F413998
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 339 | 196 | 678 | 190 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0000185|Ga0316582_0000185_15345_16031 |
| Length | 228 |
| Sequence | MSVARWATFTVYLRYRQLTTNHGHRAFLLGLKGGKMAAKKILLLAGDFVEDYEIMVPFQALQMVGHTVHAVCPDKKAGETVRTAVHDFEGDQTYSEKPGHNFTLNASFDEIKADDYDALVIPGGRAPEYIRLNNSVLKIVQHFAETQKPIAAICHGAQLLAAAGVLKSKSCSAYPAVGPDVKASGGEFVDIPVDQAHVDGNLVSAPAWPAHPDWLAKFLRVLGTKVEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 5 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 6 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 11 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 12 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 14 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 15 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 16 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 17 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 18 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 24 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 33 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 34 | 3300015679 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 | Metagenome | Unclassified |
| 35 | 3300015680 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 | Metagenome | Rhizosphere |
| 36 | 3300015685 | Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 | Metagenome | Unclassified |
| 37 | 3300015687 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 | Metagenome | Rhizosphere |
| 38 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 48 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 51 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 52 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 53 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 54 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 55 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 56 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 57 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 58 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 59 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 60 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 61 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 62 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 63 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 65 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 66 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 67 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 68 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 69 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 70 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 71 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 72 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 73 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 74 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 75 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 76 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 77 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 78 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 79 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 80 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 81 | 3300044669 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E | Metagenome | Unclassified |
| 82 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 83 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 84 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 87 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 88 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 89 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 90 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 97 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 98 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 99 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 100 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 101 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 102 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 103 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 104 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 105 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 106 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 107 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 108 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 109 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 110 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 111 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 114 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 115 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 117 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 120 | 2506520007 | Serratia plymuthica AS9 | Isolate | Rhizosphere |
| 121 | 2506520008 | Serratia plymuthica AS12 | Isolate | Unclassified |
| 122 | 2526164512 | Azovibrio restrictus DSM 23866 | Isolate | Unclassified |
| 123 | 2547132416 | Enterobacter sp. MR1 | Isolate | Rhizoplane |
| 124 | 2599185169 | Klebsiella quasipneumoniae NFPP35 | Isolate | Rhizoplane |
| 125 | 2600255254 | Klebsiella quasipneumoniae NFIX15 | Isolate | Rhizoplane |
| 126 | 2600255255 | Klebsiella quasipneumoniae NFIX23 | Isolate | Rhizoplane |
