574_0003902 3300035398 Bacteria 7750
131 Ga0316574_0081649 3300035398 Bacteria 2053
132 Ga0316574_0302217 3300035398 Bacteria 1017
133 Ga0373937_0178125 3300036401 Bacteria 1996
134 Ga0373937_0217516 3300036401 Bacteria 1798
135 Ga0316582_0000113 3300036647 Bacteria 22888
136 Ga0316582_0088384 3300036647 Bacteria 2035
137 Ga0316582_0116341 3300036647 Bacteria 1785
138 Ga0316582_0223736 3300036647 Bacteria 1287
139 Ga0316582_0235562 3300036647 Bacteria 1253
140 Ga0316582_0241485 3300036647 Bacteria 1237
141 Ga0316582_0271164 3300036647 Bacteria 1164
142 Ga0316582_0279900 3300036647 Bacteria 1145
143 Ga0316584_0002135 3300036712 Bacteria 12375
144 Ga0316584_0002655 3300036712 Bacteria 11408
145 Ga0316584_0009270 3300036712 Bacteria 6823
146 Ga0316584_0012858 3300036712 Bacteria 5908
147 Ga0316584_0015352 3300036712 Bacteria 5476
148 Ga0316584_0016776 3300036712 Bacteria 5254
149 Ga0316584_0188021 3300036712 Bacteria 1528
150 Ga0316584_0255428 3300036712 Bacteria 1279
151 Ga0316581_0021866 3300037588 Bacteria 1883
152 Ga0316581_0058154 3300037588 Bacteria 1186
153 Ga0316581_0084519 3300037588 Bacteria 976
154 Ga0436364_1305061 3300037853 Bacteria 2604
155 Ga0395901_0151560 3300038443 Bacteria 2436
156 Ga0400484_43724 3300038725 Bacteria 4379
157 Ga0400486_01879 3300038742 Bacteria 1018
158 Ga0400489_32209 3300039093 Bacteria 2699
159 Ga0400487_28351 3300039110 Bacteria 14795
160 Ga0439466_0048371 3300041411 Bacteria 1399
161 Ga0451795_0917145 3300041456 Unclassified 860
162 Ga0439432_014825 3300042006 Bacteria 2635
163 Ga0439452_000062 3300042010 Bacteria 100841
164 Ga0451577_0000271 3300042876 Bacteria 101284
165 Ga0451577_1200811 3300042876 Bacteria 676
166 Ga0466981_0000007 3300044669 Bacteria 155983
167 Ga0453684_0000005 3300044712 Bacteria 1431632
168 Ga0453684_0444555 3300044712 Bacteria 1444
169 Ga0451576_0015235 3300045051 Bacteria 8525
170 Ga0451576_0735103 3300045051 Bacteria 1037
171 Ga0451576_1524820 3300045051 Bacteria 694
172 Ga0495627_000020 3300046453 Bacteria 291866
173 Ga0495653_0238340 3300046463 Bacteria 1214
174 Ga0495650_0000005 3300046471 Bacteria 766553
175 Ga0495608_0025733 3300046511 Bacteria 4017
176 Ga0495652_0415351 3300046529 Bacteria 949
177 Ga0495609_0092677 3300046538 Bacteria 1313
178 Ga0495667_0000069 3300046559 Bacteria 79580
179 Ga0495667_0152985 3300046559 Bacteria 1485
180 Ga0495635_0063369 3300046663 Bacteria 2539
181 Ga0495613_0086475 3300046689 Bacteria 2273
182 Ga0495671_0171926 3300046692 Bacteria 1053
183 Ga0495600_0350299 3300046809 Bacteria 925
184 Ga0495684_0002646 3300047471 Bacteria 14221
185 Ga0496104_0000344 3300048907 Bacteria 41481
186 Ga0496104_0224265 3300048907 Bacteria 1792
187 Ga0496105_0005468 3300048908 Bacteria 9639
188 Ga0496105_0210930 3300048908 Bacteria 1583
189 Ga0496116_0000001 3300048919 Bacteria 1501681
190 Ga0496116_0000204 3300048919 Bacteria 113862
191 Ga0496116_0023838 3300048919 Bacteria 4545
192 Ga0496117_0000421 3300048920 Bacteria 71461
193 Ga0496117_0001549 3300048920 Bacteria 32639
194 Ga0496117_0007778 3300048920 Bacteria 10337
195 Ga0496117_0009216 3300048920 Bacteria 9231
196 Ga0496117_0062038 3300048920 Bacteria 2564
197 Ga0496117_0377498 3300048920 Bacteria 723
198 Ga0496118_0000527 3300048921 Bacteria 62722
199 Ga0496118_0001793 3300048921 Bacteria 31005
200 Ga0496118_0017893 3300048921 Bacteria 6428
