F414009

General Info

Members Datasets Scaffolds Average Seq Length
339 284 678 164

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1091110|Ga0436364_1091110_769_1353
Length 194
Sequence VPAVLAEHHELDNFNCGETSLAQRARMRAEMQEGNSTVFGSGRLTPRPSCAACLLDEWLKKRARPNQAGGASRVFVICERNRVVGYYALSSFCVTPAIVPGRFRRNMPDPIPVVLLGRLAIDKAWQHQGIGRALFRDAAIRVSHAADAIGVRGIVVHAISDEARKFYLALGFTECPGQPMTLVVTLQDIRAVLG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
13 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
17 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
18 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
19 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
20 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
21 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
74 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
75 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
93 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
96 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
97 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
100 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
141 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
158 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
161 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
162 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
163 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
164 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
165 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
171 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
172 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
180 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
181 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
182 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
189 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
190 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
218 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
219 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
220 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
221 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
225 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
226 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
227 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
228 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
229 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
230 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
231 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
232 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
233 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
234 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
235 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
236 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
237 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
238 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
239 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
240 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
241 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
242 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
243 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
244 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
245 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
246 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
247 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
248 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
249 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
250 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
251 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
252 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
253 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
254 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
255 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
256 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
257 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
258 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
259 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
260 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
261 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
262 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
263 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
264 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
265 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
266 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
267 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
268 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
269 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
270 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
271 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
272 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
273 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
274 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
275 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
276 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
277 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
278 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
279 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
280 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
281 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
282 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
283 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
284 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 80.24
Metatranscriptomes 1.77
Isolates 17.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.39
Nodule 16.22
Rhizoplane 4.72
Rhizosphere 56.34
Stem 0
Stem Tuber 0
Unclassified 12.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1091110 3300037853 Unclassified 1559
2 JGI24740J21852_10018599 3300001979 Bacteria 2459
3 JGI24739J22299_10002458 3300001989 Bacteria 7147
4 JGI24737J22298_10001987 3300001990 Bacteria 7307
5 JGI24735J21928_10069401 3300002067 Bacteria 1010
6 JGI24735J21928_10069403 3300002067 Bacteria 1010
7 JGI24034J26672_10046494 3300002239 Unclassified 738
8 JGI25152J39213_1013652 3300002773 Bacteria 1681
9 JGI25150J39212_1005543 3300002774 Bacteria 2685
10 JGI25151J46595_10000130 3300003187 Bacteria 101649
11 JGI25165J46597_1000039 3300003214 Bacteria 281327
12 JGI25153J46596_10015871 3300003215 Bacteria 3045
13 JGI25153J46596_10018260 3300003215 Bacteria 2732
14 JGI25153J46596_10082257 3300003215 Bacteria 799
15 rootH1_10033302 3300003316 Bacteria 27746
16 rootH2_10013469 3300003320 Bacteria 8430
17 rootH2_10107616 3300003320 Plasmid 4551
18 rootH1_10100632 3300003323 Bacteria 3670
19 JGI25160J50197_1008998 3300003354 Bacteria 3746
20 Ga0006562J51391_1078520 3300003578 Bacteria 11930
21 Ga0006562J51391_1078522 3300003578 Bacteria 6490
22 Ga0055533_1009961 3300003756 Bacteria 1102
23 Ga0055527_1000342 3300003760 Bacteria 23483
24 Ga0055535_1000776 3300003761 Bacteria 23483
25 Ga0055542_1000790 3300003762 Bacteria 23483
26 Ga0055529_1000173 3300003763 Bacteria 88663
27 Ga0055526_1005356 3300003771 Bacteria 7405
28 Ga0065165_1001770 3300005262 Bacteria 21418
29 Ga0070658_10176833 3300005327 Bacteria 1795
30 Ga0070676_10641776 3300005328 Unclassified 770
31 Ga0070690_101167953 3300005330 Bacteria 613
32 Ga0068868_100254069 3300005338 Unclassified 1480
33 Ga0070689_100291668 3300005340 Unclassified 1356
34 Ga0070687_100302956 3300005343 Bacteria 1015
35 Ga0070668_100890472 3300005347 Unclassified 795
36 Ga0070675_101287059 3300005354 Unclassified 674
37 Ga0070671_101032815 3300005355 Bacteria 721
38 Ga0070674_100189914 3300005356 Unclassified 1580
39 Ga0070688_100232168 3300005365 Bacteria 1306
40 Ga0070667_100004860 3300005367 Bacteria 11260
41 Ga0070667_100667207 3300005367 Bacteria 961
42 Ga0070701_10141347 3300005438 Bacteria 1377
43 Ga0070700_100069844 3300005441 Bacteria 2238
44 Ga0070663_100138261 3300005455 Bacteria 1857
45 Ga0070662_100146290 3300005457 Bacteria 1836
46 Ga0070662_100327093 3300005457 Bacteria 1251
47 Ga0068867_100546569 3300005459 Bacteria 1003
48 Ga0070685_10191310 3300005466 Bacteria 1324
49 Ga0070706_100687249 3300005467 Unclassified 949
50 Ga0070672_100307561 3300005543 Bacteria 1345