| 127 | 2600255280 | Klebsiella quasipneumoniae NFIX42 | Isolate | Rhizoplane |
| 128 | 2600255281 | Klebsiella quasipneumoniae NFIX43 | Isolate | Rhizoplane |
| 129 | 2600255287 | Klebsiella quasipneumoniae NFIX11 | Isolate | Rhizoplane |
| 130 | 2600255288 | Klebsiella quasipneumoniae NFIX14 | Isolate | Rhizoplane |
| 131 | 2600255289 | Klebsiella quasipneumoniae NFIX16 | Isolate | Rhizoplane |
| 132 | 2600255290 | Klebsiella quasipneumoniae NFIX17 | Isolate | Rhizoplane |
| 133 | 2600255291 | Klebsiella quasipneumoniae NFIX19 | Isolate | Rhizoplane |
| 134 | 2600255298 | Klebsiella quasipneumoniae NFIX21 | Isolate | Rhizoplane |
| 135 | 2600255299 | Klebsiella quasipneumoniae NFIX22 | Isolate | Rhizoplane |
| 136 | 2600255300 | Klebsiella quasipneumoniae NFIX30 | Isolate | Rhizoplane |
| 137 | 2600255301 | Klebsiella quasipneumoniae NFIX33 | Isolate | Rhizoplane |
| 138 | 2600255302 | Klebsiella quasipneumoniae NFIX35 | Isolate | Rhizoplane |
| 139 | 2600255303 | Klebsiella quasipneumoniae NFIX36 | Isolate | Rhizoplane |
| 140 | 2600255304 | Klebsiella quasipneumoniae NFIX37 | Isolate | Rhizoplane |
| 141 | 2600255305 | Klebsiella quasipneumoniae NFIX41 | Isolate | Rhizoplane |
| 142 | 2600255306 | Klebsiella quasipneumoniae NFIX44 | Isolate | Rhizoplane |
| 143 | 2600255307 | Klebsiella quasipneumoniae NFIX56 | Isolate | Rhizoplane |
| 144 | 2600255309 | Klebsiella sp. NFIX53 | Isolate | Rhizoplane |
| 145 | 2600255392 | Klebsiella quasipneumoniae NFIX54 | Isolate | Rhizoplane |
| 146 | 2602042047 | Enterobacter sp. NFIX59 | Isolate | Rhizoplane |
| 147 | 2602042052 | Klebsiella quasipneumoniae NFIX18 | Isolate | Rhizoplane |
| 148 | 2602042053 | Klebsiella quasipneumoniae NFIX12 | Isolate | Rhizoplane |
| 149 | 2602042067 | Enterobacter sp. NFIX58 | Isolate | Rhizoplane |
| 150 | 2602042103 | Klebsiella quasipneumoniae NFIX29 | Isolate | Rhizoplane |
| 151 | 2602042104 | Klebsiella quasipneumoniae NFIX26 | Isolate | Rhizoplane |
| 152 | 2602042105 | Klebsiella quasipneumoniae NFIX25 | Isolate | Rhizoplane |
| 153 | 2602042106 | Klebsiella quasipneumoniae NFIX13 | Isolate | Rhizoplane |
| 154 | 2602042109 | Klebsiella aerogenes NFIX39 | Isolate | Rhizoplane |
| 155 | 2602042110 | Klebsiella quasipneumoniae NFIX40 | Isolate | Rhizoplane |
| 156 | 2602042111 | Klebsiella quasipneumoniae NFIX20 | Isolate | Rhizoplane |
| 157 | 2603880178 | Klebsiella quasipneumoniae NFIX34 | Isolate | Rhizoplane |
| 158 | 2603880184 | Klebsiella quasipneumoniae NFIX27 | Isolate | Rhizoplane |
| 159 | 2603880202 | Klebsiella quasipneumoniae NFIX38 | Isolate | Rhizoplane |
| 160 | 2603880211 | Klebsiella quasipneumoniae NFIX24 | Isolate | Rhizoplane |
| 161 | 2636415599 | Klebsiella variicola DX120E | Isolate | Unclassified |
| 162 | 2654587920 | Serratia plymuthica HRO-C48 | Isolate | Rhizosphere |
| 163 | 2667528172 | Enterobacteriaceae bacterium NFIX31 | Isolate | Rhizoplane |
| 164 | 2671180531 | Gemmata sp. SH-PL17 | Isolate | Unclassified |
| 165 | 2675903046 | Klebsiella quasipneumoniae NFIX52 | Isolate | Rhizoplane |
| 166 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 167 | 2681812866 | Enterobacter asburiae NFIX55 | Isolate | Rhizoplane |
| 168 | 2681812869 | Enterobacter ludwigii NFPP41 | Isolate | Rhizoplane |
| 169 | 2687453601 | Serratia plymuthica 3Rp8 | Isolate | Unclassified |
| 170 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 171 | 2751185917 | Enterobacter sp. HK169 | Isolate | Unclassified |
| 172 | 2765235842 | Enterobacter ludwigii AA4 | Isolate | Unclassified |
| 173 | 2772190666 | Serratia surfactantfaciens YD25 | Isolate | Unclassified |
| 174 | 2775506706 | Enterobacter asburiae 1216 | Isolate | Unclassified |
| 175 | 2775507074 | Klebsiella sp. D5A | Isolate | Unclassified |
| 176 | 2821118458 | Enterobacter asburiae 609 | Isolate | Unclassified |
| 177 | 2823373977 | Enterobacter ludwigii NCR3 | Isolate | Rhizosphere |
| 178 | 2844425489 | Enterobacter cloacae SBP-8 | Isolate | Rhizosphere |
| 179 | 2869551831 | Serratia inhibens PRI-2C | Isolate | Rhizosphere |
| 180 | 2885266251 | Ralstonia sp. SET104 | Isolate | Nodule |
| 181 | 2888366609 | Serratia sp. NGAS9 | Isolate | Rhizosphere |
| 182 | 2904513164 | Klebsiella variicola 1431 | Isolate | Rhizosphere |
| 183 | 2923634449 | Enterobacter kobei SLBN-76 | Isolate | Rhizosphere |
| 184 | 2927833300 | Enterobacter sp. SLBN-59 | Isolate | Rhizosphere |
| 185 | 2937967321 | Serratia sp. YC16 | Isolate | Unclassified |
| 186 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 187 | 2969079654 | Klebsiella variicola E57-7 | Isolate | Unclassified |
| 188 | 2974310843 | Enterobacter sp. SORGH_AS 287 | Isolate | Unclassified |
| 189 | 2984559226 | Klebsiella variicola SORGH_AS834 | Isolate | Aerial Root |
| 190 | 2984595703 | Klebsiella variicola SORGH_AS1070 | Isolate | Aerial Root |
| 191 | 8004592986 | Serratia sp. S119 | Isolate | Unclassified |
| 192 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 193 | 8015394850 | Serratia sp. PGPR-27 | Isolate | Rhizosphere |
| 194 | 8018405270 | Enterobacter sp. 198 | Isolate | Rhizosphere |
| 195 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 196 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.93 |
| Metatranscriptomes | 2.36 |