201 Ga0496118_0047258 3300048921 Bacteria 3337
202 Ga0496118_0078847 3300048921 Bacteria 2328
203 Ga0496119_0000824 3300048922 Bacteria 41353
204 Ga0496119_0000909 3300048922 Bacteria 38357
205 Ga0496119_0002200 3300048922 Bacteria 21791
206 Ga0496119_0010676 3300048922 Bacteria 7695
207 Ga0496119_0019841 3300048922 Bacteria 4928
208 Ga0496119_0036648 3300048922 Bacteria 3199
209 Ga0496119_0111270 3300048922 Bacteria 1519
210 Ga0496119_0212167 3300048922 Bacteria 995
211 Ga0496120_0000096 3300048923 Bacteria 145880
212 Ga0496120_0000159 3300048923 Bacteria 112577
213 Ga0496120_0000233 3300048923 Bacteria 95589
214 Ga0496120_0001151 3300048923 Bacteria 33896
215 Ga0496120_0003117 3300048923 Bacteria 15560
216 Ga0496121_0001075 3300048924 Bacteria 48357
217 Ga0496121_0001447 3300048924 Bacteria 40045
218 Ga0496121_0003562 3300048924 Bacteria 22032
219 Ga0496121_0006060 3300048924 Bacteria 15221
220 Ga0496121_0020298 3300048924 Bacteria 6586
221 Ga0496122_0001110 3300048925 Bacteria 46499
222 Ga0496122_0007319 3300048925 Bacteria 12326
223 Ga0496122_0185595 3300048925 Bacteria 1234
224 Ga0496123_0000940 3300048926 Bacteria 45468
225 Ga0496123_0003650 3300048926 Bacteria 17021
226 Ga0496123_0004258 3300048926 Bacteria 15236
227 Ga0496123_0031279 3300048926 Bacteria 3874
228 Ga0496123_0079570 3300048926 Bacteria 2002
229 Ga0496123_0189431 3300048926 Bacteria 1065
230 Ga0496123_0193049 3300048926 Bacteria 1051
231 Ga0496124_0000008 3300048927 Bacteria 864372
232 Ga0496124_0002250 3300048927 Bacteria 25638
233 Ga0496124_0025430 3300048927 Bacteria 5362
234 Ga0496124_0101798 3300048927 Bacteria 2326
235 Ga0496125_0000122 3300048928 Bacteria 174898
236 Ga0496125_0000931 3300048928 Bacteria 45982
237 Ga0496125_0013668 3300048928 Bacteria 7964
238 Ga0496125_0013995 3300048928 Bacteria 7844
239 Ga0496125_0028005 3300048928 Bacteria 5096
240 Ga0496125_0061106 3300048928 Bacteria 3024
241 Ga0496125_0150219 3300048928 Bacteria 1601
242 Ga0496126_0000472 3300048929 Bacteria 79898
243 Ga0496126_0016761 3300048929 Bacteria 7317
244 Ga0496126_0045566 3300048929 Bacteria 4029
245 Ga0496126_0193667 3300048929 Bacteria 1720
246 Ga0496126_0512915 3300048929 Bacteria 956
247 Ga0501032_0025640 3300049569 Bacteria 4064
248 Ga0501034_0116344 3300049571 Bacteria 2662
249 Ga0501034_0258584 3300049571 Bacteria 1684
250 Ga0501034_0260152 3300049571 Bacteria 1678
251 Ga0501034_0388303 3300049571 Bacteria 1320
252 Ga0501036_0103802 3300049572 Bacteria 2404
253 Ga0501036_0388220 3300049572 Bacteria 1165
254 Ga0501037_0137078 3300049573 Bacteria 1753
255 Ga0501038_0164712 3300049574 Bacteria 1799
256 Ga0501039_0456492 3300049575 Bacteria 1004
257 Ga0501035_0265287 3300049822 Bacteria 1455
258 nmdc:mga0k408_11129_c1 3300050493 Bacteria 3560
259 nmdc:mga05p37_8493_c1 3300050507 Bacteria 12142
260 nmdc:mga0qj67_173457_c1 3300050509 Bacteria 1751
261 nmdc:mga06r32_111168_c1 3300050510 Bacteria 2696
262 nmdc:mga06r32_496394_c1 3300050510 Bacteria 1198
263 2506578524 2506520007 Bacteria 5442880
264 2506583663 2506520008 Bacteria 5443009
265 2526212177 2526164512 Bacteria 4025691
266 2548649092 2547132416 Bacteria 4633861
267 2599409731 2599185169 Bacteria 5441380
268 2601521775 2600255254 Bacteria 5281859
269 2601526800 2600255255 Bacteria 5282785
270 2601613630 2600255280 Bacteria 5292309