51 Ga0070686_100266939 3300005544 Bacteria 1257
52 Ga0070665_100406377 3300005548 Unclassified 1370
53 Ga0070704_100478395 3300005549 Bacteria 1077
54 Ga0068855_100349562 3300005563 Bacteria 1629
55 Ga0070664_100083128 3300005564 Bacteria 2762
56 Ga0068857_100000812 3300005577 Bacteria 23356
57 Ga0068854_100025792 3300005578 Bacteria 4034
58 Ga0068854_100175716 3300005578 Bacteria 1669
59 Ga0068854_100530018 3300005578 Unclassified 996
60 Ga0070702_100246441 3300005615 Bacteria 1209
61 Ga0068859_100752899 3300005617 Unclassified 1063
62 Ga0068864_100001759 3300005618 Bacteria 17827
63 Ga0068861_100370181 3300005719 Bacteria 1263
64 Ga0068851_10164643 3300005834 Bacteria 1220
65 Ga0068863_100425969 3300005841 Bacteria 1300
66 Ga0068858_100998670 3300005842 Unclassified 820
67 Ga0068860_100007037 3300005843 Bacteria 11263
68 Ga0068862_100170071 3300005844 Bacteria 1951
69 Ga0081455_10020606 3300005937 Bacteria 6202
70 Ga0081455_10050873 3300005937 Bacteria 3558
71 Ga0068871_100912990 3300006358 Unclassified 814
72 Ga0068865_100169868 3300006881 Bacteria 1671
73 Ga0097620_100752852 3300006931 Unclassified 1063
74 Ga0099795_10068320 3300007788 Bacteria 1335
75 Ga0105240_10002832 3300009093 Bacteria 27427
76 Ga0105240_10004332 3300009093 Bacteria 21665
77 Ga0105240_10053536 3300009093 Bacteria 5065
78 Ga0105240_10197783 3300009093 Bacteria 2358
79 Ga0105245_10690205 3300009098 Bacteria 1053
80 Ga0105243_10244181 3300009148 Unclassified 1600
81 Ga0105242_10188359 3300009176 Bacteria 1825
82 Ga0105242_10459322 3300009176 Unclassified 1202
83 Ga0105248_10075182 3300009177 Plasmid 3797
84 Ga0105237_10000026 3300009545 Bacteria 212619
85 Ga0105237_10009530 3300009545 Bacteria 10400
86 Ga0105237_10096463 3300009545 Bacteria 2947
87 Ga0105238_10092597 3300009551 Bacteria 3011
88 Ga0105238_10203720 3300009551 Bacteria 1954
89 Ga0105249_10218981 3300009553 Bacteria 1872
90 Ga0123340_1004570 3300009763 Bacteria 13132
91 Ga0123341_1013020 3300009765 Bacteria 7511
92 Ga0099796_10108111 3300010159 Unclassified 1055
93 Ga0105239_10122866 3300010375 Bacteria 2885
94 Ga0105239_10344004 3300010375 Unclassified 1683
95 Ga0105239_10612839 3300010375 Bacteria 1242
96 Ga0157369_10073415 3300013105 Bacteria 3670
97 Ga0157369_10425281 3300013105 Bacteria 1377
98 Ga0157374_10416063 3300013296 Bacteria 1342
99 Ga0157378_10350645 3300013297 Bacteria 1442
100 Ga0157378_11780844 3300013297 Bacteria 664
101 Ga0163162_10377838 3300013306 Unclassified 1550
102 Ga0157380_10128061 3300014326 Bacteria 2161
103 Ga0182008_10010042 3300014497 Bacteria 5083
104 Ga0182007_10040670 3300015262 Bacteria 1552
105 Ga0163161_10154522 3300017792 Bacteria 1746
106 Ga0163161_10212666 3300017792 Bacteria 1494
107 Ga0206353_11732485 3300020082 Bacteria 736
108 Ga0213874_10023947 3300021377 Bacteria 1707
109 Ga0213874_10084941 3300021377 Bacteria 1031
110 Ga0213876_10166868 3300021384 Bacteria 1171
111 Ga0213875_10004939 3300021388 Bacteria 7236
112 Ga0209672_100029 3300025228 Bacteria 339298
113 Ga0209437_109165 3300025233 Bacteria 1555
114 Ga0209258_100053 3300025242 Bacteria 339233
115 Ga0207425_1002252 3300025245 Bacteria 6980
116 Ga0209677_107874 3300025253 Bacteria 2167
117 Ga0209148_1000009 3300025254 Bacteria 1395625
118 Ga0209129_1000175 3300025258 Bacteria 93817
119 Ga0209129_1001603 3300025258 Bacteria 12330
120 Ga0209233_1000052 3300025261 Bacteria 445813
121 Ga0209455_1000060 3300025272 Bacteria 339298
122 Ga0209673_1013181 3300025273 Bacteria 3281
123 Ga0209025_1000152 3300025294 Bacteria 171558
124 Ga0209564_1000136 3300025295 Bacteria 185198
125 Ga0209758_1000266 3300025297 Bacteria 104007
126 Ga0209758_1000275 3300025297 Bacteria 102404
127 Ga0209758_1003182 3300025297 Bacteria 15352
128 Ga0209758_1020163 3300025297 Bacteria 3170
129 Ga0209256_1018782 3300025299 Bacteria 2229
130 Ga0207426_1000333 3300025302 Bacteria 88786
131 Ga0209051_1001155 3300025303 Bacteria 23995
132 Ga0209257_1025958 3300025304 Bacteria 1988
133 Ga0207656_10010421 3300025321 Bacteria 3482
134 Ga0207647_10011002 3300025904 Bacteria 6365
135 Ga0207645_10287101 3300025907 Bacteria 1093
136 Ga0207705_10266559 3300025909 Bacteria 1309
137 Ga0207695_10001108 3300025913 Bacteria 46826