| Isolates | 22.71 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.59 |
| Bulb | 0 |
| Endosphere | 0.88 |
| Nodule | 1.47 |
| Rhizoplane | 13.86 |
| Rhizosphere | 58.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0316582_0000185 | 3300036647 | Bacteria | 19514 |
| 2 | SwRhRL2b_contig_1795684 | 2162886007 | Bacteria | 7259 |
| 3 | rootH2_10045982 | 3300003320 | Bacteria | 32690 |
| 4 | rootH1_10198924 | 3300003323 | Bacteria | 1755 |
| 5 | Ga0058692_1000981 | 3300003856 | Bacteria | 11231 |
| 6 | Ga0065704_10000240 | 3300005289 | Bacteria | 56098 |
| 7 | Ga0065704_10132798 | 3300005289 | Bacteria | 1608 |
| 8 | Ga0070659_100077850 | 3300005366 | Bacteria | 2645 |
| 9 | Ga0070665_100000600 | 3300005548 | Bacteria | 49830 |
| 10 | Ga0070704_100326052 | 3300005549 | Bacteria | 1288 |
| 11 | Ga0070704_101478938 | 3300005549 | Bacteria | 624 |
| 12 | Ga0068856_100239401 | 3300005614 | Bacteria | 1830 |
| 13 | Ga0068851_10255740 | 3300005834 | Bacteria | 995 |
| 14 | Ga0081455_10228829 | 3300005937 | Bacteria | 1373 |
| 15 | Ga0075364_10006172 | 3300006051 | Bacteria | 7020 |
| 16 | Ga0075366_10048347 | 3300006195 | Bacteria | 2522 |
| 17 | Ga0075430_100022673 | 3300006846 | Bacteria | 5342 |
| 18 | Ga0075431_100113102 | 3300006847 | Bacteria | 2802 |
| 19 | Ga0075431_100505467 | 3300006847 | Bacteria | 1199 |
| 20 | Ga0079104_1000907 | 3300006946 | Bacteria | 24005 |
| 21 | Ga0079104_1001643 | 3300006946 | Bacteria | 14483 |
| 22 | Ga0105251_10000002 | 3300009011 | Bacteria | 350843 |
| 23 | Ga0105251_10000539 | 3300009011 | Bacteria | 35683 |
| 24 | Ga0105251_10000549 | 3300009011 | Bacteria | 35334 |
| 25 | Ga0105251_10001544 | 3300009011 | Bacteria | 19757 |
| 26 | Ga0105251_10004257 | 3300009011 | Bacteria | 9863 |
| 27 | Ga0105251_10108360 | 3300009011 | Bacteria | 1266 |
| 28 | Ga0105251_10108520 | 3300009011 | Bacteria | 1265 |
| 29 | Ga0105244_10003460 | 3300009036 | Bacteria | 11247 |
| 30 | Ga0105250_10000330 | 3300009092 | Bacteria | 36615 |
| 31 | Ga0105250_10016516 | 3300009092 | Bacteria | 3005 |
| 32 | Ga0105240_10539733 | 3300009093 | Bacteria | 1292 |
| 33 | Ga0105247_10000045 | 3300009101 | Bacteria | 153175 |
| 34 | Ga0114129_10027409 | 3300009147 | Bacteria | 8066 |
| 35 | Ga0105241_10000002 | 3300009174 | Bacteria | 869480 |
| 36 | Ga0105248_10181375 | 3300009177 | Bacteria | 2372 |
| 37 | Ga0105248_10901747 | 3300009177 | Bacteria | 998 |
| 38 | Ga0105238_10793996 | 3300009551 | Bacteria | 962 |
| 39 | Ga0105239_10418226 | 3300010375 | Bacteria | 1518 |
| 40 | Ga0157373_10001547 | 3300013100 | Bacteria | 17560 |
| 41 | Ga0157370_10007177 | 3300013104 | Bacteria | 12157 |
| 42 | Ga0157372_11463882 | 3300013307 | Bacteria | 787 |
| 43 | Ga0163163_10139414 | 3300014325 | Bacteria | 2467 |
| 44 | Ga0182008_10007764 | 3300014497 | Bacteria | 5903 |
| 45 | Ga0182006_1164325 | 3300015261 | Bacteria | 746 |
| 46 | Ga0183366_1001 | 3300015679 | Bacteria | 2743932 |
| 47 | Ga0183370_1001 | 3300015680 | Bacteria | 2743932 |
| 48 | Ga0183369_1001 | 3300015685 | Bacteria | 2743932 |
| 49 | Ga0183368_1001 | 3300015687 | Bacteria | 2743932 |
| 50 | Ga0163161_10000001 | 3300017792 | Bacteria | 2041488 |
| 51 | Ga0207696_1000001 | 3300025711 | Bacteria | 2579611 |
| 52 | Ga0207696_1000003 | 3300025711 | Bacteria | 860639 |
| 53 | Ga0207696_1000446 | 3300025711 | Bacteria | 36487 |
| 54 | Ga0207655_1000064 | 3300025728 | Bacteria | 255782 |
| 55 | Ga0207713_1000002 | 3300025735 | Bacteria | 1061749 |
| 56 | Ga0207713_1000004 | 3300025735 | Bacteria | 702781 |
| 57 | Ga0207713_1000008 | 3300025735 | Bacteria | 553952 |
| 58 | Ga0207713_1000016 | 3300025735 | Bacteria | 421689 |
| 59 | Ga0207713_1000533 | 3300025735 | Bacteria | 38234 |
| 60 | Ga0207713_1023132 | 3300025735 | Bacteria | 2933 |
| 61 | Ga0207713_1032097 | 3300025735 | Bacteria | 2311 |
| 62 | Ga0207713_1034477 | 3300025735 | Bacteria | 2198 |
| 63 | Ga0207710_10000780 | 3300025900 | Bacteria | 17362 |
| 64 | Ga0207654_10000005 | 3300025911 | Bacteria | 869492 |
| 65 | Ga0207695_10423523 | 3300025913 | Bacteria | 1215 |
| 66 | Ga0207690_10369269 | 3300025932 | Bacteria | 1138 |
| 67 | Ga0207711_10210346 | 3300025941 | Bacteria | 1776 |
| 68 | Ga0209281_1000003 | 3300027111 | Bacteria | 1260089 |
| 69 | Ga0209281_1001032 | 3300027111 | Bacteria | 21394 |
| 70 | Ga0209371_1000001 | 3300027312 | Bacteria | 2771503 |
| 71 | Ga0209371_1000301 | 3300027312 | Bacteria | 55150 |
| 72 | Ga0209371_1001883 | 3300027312 | Bacteria | 12871 |
| 73 | Ga0209371_1006269 | 3300027312 | Bacteria | 4449 |
| 74 | Ga0209371_1034932 | 3300027312 | Bacteria | 1062 |
| 75 | Ga0268266_10000762 | 3300028379 | Bacteria | 43072 |
| 76 | Ga0268256_1000001 | 3300030500 | Bacteria | 2771065 |
| 77 | Ga0268256_1000266 | 3300030500 | Bacteria | 55130 |
| 78 | Ga0268256_1001620 | 3300030500 | Bacteria | 13032 |
| 79 | Ga0268256_1004974 | 3300030500 | Bacteria | 5356 |
| 80 | Ga0268256_1047952 | 3300030500 | Bacteria | 916 |
| 81 | Ga0265325_10000929 | 3300031241 | Bacteria | 21157 |
| 82 | Ga0265316_10012559 | 3300031344 | Bacteria | 7586 |
| 83 | Ga0265316_10028289 | 3300031344 | Bacteria | 4626 |
| 84 | Ga0307408_100308582 | 3300031548 | Bacteria | 1328 |
| 85 | Ga0316575_10002981 | 3300031665 | Bacteria | 5765 |
| 86 | Ga0316575_10154997 | 3300031665 | Bacteria | 946 |
| 87 | Ga0316579_10003530 | 3300031691 | Bacteria | 6120 |