271 2601618353 2600255281 Bacteria 5288753
272 2601643020 2600255287 Bacteria 5210468
273 2601647890 2600255288 Bacteria 5282738
274 2601651778 2600255289 Bacteria 5281907
275 2601657105 2600255290 Bacteria 5282218
276 2601662841 2600255291 Bacteria 5217298
277 2601695800 2600255298 Bacteria 5215185
278 2601700474 2600255299 Bacteria 5218662
279 2601704902 2600255300 Bacteria 5287774
280 2601709931 2600255301 Bacteria 5280532
281 2601714943 2600255302 Bacteria 5288235
282 2601720825 2600255303 Bacteria 5219315
283 2601725349 2600255304 Bacteria 5283973
284 2601729891 2600255305 Bacteria 5282329
285 2601734908 2600255306 Bacteria 5281613
286 2601739593 2600255307 Bacteria 5439064
287 2601750082 2600255309 Bacteria 5431045
288 2602017335 2600255392 Bacteria 5437392
289 2603642111 2602042047 Bacteria 4697674
290 2603660216 2602042052 Bacteria 5215873
291 2603665491 2602042053 Bacteria 5214361
292 2603702723 2602042067 Bacteria 4863713
293 2603837270 2602042103 Bacteria 5284714
294 2603842346 2602042104 Bacteria 5281639
295 2603847419 2602042105 Bacteria 5282303
296 2603852490 2602042106 Bacteria 5282744
297 2603867125 2602042109 Bacteria 5152801
298 2603870544 2602042110 Bacteria 5283285
299 2603875482 2602042111 Bacteria 5212080
300 2606047734 2603880178 Bacteria 5283018
301 2606069922 2603880184 Bacteria 5217896
302 2606145761 2603880202 Bacteria 5284684
303 2606175136 2603880211 Bacteria 5284226
304 2637225659 2636415599 Bacteria 5718434
305 2656279496 2654587920 Bacteria 5475511
306 2671101881 2667528172 Bacteria 5170840
307 2673166666 2671180531 Bacteria 9045424
308 2676406880 2675903046 Bacteria 5451247
309 2678261910 2675903515 Bacteria 6580491
310 2681998498 2681812866 Bacteria 4552357
311 2682005650 2681812869 Bacteria 5014465
312 2689445071 2687453601 Bacteria 5546041
313 2745008258 2744054620 Bacteria 6551379
314 2753856242 2751185917 Bacteria 4551186
315 2765589232 2765235842 Bacteria 4799256
316 2772439050 2772190666 Bacteria 5117644
317 2775539313 2775506706 Bacteria 4873073
318 2777023518 2775507074 Bacteria 5532402
319 2821122714 2821118458 Bacteria 4714306
320 2823374971 2823373977 Bacteria 4779415
321 2844427749 2844425489 Bacteria 4854065
322 2869554491 2869551831 Bacteria 5474685
323 2885269050 2885266251 Bacteria 4796748
324 2888369102 2888366609 Bacteria 5155009
325 2904513479 2904513164 Bacteria 5476410
326 2923635149 2923634449 Bacteria 4753480
327 2927833833 2927833300 Bacteria 4923934
328 2937967667 2937967321 Bacteria 5094075
329 2939575043 2939573065 Bacteria 4926053
330 2969082649 2969079654 Bacteria 5439582
331 2974311870 2974310843 Bacteria 4947816
332 2984559726 2984559226 Bacteria 5683096
333 2984597808 2984595703 Bacteria 5682994
334 8004597305 8004592986 Bacteria 5122074
335 8011351360 8011350971 Bacteria 6158957
336 8015395336 8015394850 Bacteria 5064660
337 8018407556 8018405270 Bacteria 4978981
338 8055090706 8055087960 Bacteria 4784273
339 8055096653 8055092621 Bacteria 4873875
340 Ga0316582_0000185
341 SwRhRL2b_contig_1795684
342 rootH2_10045982
343 rootH1_10198924
344 Ga0058692_1000981
345 Ga0065704_10000240
346 Ga0065704_10132798
347 Ga0070659_100077850
348 Ga0070665_100000600
349 Ga0070704_100326052
350 Ga0070704_101478938
351 Ga0068856_100239401
352 Ga0068851_10255740
353 Ga0081455_10228829
354 Ga0075364_10006172
355 Ga0075366_10048347