138 Ga0207695_10001359 3300025913 Bacteria 41519
139 Ga0207695_10013120 3300025913 Bacteria 9890
140 Ga0207695_10321345 3300025913 Bacteria 1437
141 Ga0207671_10000041 3300025914 Bacteria 216095
142 Ga0207671_10000508 3300025914 Bacteria 52782
143 Ga0207646_11256157 3300025922 Bacteria 648
144 Ga0207659_10436571 3300025926 Bacteria 1101
145 Ga0207687_10094693 3300025927 Bacteria 2186
146 Ga0207644_10937516 3300025931 Bacteria 726
147 Ga0207690_10720784 3300025932 Bacteria 821
148 Ga0207706_10240963 3300025933 Bacteria 1581
149 Ga0207706_10430014 3300025933 Bacteria 1143
150 Ga0207686_10251958 3300025934 Bacteria 1290
151 Ga0207670_10713284 3300025936 Bacteria 831
152 Ga0207669_10537218 3300025937 Unclassified 941
153 Ga0207704_10196439 3300025938 Unclassified 1472
154 Ga0207691_10007617 3300025940 Bacteria 10417
155 Ga0207691_10405978 3300025940 Bacteria 1162
156 Ga0207711_10037231 3300025941 Plasmid 4131
157 Ga0207679_10073935 3300025945 Bacteria 2581
158 Ga0207667_10000157 3300025949 Bacteria 101449
159 Ga0207667_10299318 3300025949 Bacteria 1643
160 Ga0207667_10397337 3300025949 Bacteria 1404
161 Ga0207640_10002073 3300025981 Bacteria 10805
162 Ga0207640_10024331 3300025981 Bacteria 3652
163 Ga0207640_11466982 3300025981 Unclassified 612
164 Ga0207658_10003412 3300025986 Bacteria 11249
165 Ga0207677_10200527 3300026023 Bacteria 1586
166 Ga0207703_10200014 3300026035 Bacteria 1775
167 Ga0207703_11222420 3300026035 Unclassified 722
168 Ga0207678_10259339 3300026067 Bacteria 1490
169 Ga0207648_10317352 3300026089 Bacteria 1400
170 Ga0207676_10004719 3300026095 Bacteria 9657
171 Ga0207674_10001266 3300026116 Bacteria 33027
172 Ga0207675_100203946 3300026118 Unclassified 1900
173 Ga0207675_100368739 3300026118 Bacteria 1410
174 Ga0207683_10509689 3300026121 Unclassified 1111
175 Ga0207698_11387539 3300026142 Bacteria 718
176 Ga0209371_1018916 3300027312 Bacteria 1735
177 Ga0268266_10209841 3300028379 Bacteria 1786
178 Ga0268264_10004890 3300028381 Bacteria 11356
179 Ga0265324_10001634 3300029957 Bacteria 12406
180 Ga0268256_1005757 3300030500 Bacteria 4773
181 Ga0265331_10000497 3300031250 Bacteria 37153
182 Ga0265331_10002470 3300031250 Bacteria 12493
183 Ga0265327_10010966 3300031251 Bacteria 6304
184 Ga0265316_10005830 3300031344 Bacteria 11879
185 Ga0265316_10409354 3300031344 Unclassified 976
186 Ga0307513_10171850 3300031456 Bacteria 2044
187 Ga0307509_10196274 3300031507 Bacteria 1862
188 Ga0307508_10043532 3300031616 Bacteria 4022
189 Ga0307508_10147157 3300031616 Bacteria 1960
190 Ga0373926_0122340 3300035083 Bacteria 982
191 Ga0373943_0235327 3300035170 Unclassified 1025
192 Ga0373942_0056171 3300035207 Bacteria 1117
193 Ga0373931_0099424 3300035691 Bacteria 1634
194 Ga0373937_0525119 3300036401 Unclassified 1125
195 Ga0373925_0830420 3300037068 Bacteria 762
196 Ga0395905_0105930 3300037471 Bacteria 2640
197 Ga0436364_0100806 3300037853 Unclassified 739
198 Ga0436364_0236381 3300037853 Bacteria 1255
199 Ga0436364_0262582 3300037853 Bacteria 77527
200 Ga0395901_0000009 3300038443 Bacteria 479396
201 Ga0436365_0394606 3300039437 Unclassified 1622
202 Ga0436365_1380864 3300039437 Bacteria 6099
203 Ga0436360_1256854 3300039438 Bacteria 1177
204 Ga0436363_0249933 3300039450 Bacteria 3502
205 Ga0436363_0473685 3300039450 Unclassified 507
206 Ga0436363_1269101 3300039450 Bacteria 3824
207 Ga0451791_1539406 3300041451 Unclassified 704
208 Ga0451843_0049858 3300041509 Bacteria 10821
209 Ga0451855_0469297 3300041511 Bacteria 1386
210 Ga0452271_48974 3300041916 Bacteria 911
211 Ga0439448_0012283 3300042005 Bacteria 2561
212 Ga0450907_054742 3300042146 Bacteria 687
213 Ga0466966_0084861 3300044684 Unclassified 1969
214 Ga0466961_0002952 3300044693 Bacteria 10562
215 Ga0466967_0287223 3300045976 Bacteria 1579
216 Ga0495580_0683156 3300046472 Unclassified 673
217 Ga0495585_0260865 3300046492 Bacteria 862
218 Ga0495606_0038068 3300046507 Bacteria 3257
219 Ga0495610_0041741 3300046512 Bacteria 2300
220 Ga0495616_0116041 3300046513 Bacteria 1240
221 Ga0495630_0286421 3300046517 Unclassified 1259
222 Ga0495632_0113554 3300046519 Bacteria 1270
223 Ga0495643_0026674 3300046522 Bacteria 3256