| 88 | Ga0316579_10016216 | 3300031691 | Bacteria | 3250 |
| 89 | Ga0316579_10028775 | 3300031691 | Bacteria | 2531 |
| 90 | Ga0316579_10032165 | 3300031691 | Bacteria | 2405 |
| 91 | Ga0316579_10046542 | 3300031691 | Bacteria | 2024 |
| 92 | Ga0316579_10101034 | 3300031691 | Bacteria | 1381 |
| 93 | Ga0316576_10028189 | 3300031727 | Bacteria | 3956 |
| 94 | Ga0316576_10043208 | 3300031727 | Bacteria | 3251 |
| 95 | Ga0316576_10054909 | 3300031727 | Bacteria | 2906 |
| 96 | Ga0316576_10137095 | 3300031727 | Bacteria | 1842 |
| 97 | Ga0316576_10173452 | 3300031727 | Bacteria | 1627 |
| 98 | Ga0316576_10345973 | 3300031727 | Bacteria | 1107 |
| 99 | Ga0316578_10000782 | 3300031728 | Bacteria | 11736 |
| 100 | Ga0316578_10110452 | 3300031728 | Bacteria | 1651 |
| 101 | Ga0316578_10306299 | 3300031728 | Bacteria | 949 |
| 102 | Ga0316578_10363968 | 3300031728 | Bacteria | 860 |
| 103 | Ga0316577_10008192 | 3300031733 | Bacteria | 5595 |
| 104 | Ga0316577_10010850 | 3300031733 | Bacteria | 4926 |
| 105 | Ga0316577_10021227 | 3300031733 | Bacteria | 3602 |
| 106 | Ga0316577_10040196 | 3300031733 | Unclassified | 2616 |
| 107 | Ga0316577_10043995 | 3300031733 | Bacteria | 2497 |
| 108 | Ga0316577_10089628 | 3300031733 | Bacteria | 1722 |
| 109 | Ga0316577_10118314 | 3300031733 | Bacteria | 1488 |
| 110 | Ga0316577_10153745 | 3300031733 | Bacteria | 1297 |
| 111 | Ga0316577_10323171 | 3300031733 | Bacteria | 875 |
| 112 | Ga0316583_10004616 | 3300032133 | Bacteria | 4914 |
| 113 | Ga0316583_10017586 | 3300032133 | Bacteria | 2572 |
| 114 | Ga0316583_10031337 | 3300032133 | Bacteria | 1893 |
| 115 | Ga0316583_10142365 | 3300032133 | Bacteria | 835 |
| 116 | Ga0316585_10036216 | 3300032137 | Bacteria | 1564 |
| 117 | Ga0316585_10040219 | 3300032137 | Bacteria | 1488 |
| 118 | Ga0316585_10064615 | 3300032137 | Bacteria | 1185 |
| 119 | Ga0316580_10006681 | 3300032139 | Bacteria | 3410 |
| 120 | Ga0316580_10081016 | 3300032139 | Bacteria | 993 |
| 121 | Ga0316580_10158810 | 3300032139 | Bacteria | 694 |
| 122 | Ga0316593_10030591 | 3300032168 | Bacteria | 1749 |
| 123 | Ga0316593_10114883 | 3300032168 | Bacteria | 963 |
| 124 | Ga0316593_10190893 | 3300032168 | Bacteria | 755 |
| 125 | Ga0316592_1025859 | 3300033524 | Bacteria | 1266 |
| 126 | Ga0316586_1028113 | 3300033527 | Bacteria | 955 |
| 127 | Ga0316596_1036172 | 3300033541 | Bacteria | 1290 |
| 128 | Ga0316596_1053267 | 3300033541 | Bacteria | 1073 |
| 129 | Ga0316596_1134073 | 3300033541 | Bacteria | 677 |
| 130 | Ga0316574_0003902 | 3300035398 | Bacteria | 7750 |
| 131 | Ga0316574_0081649 | 3300035398 | Bacteria | 2053 |
| 132 | Ga0316574_0302217 | 3300035398 | Bacteria | 1017 |
| 133 | Ga0373937_0178125 | 3300036401 | Bacteria | 1996 |
| 134 | Ga0373937_0217516 | 3300036401 | Bacteria | 1798 |
| 135 | Ga0316582_0000113 | 3300036647 | Bacteria | 22888 |
| 136 | Ga0316582_0088384 | 3300036647 | Bacteria | 2035 |
| 137 | Ga0316582_0116341 | 3300036647 | Bacteria | 1785 |
| 138 | Ga0316582_0223736 | 3300036647 | Bacteria | 1287 |
| 139 | Ga0316582_0235562 | 3300036647 | Bacteria | 1253 |
| 140 | Ga0316582_0241485 | 3300036647 | Bacteria | 1237 |
| 141 | Ga0316582_0271164 | 3300036647 | Bacteria | 1164 |
| 142 | Ga0316582_0279900 | 3300036647 | Bacteria | 1145 |
| 143 | Ga0316584_0002135 | 3300036712 | Bacteria | 12375 |
| 144 | Ga0316584_0002655 | 3300036712 | Bacteria | 11408 |
| 145 | Ga0316584_0009270 | 3300036712 | Bacteria | 6823 |
| 146 | Ga0316584_0012858 | 3300036712 | Bacteria | 5908 |
| 147 | Ga0316584_0015352 | 3300036712 | Bacteria | 5476 |
| 148 | Ga0316584_0016776 | 3300036712 | Bacteria | 5254 |
| 149 | Ga0316584_0188021 | 3300036712 | Bacteria | 1528 |
| 150 | Ga0316584_0255428 | 3300036712 | Bacteria | 1279 |
| 151 | Ga0316581_0021866 | 3300037588 | Bacteria | 1883 |
| 152 | Ga0316581_0058154 | 3300037588 | Bacteria | 1186 |
| 153 | Ga0316581_0084519 | 3300037588 | Bacteria | 976 |
| 154 | Ga0436364_1305061 | 3300037853 | Bacteria | 2604 |
| 155 | Ga0395901_0151560 | 3300038443 | Bacteria | 2436 |
| 156 | Ga0400484_43724 | 3300038725 | Bacteria | 4379 |
| 157 | Ga0400486_01879 | 3300038742 | Bacteria | 1018 |
| 158 | Ga0400489_32209 | 3300039093 | Bacteria | 2699 |
| 159 | Ga0400487_28351 | 3300039110 | Bacteria | 14795 |
| 160 | Ga0439466_0048371 | 3300041411 | Bacteria | 1399 |
| 161 | Ga0451795_0917145 | 3300041456 | Unclassified | 860 |
| 162 | Ga0439432_014825 | 3300042006 | Bacteria | 2635 |
| 163 | Ga0439452_000062 | 3300042010 | Bacteria | 100841 |
| 164 | Ga0451577_0000271 | 3300042876 | Bacteria | 101284 |
| 165 | Ga0451577_1200811 | 3300042876 | Bacteria | 676 |
| 166 | Ga0466981_0000007 | 3300044669 | Bacteria | 155983 |
| 167 | Ga0453684_0000005 | 3300044712 | Bacteria | 1431632 |
| 168 | Ga0453684_0444555 | 3300044712 | Bacteria | 1444 |
| 169 | Ga0451576_0015235 | 3300045051 | Bacteria | 8525 |
| 170 | Ga0451576_0735103 | 3300045051 | Bacteria | 1037 |
| 171 | Ga0451576_1524820 | 3300045051 | Bacteria | 694 |
| 172 | Ga0495627_000020 | 3300046453 | Bacteria | 291866 |
| 173 | Ga0495653_0238340 | 3300046463 | Bacteria | 1214 |
| 174 | Ga0495650_0000005 | 3300046471 | Bacteria | 766553 |
| 175 | Ga0495608_0025733 | 3300046511 | Bacteria | 4017 |
| 176 | Ga0495652_0415351 | 3300046529 | Bacteria | 949 |