356 Ga0075430_100022673
357 Ga0075431_100113102
358 Ga0075431_100505467
359 Ga0079104_1000907
360 Ga0079104_1001643
361 Ga0105251_10000002
362 Ga0105251_10000539
363 Ga0105251_10000549
364 Ga0105251_10001544
365 Ga0105251_10004257
366 Ga0105251_10108360
367 Ga0105251_10108520
368 Ga0105244_10003460
369 Ga0105250_10000330
370 Ga0105250_10016516
371 Ga0105240_10539733
372 Ga0105247_10000045
373 Ga0114129_10027409
374 Ga0105241_10000002
375 Ga0105248_10181375
376 Ga0105248_10901747
377 Ga0105238_10793996
378 Ga0105239_10418226
379 Ga0157373_10001547
380 Ga0157370_10007177
381 Ga0157372_11463882
382 Ga0163163_10139414
383 Ga0182008_10007764
384 Ga0182006_1164325
385 Ga0183366_1001
386 Ga0183370_1001
387 Ga0183369_1001
388 Ga0183368_1001
389 Ga0163161_10000001
390 Ga0207696_1000001
391 Ga0207696_1000003
392 Ga0207696_1000446
393 Ga0207655_1000064
394 Ga0207713_1000002
395 Ga0207713_1000004
396 Ga0207713_1000008
397 Ga0207713_1000016
398 Ga0207713_1000533
399 Ga0207713_1023132
400 Ga0207713_1032097
401 Ga0207713_1034477
402 Ga0207710_10000780
403 Ga0207654_10000005
404 Ga0207695_10423523
405 Ga0207690_10369269
406 Ga0207711_10210346
407 Ga0209281_1000003
408 Ga0209281_1001032
409 Ga0209371_1000001
410 Ga0209371_1000301
411 Ga0209371_1001883
412 Ga0209371_1006269
413 Ga0209371_1034932
414 Ga0268266_10000762
415 Ga0268256_1000001
416 Ga0268256_1000266
417 Ga0268256_1001620
418 Ga0268256_1004974
419 Ga0268256_1047952
420 Ga0265325_10000929
421 Ga0265316_10012559
422 Ga0265316_10028289
423 Ga0307408_100308582
424 Ga0316575_10002981
425 Ga0316575_10154997
426 Ga0316579_10003530
427 Ga0316579_10016216
428 Ga0316579_10028775
429 Ga0316579_10032165
430 Ga0316579_10046542
431 Ga0316579_10101034
432 Ga0316576_10028189
433 Ga0316576_10043208
434 Ga0316576_10054909
435 Ga0316576_10137095
436 Ga0316576_10173452
437 Ga0316576_10345973
438 Ga0316578_10000782
439 Ga0316578_10110452
440 Ga0316578_10306299
441 Ga0316578_10363968
442 Ga0316577_10008192
443 Ga0316577_10010850
444 Ga0316577_10021227
445 Ga0316577_10040196
446 Ga0316577_10043995
447 Ga0316577_10089628
448 Ga0316577_10118314
449 Ga0316577_10153745
450 Ga0316577_10323171
451 Ga0316583_10004616
452 Ga0316583_10017586
453 Ga0316583_10031337
454 Ga0316583_10142365
455 Ga0316585_10036216
456 Ga0316585_10040219
457 Ga0316585_10064615
458 Ga0316580_10006681
459 Ga0316580_10081016
460 Ga0316580_10158810
461 Ga0316593_10030591
462 Ga0316593_10114883
463 Ga0316593_10190893
464 Ga0316592_1025859
465 Ga0316586_1028113
466 Ga0316596_1036172
467 Ga0316596_1053267
468 Ga0316596_1134073
469 Ga0316574_0003902
470 Ga0316574_0081649
471 Ga0316574_0302217
472 Ga0373937_0178125
473 Ga0373937_0217516
474 Ga0316582_0000113
475 Ga0316582_0088384
476 Ga0316582_0116341
477 Ga0316582_0223736
478 Ga0316582_0235562
479 Ga0316582_0241485
480 Ga0316582_0271164
481 Ga0316582_0279900
482 Ga0316584_0002135
483 Ga0316584_0002655
484 Ga0316584_0009270
485 Ga0316584_0012858
486 Ga0316584_0015352
487 Ga0316584_0016776
488 Ga0316584_0188021
489 Ga0316584_0255428
490 Ga0316581_0021866
491 Ga0316581_0058154
492 Ga0316581_0084519
493 Ga0436364_1305061
494 Ga0395901_0151560
495 Ga0400484_43724
496 Ga0400486_01879
497 Ga0400489_32209
498 Ga0400487_28351
499 Ga0439466_0048371
500 Ga0451795_0917145
501 Ga0439432_014825
502 Ga0439452_000062
503 Ga0451577_0000271