224 Ga0495643_0029994 3300046522 Bacteria 3040
225 Ga0495652_0025078 3300046529 Bacteria 5277
226 Ga0495665_0144008 3300046531 Bacteria 1245
227 Ga0495587_0054096 3300046536 Unclassified 2366
228 Ga0495621_0299942 3300046539 Bacteria 666
229 Ga0495645_0438342 3300046543 Unclassified 826
230 Ga0495656_0156025 3300046615 Bacteria 1106
231 Ga0495668_0072624 3300046616 Bacteria 1890
232 Ga0495625_0006602 3300046660 Bacteria 10300
233 Ga0495635_0455831 3300046663 Unclassified 845
234 Ga0495588_0217056 3300046674 Bacteria 1010
235 Ga0495599_0041026 3300046678 Bacteria 2906
236 Ga0495623_0511400 3300046679 Bacteria 633
237 Ga0495669_0034808 3300046684 Bacteria 2221
238 Ga0495600_0305095 3300046809 Unclassified 1004
239 Ga0495660_0189403 3300046810 Bacteria 989
240 Ga0495636_0534456 3300047318 Bacteria 569
241 Ga0495683_0095322 3300047323 Bacteria 1437
242 Ga0496100_0319693 3300048903 Bacteria 1166
243 Ga0496101_0169899 3300048904 Bacteria 1676
244 Ga0496102_0459330 3300048905 Bacteria 1194
245 Ga0496103_0259651 3300048906 Unclassified 1118
246 Ga0496105_0281887 3300048908 Bacteria 1340
247 Ga0496106_0415455 3300048909 Bacteria 1081
248 Ga0496107_0453791 3300048910 Bacteria 952
249 Ga0496111_0478870 3300048914 Bacteria 917
250 Ga0496112_0047069 3300048915 Bacteria 4231
251 Ga0496112_0162679 3300048915 Bacteria 2198
252 Ga0496113_0578921 3300048916 Bacteria 899
253 Ga0496114_0128471 3300048917 Bacteria 2187
254 Ga0496114_0627303 3300048917 Bacteria 947
255 Ga0496115_0358292 3300048918 Bacteria 1189
256 Ga0496115_0800149 3300048918 Bacteria 734
257 Ga0496116_0077382 3300048919 Bacteria 2079
258 Ga0496121_0007806 3300048924 Bacteria 12812
259 Ga0496124_0017942 3300048927 Bacteria 6651
260 Ga0496125_0000198 3300048928 Bacteria 127026
261 Ga0496126_0216112 3300048929 Bacteria 1612
262 Ga0501033_0101069 3300049570 Unclassified 2104
263 Ga0501047_0270572 3300049581 Bacteria 1545
264 Ga0501070_0493758 3300049586 Bacteria 984
265 Ga0501080_0181621 3300049742 Bacteria 1935
266 Ga0501080_1488254 3300049742 Unclassified 576
267 Ga0501044_0275921 3300049823 Bacteria 1616
268 Ga0501044_0965449 3300049823 Bacteria 725
269 nmdc:mga0yw44_78680_c1 3300050492 Bacteria 2062
270 Ga0495601_0544731 3300053077 Bacteria 747
271 Ga0500569_001582 3300053109 Bacteria 4321
272 Ga0500658_0044801 3300053134 Bacteria 1786
273 Ga0500559_0107275 3300053136 Bacteria 1292
274 Ga0500559_0122451 3300053136 Bacteria 1210
275 Ga0500616_0104387 3300053153 Bacteria 1379
276 Ga0587072_031847 3300059643 Bacteria 988
277 Ga0587107_070586 3300059652 Bacteria 637
278 Ga0501082_0659252 3300060353 Unclassified 916
279 2501413863 2501025504 Bacteria 8008976
280 2509368199 2509276018 Bacteria 6910194
281 2510315863 2510065059 Bacteria 6847884
282 2511094870 2510917014 Bacteria 8296963
283 2512033634 2511231221 Bacteria 6846400
284 2517099753 2517093000 Bacteria 7412387
285 2574430629 2574179768 Bacteria 4907129
286 2585281653 2582581308 Bacteria 7413247
287 2585397337 2582581866 Bacteria 6859583
288 2585525052 2585427526 Bacteria 7258840
289 2616309572 2615840626 Bacteria 7921970
290 2688598077 2687453392 Bacteria 6880454
291 2856333789 2856328259 Bacteria 6528202
292 2856334994 2856334872 Bacteria 7037011
293 2869253121 2869249662 Bacteria 6868783
294 2869265843 2869264136 Bacteria 6880765
295 2869272054 2869271264 Bacteria 6908218
296 2871460979 2871459585 Bacteria 6866887
297 2874138584 2874131515 Bacteria 6820270
298 2874165171 2874162495 Bacteria 6174670
299 2876404888 2876399893 Bacteria 6927900
300 2876413729 2876406927 Bacteria 6191900
301 2878775300 2878774303 Bacteria 6108671
302 2878786091 2878781027 Bacteria 6834456
303 2885338011 2885334103 Bacteria 7216818
304 2906364615 2906363423 Bacteria 6856682
305 2906377232 2906370794 Bacteria 6881062
306 2906387618 2906386501 Bacteria 5977019
307 2906398842 2906393657 Bacteria 6790866
308 2906413564 2906408224 Bacteria 6162342
309 2922158259 2922151315 Bacteria 6902399
310 2922176739 2922172374 Bacteria 6167644
311 2922183596 2922178524 Bacteria 6025201
312 2924752289 2924748358 Bacteria 6154725
313 2937872865 2937868953 Bacteria 6639878
314 2958127475 2958122699 Bacteria 7280457