| 177 | Ga0495609_0092677 | 3300046538 | Bacteria | 1313 |
| 178 | Ga0495667_0000069 | 3300046559 | Bacteria | 79580 |
| 179 | Ga0495667_0152985 | 3300046559 | Bacteria | 1485 |
| 180 | Ga0495635_0063369 | 3300046663 | Bacteria | 2539 |
| 181 | Ga0495613_0086475 | 3300046689 | Bacteria | 2273 |
| 182 | Ga0495671_0171926 | 3300046692 | Bacteria | 1053 |
| 183 | Ga0495600_0350299 | 3300046809 | Bacteria | 925 |
| 184 | Ga0495684_0002646 | 3300047471 | Bacteria | 14221 |
| 185 | Ga0496104_0000344 | 3300048907 | Bacteria | 41481 |
| 186 | Ga0496104_0224265 | 3300048907 | Bacteria | 1792 |
| 187 | Ga0496105_0005468 | 3300048908 | Bacteria | 9639 |
| 188 | Ga0496105_0210930 | 3300048908 | Bacteria | 1583 |
| 189 | Ga0496116_0000001 | 3300048919 | Bacteria | 1501681 |
| 190 | Ga0496116_0000204 | 3300048919 | Bacteria | 113862 |
| 191 | Ga0496116_0023838 | 3300048919 | Bacteria | 4545 |
| 192 | Ga0496117_0000421 | 3300048920 | Bacteria | 71461 |
| 193 | Ga0496117_0001549 | 3300048920 | Bacteria | 32639 |
| 194 | Ga0496117_0007778 | 3300048920 | Bacteria | 10337 |
| 195 | Ga0496117_0009216 | 3300048920 | Bacteria | 9231 |
| 196 | Ga0496117_0062038 | 3300048920 | Bacteria | 2564 |
| 197 | Ga0496117_0377498 | 3300048920 | Bacteria | 723 |
| 198 | Ga0496118_0000527 | 3300048921 | Bacteria | 62722 |
| 199 | Ga0496118_0001793 | 3300048921 | Bacteria | 31005 |
| 200 | Ga0496118_0017893 | 3300048921 | Bacteria | 6428 |
| 201 | Ga0496118_0047258 | 3300048921 | Bacteria | 3337 |
| 202 | Ga0496118_0078847 | 3300048921 | Bacteria | 2328 |
| 203 | Ga0496119_0000824 | 3300048922 | Bacteria | 41353 |
| 204 | Ga0496119_0000909 | 3300048922 | Bacteria | 38357 |
| 205 | Ga0496119_0002200 | 3300048922 | Bacteria | 21791 |
| 206 | Ga0496119_0010676 | 3300048922 | Bacteria | 7695 |
| 207 | Ga0496119_0019841 | 3300048922 | Bacteria | 4928 |
| 208 | Ga0496119_0036648 | 3300048922 | Bacteria | 3199 |
| 209 | Ga0496119_0111270 | 3300048922 | Bacteria | 1519 |
| 210 | Ga0496119_0212167 | 3300048922 | Bacteria | 995 |
| 211 | Ga0496120_0000096 | 3300048923 | Bacteria | 145880 |
| 212 | Ga0496120_0000159 | 3300048923 | Bacteria | 112577 |
| 213 | Ga0496120_0000233 | 3300048923 | Bacteria | 95589 |
| 214 | Ga0496120_0001151 | 3300048923 | Bacteria | 33896 |
| 215 | Ga0496120_0003117 | 3300048923 | Bacteria | 15560 |
| 216 | Ga0496121_0001075 | 3300048924 | Bacteria | 48357 |
| 217 | Ga0496121_0001447 | 3300048924 | Bacteria | 40045 |
| 218 | Ga0496121_0003562 | 3300048924 | Bacteria | 22032 |
| 219 | Ga0496121_0006060 | 3300048924 | Bacteria | 15221 |
| 220 | Ga0496121_0020298 | 3300048924 | Bacteria | 6586 |
| 221 | Ga0496122_0001110 | 3300048925 | Bacteria | 46499 |
| 222 | Ga0496122_0007319 | 3300048925 | Bacteria | 12326 |
| 223 | Ga0496122_0185595 | 3300048925 | Bacteria | 1234 |
| 224 | Ga0496123_0000940 | 3300048926 | Bacteria | 45468 |
| 225 | Ga0496123_0003650 | 3300048926 | Bacteria | 17021 |
| 226 | Ga0496123_0004258 | 3300048926 | Bacteria | 15236 |
| 227 | Ga0496123_0031279 | 3300048926 | Bacteria | 3874 |
| 228 | Ga0496123_0079570 | 3300048926 | Bacteria | 2002 |
| 229 | Ga0496123_0189431 | 3300048926 | Bacteria | 1065 |
| 230 | Ga0496123_0193049 | 3300048926 | Bacteria | 1051 |
| 231 | Ga0496124_0000008 | 3300048927 | Bacteria | 864372 |
| 232 | Ga0496124_0002250 | 3300048927 | Bacteria | 25638 |
| 233 | Ga0496124_0025430 | 3300048927 | Bacteria | 5362 |
| 234 | Ga0496124_0101798 | 3300048927 | Bacteria | 2326 |
| 235 | Ga0496125_0000122 | 3300048928 | Bacteria | 174898 |
| 236 | Ga0496125_0000931 | 3300048928 | Bacteria | 45982 |
| 237 | Ga0496125_0013668 | 3300048928 | Bacteria | 7964 |
| 238 | Ga0496125_0013995 | 3300048928 | Bacteria | 7844 |
| 239 | Ga0496125_0028005 | 3300048928 | Bacteria | 5096 |
| 240 | Ga0496125_0061106 | 3300048928 | Bacteria | 3024 |
| 241 | Ga0496125_0150219 | 3300048928 | Bacteria | 1601 |
| 242 | Ga0496126_0000472 | 3300048929 | Bacteria | 79898 |
| 243 | Ga0496126_0016761 | 3300048929 | Bacteria | 7317 |
| 244 | Ga0496126_0045566 | 3300048929 | Bacteria | 4029 |
| 245 | Ga0496126_0193667 | 3300048929 | Bacteria | 1720 |
| 246 | Ga0496126_0512915 | 3300048929 | Bacteria | 956 |
| 247 | Ga0501032_0025640 | 3300049569 | Bacteria | 4064 |
| 248 | Ga0501034_0116344 | 3300049571 | Bacteria | 2662 |
| 249 | Ga0501034_0258584 | 3300049571 | Bacteria | 1684 |
| 250 | Ga0501034_0260152 | 3300049571 | Bacteria | 1678 |
| 251 | Ga0501034_0388303 | 3300049571 | Bacteria | 1320 |
| 252 | Ga0501036_0103802 | 3300049572 | Bacteria | 2404 |
| 253 | Ga0501036_0388220 | 3300049572 | Bacteria | 1165 |
| 254 | Ga0501037_0137078 | 3300049573 | Bacteria | 1753 |
| 255 | Ga0501038_0164712 | 3300049574 | Bacteria | 1799 |
| 256 | Ga0501039_0456492 | 3300049575 | Bacteria | 1004 |
| 257 | Ga0501035_0265287 | 3300049822 | Bacteria | 1455 |
| 258 | nmdc:mga0k408_11129_c1 | 3300050493 | Bacteria | 3560 |
| 259 | nmdc:mga05p37_8493_c1 | 3300050507 | Bacteria | 12142 |
| 260 | nmdc:mga0qj67_173457_c1 | 3300050509 | Bacteria | 1751 |
| 261 | nmdc:mga06r32_111168_c1 | 3300050510 | Bacteria | 2696 |
| 262 | nmdc:mga06r32_496394_c1 | 3300050510 | Bacteria | 1198 |
| 263 | 2506578524 | 2506520007 | Bacteria | 5442880 |
| 264 | 2506583663 | 2506520008 | Bacteria | 5443009 |
| 265 | 2526212177 | 2526164512 | Bacteria | 4025691 |
| 266 | 2548649092 | 2547132416 | Bacteria | 4633861 |