504 Ga0451577_1200811
505 Ga0466981_0000007
506 Ga0453684_0000005
507 Ga0453684_0444555
508 Ga0451576_0015235
509 Ga0451576_0735103
510 Ga0451576_1524820
511 Ga0495627_000020
512 Ga0495653_0238340
513 Ga0495650_0000005
514 Ga0495608_0025733
515 Ga0495652_0415351
516 Ga0495609_0092677
517 Ga0495667_0000069
518 Ga0495667_0152985
519 Ga0495635_0063369
520 Ga0495613_0086475
521 Ga0495671_0171926
522 Ga0495600_0350299
523 Ga0495684_0002646
524 Ga0496104_0000344
525 Ga0496104_0224265
526 Ga0496105_0005468
527 Ga0496105_0210930
528 Ga0496116_0000001
529 Ga0496116_0000204
530 Ga0496116_0023838
531 Ga0496117_0000421
532 Ga0496117_0001549
533 Ga0496117_0007778
534 Ga0496117_0009216
535 Ga0496117_0062038
536 Ga0496117_0377498
537 Ga0496118_0000527
538 Ga0496118_0001793
539 Ga0496118_0017893
540 Ga0496118_0047258
541 Ga0496118_0078847
542 Ga0496119_0000824
543 Ga0496119_0000909
544 Ga0496119_0002200
545 Ga0496119_0010676
546 Ga0496119_0019841
547 Ga0496119_0036648
548 Ga0496119_0111270
549 Ga0496119_0212167
550 Ga0496120_0000096
551 Ga0496120_0000159
552 Ga0496120_0000233
553 Ga0496120_0001151
554 Ga0496120_0003117
555 Ga0496121_0001075
556 Ga0496121_0001447
557 Ga0496121_0003562
558 Ga0496121_0006060
559 Ga0496121_0020298
560 Ga0496122_0001110
561 Ga0496122_0007319
562 Ga0496122_0185595
563 Ga0496123_0000940
564 Ga0496123_0003650
565 Ga0496123_0004258
566 Ga0496123_0031279
567 Ga0496123_0079570
568 Ga0496123_0189431
569 Ga0496123_0193049
570 Ga0496124_0000008
571 Ga0496124_0002250
572 Ga0496124_0025430
573 Ga0496124_0101798
574 Ga0496125_0000122
575 Ga0496125_0000931
576 Ga0496125_0013668
577 Ga0496125_0013995
578 Ga0496125_0028005
579 Ga0496125_0061106
580 Ga0496125_0150219
581 Ga0496126_0000472
582 Ga0496126_0016761
583 Ga0496126_0045566
584 Ga0496126_0193667
585 Ga0496126_0512915
586 Ga0501032_0025640
587 Ga0501034_0116344
588 Ga0501034_0258584
589 Ga0501034_0260152
590 Ga0501034_0388303
591 Ga0501036_0103802
592 Ga0501036_0388220
593 Ga0501037_0137078
594 Ga0501038_0164712
595 Ga0501039_0456492
596 Ga0501035_0265287
597 nmdc:mga0k408_11129_c1
598 nmdc:mga05p37_8493_c1
599 nmdc:mga0qj67_173457_c1
600 nmdc:mga06r32_111168_c1
601 nmdc:mga06r32_496394_c1
602 2506578524
603 2506583663
604 2526212177
605 2548649092
606 2599409731
607 2601521775
608 2601526800
609 2601613630
610 2601618353
611 2601643020
612 2601647890
613 2601651778
614 2601657105
615 2601662841
616 2601695800
617 2601700474
618 2601704902
619 2601709931
620 2601714943
621 2601720825
622 2601725349
623 2601729891
624 2601734908
625 2601739593
626 2601750082
627 2602017335
628 2603642111
629 2603660216
630 2603665491
631 2603702723
632 2603837270
633 2603842346
634 2603847419
635 2603852490
636 2603867125
637 2603870544
638 2603875482
639 2606047734
640 2606069922
641 2606145761
642 2606175136
643 2637225659
644 2656279496
645 2671101881
646 2673166666
647 2676406880
648 2678261910
649 2681998498
650 2682005650
651 2689445071
652 2745008258
653 2753856242
654 2765589232
655 2772439050
656 2775539313
657 2777023518
658 2821122714
659 2823374971
660 2844427749
661 2869554491
662 2885269050
663 2888369102
664 2904513479
665 2923635149
666 2927833833
667 2937967667
668 2939575043
669 2969082649
670 2974311870
671 2984559726
672 2984597808
673 8004597305
674 8011351360
675 8015395336
676 8018407556
677 8055090706
678 8055096653