315 2958139427 2958137437 Bacteria 6050276
316 2958158109 2958158011 Bacteria 6058449
317 2961143086 2961136820 Bacteria 6775228
318 2965026082 2965025482 Bacteria 6532201
319 2965037588 2965032056 Bacteria 6887443
320 2965047544 2965040258 Bacteria 6855979
321 2965052670 2965047637 Bacteria 6623551
322 2965091924 2965089291 Bacteria 6866420
323 2965104130 2965102966 Bacteria 6800987
324 2965117703 2965110997 Bacteria 6693150
325 2970551776 2970547951 Bacteria 6931819
326 2977877814 2977872689 Bacteria 7270173
327 2977915695 2977915119 Bacteria 6829656
328 2977936666 2977935797 Bacteria 6252826
329 2977951294 2977950692 Bacteria 6893264
330 2977958636 2977957713 Bacteria 6877875
331 2979794688 2979793036 Bacteria 6808957
332 2987646714 2987645492 Bacteria 6117018
333 2987674871 2987673487 Bacteria 6884027
334 3004200426 3004195979 Bacteria 6776956
335 3004242453 3004239961 Bacteria 6892290
336 649872611 649633066 Bacteria 6690028
337 8004306894 8004300914 Bacteria 6132239
338 8004369319 8004361976 Bacteria 6858373
339 8004696221 8004695233 Bacteria 6731676
340 Ga0436364_1091110
341 JGI24740J21852_10018599
342 JGI24739J22299_10002458
343 JGI24737J22298_10001987
344 JGI24735J21928_10069401
345 JGI24735J21928_10069403
346 JGI24034J26672_10046494
347 JGI25152J39213_1013652
348 JGI25150J39212_1005543
349 JGI25151J46595_10000130
350 JGI25165J46597_1000039
351 JGI25153J46596_10015871
352 JGI25153J46596_10018260
353 JGI25153J46596_10082257
354 rootH1_10033302
355 rootH2_10013469
356 rootH2_10107616
357 rootH1_10100632
358 JGI25160J50197_1008998
359 Ga0006562J51391_1078520
360 Ga0006562J51391_1078522
361 Ga0055533_1009961
362 Ga0055527_1000342
363 Ga0055535_1000776
364 Ga0055542_1000790
365 Ga0055529_1000173
366 Ga0055526_1005356
367 Ga0065165_1001770
368 Ga0070658_10176833
369 Ga0070676_10641776
370 Ga0070690_101167953
371 Ga0068868_100254069
372 Ga0070689_100291668
373 Ga0070687_100302956
374 Ga0070668_100890472
375 Ga0070675_101287059
376 Ga0070671_101032815
377 Ga0070674_100189914
378 Ga0070688_100232168
379 Ga0070667_100004860
380 Ga0070667_100667207
381 Ga0070701_10141347
382 Ga0070700_100069844
383 Ga0070663_100138261
384 Ga0070662_100146290
385 Ga0070662_100327093
386 Ga0068867_100546569
387 Ga0070685_10191310
388 Ga0070706_100687249
389 Ga0070672_100307561
390 Ga0070686_100266939
391 Ga0070665_100406377
392 Ga0070704_100478395
393 Ga0068855_100349562
394 Ga0070664_100083128
395 Ga0068857_100000812
396 Ga0068854_100025792
397 Ga0068854_100175716
398 Ga0068854_100530018
399 Ga0070702_100246441
400 Ga0068859_100752899
401 Ga0068864_100001759
402 Ga0068861_100370181
403 Ga0068851_10164643
404 Ga0068863_100425969
405 Ga0068858_100998670
406 Ga0068860_100007037
407 Ga0068862_100170071
408 Ga0081455_10020606
409 Ga0081455_10050873
410 Ga0068871_100912990
411 Ga0068865_100169868
412 Ga0097620_100752852
413 Ga0099795_10068320
414 Ga0105240_10002832
415 Ga0105240_10004332
416 Ga0105240_10053536
417 Ga0105240_10197783
418 Ga0105245_10690205
419 Ga0105243_10244181
420 Ga0105242_10188359
421 Ga0105242_10459322
422 Ga0105248_10075182
423 Ga0105237_10000026
424 Ga0105237_10009530
425 Ga0105237_10096463
426 Ga0105238_10092597
427 Ga0105238_10203720
428 Ga0105249_10218981
429 Ga0123340_1004570
430 Ga0123341_1013020
431 Ga0099796_10108111
432 Ga0105239_10122866
433 Ga0105239_10344004
434 Ga0105239_10612839
435 Ga0157369_10073415
436 Ga0157369_10425281
437 Ga0157374_10416063
438 Ga0157378_10350645
439 Ga0157378_11780844
440 Ga0163162_10377838
441 Ga0157380_10128061
442 Ga0182008_10010042
443 Ga0182007_10040670
444 Ga0163161_10154522
445 Ga0163161_10212666
446 Ga0206353_11732485
447 Ga0213874_10023947
448 Ga0213874_10084941
449 Ga0213876_10166868
450 Ga0213875_10004939
451 Ga0209672_100029
452 Ga0209437_109165
453 Ga0209258_100053
454 Ga0207425_1002252
455 Ga0209677_107874
456 Ga0209148_1000009
457 Ga0209129_1000175
458 Ga0209129_1001603
459 Ga0209233_1000052
460 Ga0209455_1000060
461 Ga0209673_1013181
462 Ga0209025_1000152
463 Ga0209564_1000136
464 Ga0209758_1000266
465 Ga0209758_1000275
466 Ga0209758_1003182
467 Ga0209758_1020163
468 Ga0209256_1018782
469 Ga0207426_1000333
470 Ga0209051_1001155
471 Ga0209257_1025958
472 Ga0207656_10010421