| 267 | 2599409731 | 2599185169 | Bacteria | 5441380 |
| 268 | 2601521775 | 2600255254 | Bacteria | 5281859 |
| 269 | 2601526800 | 2600255255 | Bacteria | 5282785 |
| 270 | 2601613630 | 2600255280 | Bacteria | 5292309 |
| 271 | 2601618353 | 2600255281 | Bacteria | 5288753 |
| 272 | 2601643020 | 2600255287 | Bacteria | 5210468 |
| 273 | 2601647890 | 2600255288 | Bacteria | 5282738 |
| 274 | 2601651778 | 2600255289 | Bacteria | 5281907 |
| 275 | 2601657105 | 2600255290 | Bacteria | 5282218 |
| 276 | 2601662841 | 2600255291 | Bacteria | 5217298 |
| 277 | 2601695800 | 2600255298 | Bacteria | 5215185 |
| 278 | 2601700474 | 2600255299 | Bacteria | 5218662 |
| 279 | 2601704902 | 2600255300 | Bacteria | 5287774 |
| 280 | 2601709931 | 2600255301 | Bacteria | 5280532 |
| 281 | 2601714943 | 2600255302 | Bacteria | 5288235 |
| 282 | 2601720825 | 2600255303 | Bacteria | 5219315 |
| 283 | 2601725349 | 2600255304 | Bacteria | 5283973 |
| 284 | 2601729891 | 2600255305 | Bacteria | 5282329 |
| 285 | 2601734908 | 2600255306 | Bacteria | 5281613 |
| 286 | 2601739593 | 2600255307 | Bacteria | 5439064 |
| 287 | 2601750082 | 2600255309 | Bacteria | 5431045 |
| 288 | 2602017335 | 2600255392 | Bacteria | 5437392 |
| 289 | 2603642111 | 2602042047 | Bacteria | 4697674 |
| 290 | 2603660216 | 2602042052 | Bacteria | 5215873 |
| 291 | 2603665491 | 2602042053 | Bacteria | 5214361 |
| 292 | 2603702723 | 2602042067 | Bacteria | 4863713 |
| 293 | 2603837270 | 2602042103 | Bacteria | 5284714 |
| 294 | 2603842346 | 2602042104 | Bacteria | 5281639 |
| 295 | 2603847419 | 2602042105 | Bacteria | 5282303 |
| 296 | 2603852490 | 2602042106 | Bacteria | 5282744 |
| 297 | 2603867125 | 2602042109 | Bacteria | 5152801 |
| 298 | 2603870544 | 2602042110 | Bacteria | 5283285 |
| 299 | 2603875482 | 2602042111 | Bacteria | 5212080 |
| 300 | 2606047734 | 2603880178 | Bacteria | 5283018 |
| 301 | 2606069922 | 2603880184 | Bacteria | 5217896 |
| 302 | 2606145761 | 2603880202 | Bacteria | 5284684 |
| 303 | 2606175136 | 2603880211 | Bacteria | 5284226 |
| 304 | 2637225659 | 2636415599 | Bacteria | 5718434 |
| 305 | 2656279496 | 2654587920 | Bacteria | 5475511 |
| 306 | 2671101881 | 2667528172 | Bacteria | 5170840 |
| 307 | 2673166666 | 2671180531 | Bacteria | 9045424 |
| 308 | 2676406880 | 2675903046 | Bacteria | 5451247 |
| 309 | 2678261910 | 2675903515 | Bacteria | 6580491 |
| 310 | 2681998498 | 2681812866 | Bacteria | 4552357 |
| 311 | 2682005650 | 2681812869 | Bacteria | 5014465 |
| 312 | 2689445071 | 2687453601 | Bacteria | 5546041 |
| 313 | 2745008258 | 2744054620 | Bacteria | 6551379 |
| 314 | 2753856242 | 2751185917 | Bacteria | 4551186 |
| 315 | 2765589232 | 2765235842 | Bacteria | 4799256 |
| 316 | 2772439050 | 2772190666 | Bacteria | 5117644 |
| 317 | 2775539313 | 2775506706 | Bacteria | 4873073 |
| 318 | 2777023518 | 2775507074 | Bacteria | 5532402 |
| 319 | 2821122714 | 2821118458 | Bacteria | 4714306 |
| 320 | 2823374971 | 2823373977 | Bacteria | 4779415 |
| 321 | 2844427749 | 2844425489 | Bacteria | 4854065 |
| 322 | 2869554491 | 2869551831 | Bacteria | 5474685 |
| 323 | 2885269050 | 2885266251 | Bacteria | 4796748 |
| 324 | 2888369102 | 2888366609 | Bacteria | 5155009 |
| 325 | 2904513479 | 2904513164 | Bacteria | 5476410 |
| 326 | 2923635149 | 2923634449 | Bacteria | 4753480 |
| 327 | 2927833833 | 2927833300 | Bacteria | 4923934 |
| 328 | 2937967667 | 2937967321 | Bacteria | 5094075 |
| 329 | 2939575043 | 2939573065 | Bacteria | 4926053 |
| 330 | 2969082649 | 2969079654 | Bacteria | 5439582 |
| 331 | 2974311870 | 2974310843 | Bacteria | 4947816 |
| 332 | 2984559726 | 2984559226 | Bacteria | 5683096 |
| 333 | 2984597808 | 2984595703 | Bacteria | 5682994 |
| 334 | 8004597305 | 8004592986 | Bacteria | 5122074 |
| 335 | 8011351360 | 8011350971 | Bacteria | 6158957 |
| 336 | 8015395336 | 8015394850 | Bacteria | 5064660 |
| 337 | 8018407556 | 8018405270 | Bacteria | 4978981 |
| 338 | 8055090706 | 8055087960 | Bacteria | 4784273 |
| 339 | 8055096653 | 8055092621 | Bacteria | 4873875 |
| 340 | Ga0316582_0000185 | |||
| 341 | SwRhRL2b_contig_1795684 | |||
| 342 | rootH2_10045982 | |||
| 343 | rootH1_10198924 | |||
| 344 | Ga0058692_1000981 | |||
| 345 | Ga0065704_10000240 | |||
| 346 | Ga0065704_10132798 | |||
| 347 | Ga0070659_100077850 | |||
| 348 | Ga0070665_100000600 | |||
| 349 | Ga0070704_100326052 | |||
| 350 | Ga0070704_101478938 | |||
| 351 | Ga0068856_100239401 | |||
| 352 | Ga0068851_10255740 | |||
| 353 | Ga0081455_10228829 | |||
| 354 | Ga0075364_10006172 | |||
| 355 | Ga0075366_10048347 | |||
| 356 | Ga0075430_100022673 | |||
| 357 | Ga0075431_100113102 | |||
| 358 | Ga0075431_100505467 | |||
| 359 | Ga0079104_1000907 | |||
| 360 | Ga0079104_1001643 | |||
| 361 | Ga0105251_10000002 | |||
| 362 | Ga0105251_10000539 | |||
| 363 | Ga0105251_10000549 | |||
| 364 | Ga0105251_10001544 | |||
| 365 | Ga0105251_10004257 | |||
| 366 | Ga0105251_10108360 | |||
| 367 | Ga0105251_10108520 | |||
| 368 | Ga0105244_10003460 | |||
| 369 | Ga0105250_10000330 | |||
| 370 | Ga0105250_10016516 | |||
| 371 | Ga0105240_10539733 | |||
| 372 | Ga0105247_10000045 | |||
| 373 | Ga0114129_10027409 | |||
| 374 | Ga0105241_10000002 | |||
| 375 | Ga0105248_10181375 | |||
| 376 | Ga0105248_10901747 | |||
| 377 | Ga0105238_10793996 | |||
| 378 | Ga0105239_10418226 | |||