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

39

221

0.98

PF00117

GATase

Glutamine amidotransferase class-I

94

191

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ofw-assembly2.cif.gz_F crystal structure of arabidopsis thaliana dj-1d 0.9797 3 187
3uk7-assembly1.cif.gz_C crystal structure of arabidopsis thaliana dj-1d 0.977 3 187
4ogg-assembly1.cif.gz_A crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog 0.9728 3 187
4ofw-assembly2.cif.gz_F crystal structure of arabidopsis thaliana dj-1d 0.9593 3 187
3uk7-assembly1.cif.gz_C crystal structure of arabidopsis thaliana dj-1d 0.9566 3 187
ID Description Score Start End Superfamily
af_K7LRD9_234_303_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9857 131 187 3.40.50.720
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9777 2 187 3.40.50.880
af_K7LRD9_139_233_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9751 3 104 3.40.50.880
4oggA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9691 4 187 3.40.50.880
af_Q869N4_1_194_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9624 2 187 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7U3R3L3-F1-model_v4 deleted 1.005 102 188
AF-A0A645I3M4-F1-model_v4 DJ-1/PfpI domain-containing protein 1.005 114 187
AF-A0A1C7Z0C6-F1-model_v4 Glutamine amidotransferase 1.004 102 187 GO:0016740
AF-A0A352IP49-F1-model_v4 Protease 1.004 96 181 GO:0006508
GO:0008233
AF-A0A2S8K2R1-F1-model_v4 deleted 1.003 89 181

Map