473 Ga0207647_10011002
474 Ga0207645_10287101
475 Ga0207705_10266559
476 Ga0207695_10001108
477 Ga0207695_10001359
478 Ga0207695_10013120
479 Ga0207695_10321345
480 Ga0207671_10000041
481 Ga0207671_10000508
482 Ga0207646_11256157
483 Ga0207659_10436571
484 Ga0207687_10094693
485 Ga0207644_10937516
486 Ga0207690_10720784
487 Ga0207706_10240963
488 Ga0207706_10430014
489 Ga0207686_10251958
490 Ga0207670_10713284
491 Ga0207669_10537218
492 Ga0207704_10196439
493 Ga0207691_10007617
494 Ga0207691_10405978
495 Ga0207711_10037231
496 Ga0207679_10073935
497 Ga0207667_10000157
498 Ga0207667_10299318
499 Ga0207667_10397337
500 Ga0207640_10002073
501 Ga0207640_10024331
502 Ga0207640_11466982
503 Ga0207658_10003412
504 Ga0207677_10200527
505 Ga0207703_10200014
506 Ga0207703_11222420
507 Ga0207678_10259339
508 Ga0207648_10317352
509 Ga0207676_10004719
510 Ga0207674_10001266
511 Ga0207675_100203946
512 Ga0207675_100368739
513 Ga0207683_10509689
514 Ga0207698_11387539
515 Ga0209371_1018916
516 Ga0268266_10209841
517 Ga0268264_10004890
518 Ga0265324_10001634
519 Ga0268256_1005757
520 Ga0265331_10000497
521 Ga0265331_10002470
522 Ga0265327_10010966
523 Ga0265316_10005830
524 Ga0265316_10409354
525 Ga0307513_10171850
526 Ga0307509_10196274
527 Ga0307508_10043532
528 Ga0307508_10147157
529 Ga0373926_0122340
530 Ga0373943_0235327
531 Ga0373942_0056171
532 Ga0373931_0099424
533 Ga0373937_0525119
534 Ga0373925_0830420
535 Ga0395905_0105930
536 Ga0436364_0100806
537 Ga0436364_0236381
538 Ga0436364_0262582
539 Ga0395901_0000009
540 Ga0436365_0394606
541 Ga0436365_1380864
542 Ga0436360_1256854
543 Ga0436363_0249933
544 Ga0436363_0473685
545 Ga0436363_1269101
546 Ga0451791_1539406
547 Ga0451843_0049858
548 Ga0451855_0469297
549 Ga0452271_48974
550 Ga0439448_0012283
551 Ga0450907_054742
552 Ga0466966_0084861
553 Ga0466961_0002952
554 Ga0466967_0287223
555 Ga0495580_0683156
556 Ga0495585_0260865
557 Ga0495606_0038068
558 Ga0495610_0041741
559 Ga0495616_0116041
560 Ga0495630_0286421
561 Ga0495632_0113554
562 Ga0495643_0026674
563 Ga0495643_0029994
564 Ga0495652_0025078
565 Ga0495665_0144008
566 Ga0495587_0054096
567 Ga0495621_0299942
568 Ga0495645_0438342
569 Ga0495656_0156025
570 Ga0495668_0072624
571 Ga0495625_0006602
572 Ga0495635_0455831
573 Ga0495588_0217056
574 Ga0495599_0041026
575 Ga0495623_0511400
576 Ga0495669_0034808
577 Ga0495600_0305095
578 Ga0495660_0189403
579 Ga0495636_0534456
580 Ga0495683_0095322
581 Ga0496100_0319693
582 Ga0496101_0169899
583 Ga0496102_0459330
584 Ga0496103_0259651
585 Ga0496105_0281887
586 Ga0496106_0415455
587 Ga0496107_0453791
588 Ga0496111_0478870
589 Ga0496112_0047069
590 Ga0496112_0162679
591 Ga0496113_0578921
592 Ga0496114_0128471
593 Ga0496114_0627303
594 Ga0496115_0358292
595 Ga0496115_0800149
596 Ga0496116_0077382
597 Ga0496121_0007806
598 Ga0496124_0017942
599 Ga0496125_0000198
600 Ga0496126_0216112
601 Ga0501033_0101069
602 Ga0501047_0270572
603 Ga0501070_0493758
604 Ga0501080_0181621
605 Ga0501080_1488254
606 Ga0501044_0275921
607 Ga0501044_0965449
608 nmdc:mga0yw44_78680_c1
609 Ga0495601_0544731
610 Ga0500569_001582
611 Ga0500658_0044801
612 Ga0500559_0107275
613 Ga0500559_0122451
614 Ga0500616_0104387
615 Ga0587072_031847
616 Ga0587107_070586
617 Ga0501082_0659252
618 2501413863
619 2509368199
620 2510315863
621 2511094870
622 2512033634
623 2517099753
624 2574430629
625 2585281653
626 2585397337
627 2585525052
628 2616309572
629 2688598077
630 2856333789
631 2856334994
632 2869253121
633 2869265843
634 2869272054
635 2871460979
636 2874138584
637 2874165171
638 2876404888
639 2876413729
640 2878775300
641 2878786091
642 2885338011
643 2906364615
644 2906377232
645 2906387618
646 2906398842
647 2906413564
648 2922158259
649 2922176739
650 2922183596
651 2924752289
652 2937872865
653 2958127475
654 2958139427
655 2958158109
656 2961143086
657 2965026082
658 2965037588
659 2965047544
660 2965052670
661 2965091924
662 2965104130
663 2965117703
664 2970551776
665 2977877814
666 2977915695
667 2977936666
668 2977951294
669 2977958636
670 2979794688
671 2987646714
672 2987674871
673 3004200426
674 3004242453
675 649872611
676 8004306894
677 8004369319
678 8004696221