| 379 | Ga0157373_10001547 | |||
| 380 | Ga0157370_10007177 | |||
| 381 | Ga0157372_11463882 | |||
| 382 | Ga0163163_10139414 | |||
| 383 | Ga0182008_10007764 | |||
| 384 | Ga0182006_1164325 | |||
| 385 | Ga0183366_1001 | |||
| 386 | Ga0183370_1001 | |||
| 387 | Ga0183369_1001 | |||
| 388 | Ga0183368_1001 | |||
| 389 | Ga0163161_10000001 | |||
| 390 | Ga0207696_1000001 | |||
| 391 | Ga0207696_1000003 | |||
| 392 | Ga0207696_1000446 | |||
| 393 | Ga0207655_1000064 | |||
| 394 | Ga0207713_1000002 | |||
| 395 | Ga0207713_1000004 | |||
| 396 | Ga0207713_1000008 | |||
| 397 | Ga0207713_1000016 | |||
| 398 | Ga0207713_1000533 | |||
| 399 | Ga0207713_1023132 | |||
| 400 | Ga0207713_1032097 | |||
| 401 | Ga0207713_1034477 | |||
| 402 | Ga0207710_10000780 | |||
| 403 | Ga0207654_10000005 | |||
| 404 | Ga0207695_10423523 | |||
| 405 | Ga0207690_10369269 | |||
| 406 | Ga0207711_10210346 | |||
| 407 | Ga0209281_1000003 | |||
| 408 | Ga0209281_1001032 | |||
| 409 | Ga0209371_1000001 | |||
| 410 | Ga0209371_1000301 | |||
| 411 | Ga0209371_1001883 | |||
| 412 | Ga0209371_1006269 | |||
| 413 | Ga0209371_1034932 | |||
| 414 | Ga0268266_10000762 | |||
| 415 | Ga0268256_1000001 | |||
| 416 | Ga0268256_1000266 | |||
| 417 | Ga0268256_1001620 | |||
| 418 | Ga0268256_1004974 | |||
| 419 | Ga0268256_1047952 | |||
| 420 | Ga0265325_10000929 | |||
| 421 | Ga0265316_10012559 | |||
| 422 | Ga0265316_10028289 | |||
| 423 | Ga0307408_100308582 | |||
| 424 | Ga0316575_10002981 | |||
| 425 | Ga0316575_10154997 | |||
| 426 | Ga0316579_10003530 | |||
| 427 | Ga0316579_10016216 | |||
| 428 | Ga0316579_10028775 | |||
| 429 | Ga0316579_10032165 | |||
| 430 | Ga0316579_10046542 | |||
| 431 | Ga0316579_10101034 | |||
| 432 | Ga0316576_10028189 | |||
| 433 | Ga0316576_10043208 | |||
| 434 | Ga0316576_10054909 | |||
| 435 | Ga0316576_10137095 | |||
| 436 | Ga0316576_10173452 | |||
| 437 | Ga0316576_10345973 | |||
| 438 | Ga0316578_10000782 | |||
| 439 | Ga0316578_10110452 | |||
| 440 | Ga0316578_10306299 | |||
| 441 | Ga0316578_10363968 | |||
| 442 | Ga0316577_10008192 | |||
| 443 | Ga0316577_10010850 | |||
| 444 | Ga0316577_10021227 | |||
| 445 | Ga0316577_10040196 | |||
| 446 | Ga0316577_10043995 | |||
| 447 | Ga0316577_10089628 | |||
| 448 | Ga0316577_10118314 | |||
| 449 | Ga0316577_10153745 | |||
| 450 | Ga0316577_10323171 | |||
| 451 | Ga0316583_10004616 | |||
| 452 | Ga0316583_10017586 | |||
| 453 | Ga0316583_10031337 | |||
| 454 | Ga0316583_10142365 | |||
| 455 | Ga0316585_10036216 | |||
| 456 | Ga0316585_10040219 | |||
| 457 | Ga0316585_10064615 | |||
| 458 | Ga0316580_10006681 | |||
| 459 | Ga0316580_10081016 | |||
| 460 | Ga0316580_10158810 | |||
| 461 | Ga0316593_10030591 | |||
| 462 | Ga0316593_10114883 | |||
| 463 | Ga0316593_10190893 | |||
| 464 | Ga0316592_1025859 | |||
| 465 | Ga0316586_1028113 | |||
| 466 | Ga0316596_1036172 | |||
| 467 | Ga0316596_1053267 | |||
| 468 | Ga0316596_1134073 | |||
| 469 | Ga0316574_0003902 | |||
| 470 | Ga0316574_0081649 | |||
| 471 | Ga0316574_0302217 | |||
| 472 | Ga0373937_0178125 | |||
| 473 | Ga0373937_0217516 | |||
| 474 | Ga0316582_0000113 | |||
| 475 | Ga0316582_0088384 | |||
| 476 | Ga0316582_0116341 | |||
| 477 | Ga0316582_0223736 | |||
| 478 | Ga0316582_0235562 | |||
| 479 | Ga0316582_0241485 | |||
| 480 | Ga0316582_0271164 | |||
| 481 | Ga0316582_0279900 | |||
| 482 | Ga0316584_0002135 | |||
| 483 | Ga0316584_0002655 | |||
| 484 | Ga0316584_0009270 | |||
| 485 | Ga0316584_0012858 | |||
| 486 | Ga0316584_0015352 | |||
| 487 | Ga0316584_0016776 | |||
| 488 | Ga0316584_0188021 | |||
| 489 | Ga0316584_0255428 | |||
| 490 | Ga0316581_0021866 | |||
| 491 | Ga0316581_0058154 | |||
| 492 | Ga0316581_0084519 | |||
| 493 | Ga0436364_1305061 | |||
| 494 | Ga0395901_0151560 | |||
| 495 | Ga0400484_43724 | |||
| 496 | Ga0400486_01879 | |||
| 497 | Ga0400489_32209 | |||
| 498 | Ga0400487_28351 | |||
| 499 | Ga0439466_0048371 | |||
| 500 | Ga0451795_0917145 | |||
| 501 | Ga0439432_014825 | |||
| 502 | Ga0439452_000062 | |||
| 503 | Ga0451577_0000271 | |||
| 504 | Ga0451577_1200811 | |||
| 505 | Ga0466981_0000007 | |||
| 506 | Ga0453684_0000005 | |||
| 507 | Ga0453684_0444555 | |||
| 508 | Ga0451576_0015235 | |||
| 509 | Ga0451576_0735103 | |||
| 510 | Ga0451576_1524820 | |||
| 511 | Ga0495627_000020 | |||
| 512 | Ga0495653_0238340 | |||
| 513 | Ga0495650_0000005 | |||
| 514 | Ga0495608_0025733 | |||
| 515 | Ga0495652_0415351 | |||
| 516 | Ga0495609_0092677 | |||
| 517 | Ga0495667_0000069 | |||
| 518 | Ga0495667_0152985 | |||
| 519 | Ga0495635_0063369 | |||
| 520 | Ga0495613_0086475 | |||
| 521 | Ga0495671_0171926 | |||
| 522 | Ga0495600_0350299 | |||
| 523 | Ga0495684_0002646 | |||
| 524 | Ga0496104_0000344 | |||
| 525 | Ga0496104_0224265 | |||
| 526 | Ga0496105_0005468 | |||
| 527 | Ga0496105_0210930 | |||
| 528 | Ga0496116_0000001 | |||
| 529 | Ga0496116_0000204 | |||
| 530 | Ga0496116_0023838 | |||
| 531 | Ga0496117_0000421 | |||
| 532 | Ga0496117_0001549 | |||
| 533 | Ga0496117_0007778 | |||
| 534 | Ga0496117_0009216 | |||
| 535 | Ga0496117_0062038 | |||
| 536 | Ga0496117_0377498 | |||
| 537 | Ga0496118_0000527 | |||
| 538 | Ga0496118_0001793 | |||
| 539 | Ga0496118_0017893 | |||
| 540 | Ga0496118_0047258 | |||
| 541 | Ga0496118_0078847 | |||
| 542 | Ga0496119_0000824 | |||
| 543 | Ga0496119_0000909 | |||
| 544 | Ga0496119_0002200 | |||
| 545 | Ga0496119_0010676 | |||
| 546 | Ga0496119_0019841 | |||
| 547 | Ga0496119_0036648 | |||
| 548 | Ga0496119_0111270 | |||
| 549 | Ga0496119_0212167 | |||
| 550 | Ga0496120_0000096 | |||
| 551 | Ga0496120_0000159 | |||
| 552 | Ga0496120_0000233 | |||
| 553 | Ga0496120_0001151 | |||
| 554 | Ga0496120_0003117 | |||
| 555 | Ga0496121_0001075 | |||
| 556 | Ga0496121_0001447 | |||
| 557 | Ga0496121_0003562 | |||
| 558 | Ga0496121_0006060 | |||
| 559 | Ga0496121_0020298 | |||
| 560 | Ga0496122_0001110 | |||
| 561 | Ga0496122_0007319 | |||
| 562 | Ga0496122_0185595 | |||
| 563 | Ga0496123_0000940 | |||
| 564 | Ga0496123_0003650 | |||
| 565 | Ga0496123_0004258 | |||
| 566 | Ga0496123_0031279 | |||
| 567 | Ga0496123_0079570 | |||
| 568 | Ga0496123_0189431 | |||
| 569 | Ga0496123_0193049 | |||
| 570 | Ga0496124_0000008 | |||
| 571 | Ga0496124_0002250 | |||
| 572 | Ga0496124_0025430 | |||
| 573 | Ga0496124_0101798 | |||
| 574 | Ga0496125_0000122 | |||
| 575 | Ga0496125_0000931 | |||
| 576 | Ga0496125_0013668 | |||
| 577 | Ga0496125_0013995 | |||
| 578 | Ga0496125_0028005 | |||
| 579 | Ga0496125_0061106 | |||
| 580 | Ga0496125_0150219 | |||
| 581 | Ga0496126_0000472 | |||
| 582 | Ga0496126_0016761 | |||
| 583 | Ga0496126_0045566 | |||
| 584 | Ga0496126_0193667 | |||
| 585 | Ga0496126_0512915 | |||
| 586 | Ga0501032_0025640 | |||
| 587 | Ga0501034_0116344 | |||
| 588 | Ga0501034_0258584 | |||
| 589 | Ga0501034_0260152 | |||
| 590 | Ga0501034_0388303 | |||
| 591 | Ga0501036_0103802 | |||
| 592 | Ga0501036_0388220 | |||
| 593 | Ga0501037_0137078 | |||
| 594 | Ga0501038_0164712 | |||
| 595 | Ga0501039_0456492 | |||
| 596 | Ga0501035_0265287 | |||
| 597 | nmdc:mga0k408_11129_c1 | |||
| 598 | nmdc:mga05p37_8493_c1 | |||
| 599 | nmdc:mga0qj67_173457_c1 | |||
| 600 | nmdc:mga06r32_111168_c1 | |||
| 601 | nmdc:mga06r32_496394_c1 | |||
| 602 | 2506578524 | |||
| 603 | 2506583663 | |||
| 604 | 2526212177 | |||
| 605 | 2548649092 | |||
| 606 | 2599409731 | |||
| 607 | 2601521775 | |||
| 608 | 2601526800 | |||
| 609 | 2601613630 | |||
| 610 | 2601618353 | |||
| 611 | 2601643020 | |||
| 612 | 2601647890 | |||
| 613 | 2601651778 | |||
| 614 | 2601657105 | |||
| 615 | 2601662841 | |||
| 616 | 2601695800 | |||
| 617 | 2601700474 | |||
| 618 | 2601704902 | |||
| 619 | 2601709931 | |||
| 620 | 2601714943 | |||
| 621 | 2601720825 | |||
| 622 | 2601725349 | |||
| 623 | 2601729891 | |||
| 624 | 2601734908 | |||
| 625 | 2601739593 | |||
| 626 | 2601750082 | |||
| 627 | 2602017335 | |||
| 628 | 2603642111 | |||
| 629 | 2603660216 | |||
| 630 | 2603665491 | |||
| 631 | 2603702723 | |||
| 632 | 2603837270 | |||
| 633 | 2603842346 | |||
| 634 | 2603847419 | |||
| 635 | 2603852490 | |||
| 636 | 2603867125 | |||
| 637 | 2603870544 | |||
| 638 | 2603875482 | |||
| 639 | 2606047734 | |||
| 640 | 2606069922 | |||
| 641 | 2606145761 | |||
| 642 | 2606175136 | |||
| 643 | 2637225659 | |||
| 644 | 2656279496 | |||
| 645 | 2671101881 | |||
| 646 | 2673166666 | |||
| 647 | 2676406880 | |||
| 648 | 2678261910 | |||
| 649 | 2681998498 | |||
| 650 | 2682005650 | |||
| 651 | 2689445071 | |||
| 652 | 2745008258 | |||
| 653 | 2753856242 | |||
| 654 | 2765589232 | |||
| 655 | 2772439050 | |||
| 656 | 2775539313 | |||
| 657 | 2777023518 | |||
| 658 | 2821122714 | |||
| 659 | 2823374971 | |||
| 660 | 2844427749 | |||
| 661 | 2869554491 | |||
| 662 | 2885269050 | |||
| 663 | 2888369102 | |||
| 664 | 2904513479 | |||
| 665 | 2923635149 | |||
| 666 | 2927833833 | |||
| 667 | 2937967667 | |||
| 668 | 2939575043 | |||
| 669 | 2969082649 | |||
| 670 | 2974311870 | |||
| 671 | 2984559726 | |||
| 672 | 2984597808 | |||
| 673 | 8004597305 | |||
| 674 | 8011351360 | |||
| 675 | 8015395336 | |||
| 676 | 8018407556 | |||
| 677 | 8055090706 | |||
| 678 | 8055096653 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4ofw-assembly2.cif.gz_F | crystal structure of arabidopsis thaliana dj-1d | 0.9797 | 3 | 187 |
| 3uk7-assembly1.cif.gz_C | crystal structure of arabidopsis thaliana dj-1d | 0.977 | 3 | 187 |
| 4ogg-assembly1.cif.gz_A | crystal structure of arabidopsis thaliana dj-1d with glyoxylate as substrate analog | 0.9728 | 3 | 187 |
| 4ofw-assembly2.cif.gz_F | crystal structure of arabidopsis thaliana dj-1d | 0.9593 | 3 | 187 |
| 3uk7-assembly1.cif.gz_C | crystal structure of arabidopsis thaliana dj-1d | 0.9566 | 3 | 187 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_K7LRD9_234_303_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9857 | 131 | 187 | 3.40.50.720 |
| af_Q869N4_1_194_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9777 | 2 | 187 | 3.40.50.880 |
| af_K7LRD9_139_233_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9751 | 3 | 104 | 3.40.50.880 |
| 4oggA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9691 | 4 | 187 | 3.40.50.880 |
| af_Q869N4_1_194_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9624 | 2 | 187 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7U3R3L3-F1-model_v4 | deleted | 1.005 | 102 | 188 |
|
| AF-A0A645I3M4-F1-model_v4 | DJ-1/PfpI domain-containing protein | 1.005 | 114 | 187 |
|
| AF-A0A1C7Z0C6-F1-model_v4 | Glutamine amidotransferase | 1.004 | 102 | 187 |
GO:0016740
|
| AF-A0A352IP49-F1-model_v4 | Protease | 1.004 | 96 | 181 |
GO:0006508
GO:0008233 |
| AF-A0A2S8K2R1-F1-model_v4 | deleted | 1.003 | 89 | 181 |
|