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

54

182

0.85

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

44

172

0.78

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

70

174

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7f36-assembly1.cif.gz_D tact complexed with acetyl-glycyl-trnagly 0.9756 1 156
7f36-assembly1.cif.gz_D tact complexed with acetyl-glycyl-trnagly 0.9516 1 156
6g96-assembly1.cif.gz_B crystal structure of tact3 (trna acetylating toxin) from salmonella 0.9388 5 161
7ak8-assembly1.cif.gz_A structure of salmonella tact1 toxin bound to taca1 antitoxin c-terminal peptide 0.9338 2 156
7ak9-assembly1.cif.gz_A structure of salmonella tact3 toxin bound to taca3 antitoxin c-terminal peptide 0.9304 5 161
ID Description Score Start End Superfamily
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9844 3 157 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9806 4 156 3.40.630.30
af_I6XA42_1_159_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.954 3 157 3.40.630.30
5fvjB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9441 4 156 3.40.630.30
af_Q59V67_76_339_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8406 81 141 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A366I0T5-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9957 106 163
AF-A0A522CKS7-F1-model_v4 N-acetyltransferase 0.994 3 162 GO:0016747
AF-A0A2K8UHM8-F1-model_v4 GNAT family N-acetyltransferase 0.9899 2 156 GO:0016747
AF-A0A2V8ERV0-F1-model_v4 N-acetyltransferase domain-containing protein 0.9899 85 162 GO:0016747
AF-A0A1B3NEK6-F1-model_v4 Acetyltransferase family protein 0.9895 2 163 GO:0016747

Map