F414043

General Info

Members Datasets Scaffolds Average Seq Length
339 177 679 849

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0001878|Ga0495580_0001878_12054_15083
Length 963
Sequence MTRDYYLSQLKIYSRFVRNFNPAQQDKNQMLKIAVGPGGRLGTSPSSLQRELSSLVANGVLVHRREGTRAYSNLTSFGLLGCSSFSYRAQKSPHLGTEWRPDGAHVISCWGKGAVSIPMFMRIRVCLLLALISLILISAPGLSGADFALKVTDKNYLDTQGFSVFLYDSTYHPIFVDQKNTAMEMILHGQRIATNGDVRLMPTPEQWDLVATLKGRHADKANNRLTADLAFPTFDLSYTLEVAAEPGGVRVSINLDKPLPQKLAGRAGFNLEFLPSIYMGKAYLVDGTKAGIFPRTPNDPMTKVLPLPDEPKKAYYLEDWDKAKGYTQPLPFAEGKSITLGVDDALARVNVVSDTANLMLFDGRARAQNGWFVLRSLIPSGKTTGAIVWHIRPDVIPNWTRPPMIAHSQVGYAPGFSKVAVLELDPNYNASKTARVLRLMEDGSYKQVFEGPITPSTPWLRYVYSKFDFTPVKDPGLYVLEYGDQRTAPFPISSDAYANIWQDSLDHHLAEQMDHVSVREGYRVWHGASHLDDGRMAPVVGEQFDGWNQVTATDGKYKGGDHIPGMNVGGWYDAGDFDLEEPAQLSVIQSLALAYREFDLKYDQLTVDEAAREVEMHRPDGVPDTVQQVKHGALLILAQFQNIGHAIRGTHEPDLRQYTQVGDGASKTDGRIYDPKLGPNETKGDYSGKPDDRWIFTTNNPYFQWNAIAALAAAADTLKGWDDALAKDCLDTAIKAWQDAKDHPTRRGSGVGLDWAAALELTIATNGAEPYKSRLKELSPQMITPQQMDLHGWTAVRALPYLDASAKDQLREAVKTYMAGLDKRLDATPFGVPPSLGTWGGSGAVMDMAIRMYFLHKTFPDLVSPEYTLRAVDYILGTHPVSSTSXXXXVGTVSKTMTYSNNRADNAYIPGAVIPGYIIIKPDFPECIDNFGFLWFEDEAVVAGSASWVVAGNAADAIIKESK

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
90 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
101 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
102 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
109 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
125 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
130 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
131 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
132 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
133 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
134 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
137 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
138 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
139 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
140 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
146 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
147 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
148 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
149 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
150 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
151 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
155 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
160 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
161 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
162 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
163 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
164 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
165 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
166 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
175 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
176 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
177 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 2.65
Rhizosphere 91.15
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0001878 3300046472 Bacteria 18487
2 rootH1_10033593 3300003316 Bacteria 10042
3 rootH1_10033593 3300003323 Bacteria 6842
4 rootL2_10076151 3300003322 Bacteria 4315
5 Ga0065712_10075645 3300005290 Bacteria 3814
6 Ga0070683_100000004 3300005329 Bacteria 373231
7 Ga0070683_100001452 3300005329 Bacteria 18237
8 Ga0070683_100028187 3300005329 Bacteria 5074
9 Ga0070683_100048123 3300005329 Bacteria 3942
10 Ga0070683_100057389 3300005329 Bacteria 3617
11 Ga0068869_100003419 3300005334 Bacteria 9701
12 Ga0070680_100006173 3300005336 Bacteria 9085
13 Ga0070680_100015000 3300005336 Bacteria 6065
14 Ga0070682_100026993 3300005337 Bacteria 3442
15 Ga0068868_100007085 3300005338 Bacteria 7968
16 Ga0068868_100029895 3300005338 Bacteria 4175
17 Ga0070668_100008822 3300005347 Bacteria 7487
18 Ga0070671_100000799 3300005355 Bacteria 22726
19 Ga0070671_100002601 3300005355 Bacteria 13979
20 Ga0070671_100003017 3300005355 Bacteria 13102
21 Ga0070667_100015932 3300005367 Bacteria 6219
22 Ga0070714_100000096 3300005435 Bacteria 74616
23 Ga0070713_100000125 3300005436 Bacteria 50351
24 Ga0070713_100000788 3300005436 Bacteria 20250
25 Ga0070713_100006012 3300005436 Bacteria 8358
26 Ga0070713_100012798 3300005436 Bacteria 6169
27 Ga0070711_100000408 3300005439 Bacteria 22286
28 Ga0070711_100013289 3300005439 Bacteria 5168
29 Ga0070711_100022730 3300005439 Bacteria 4068
30 Ga0070708_100020170 3300005445 Bacteria 5616
31 Ga0070662_100006877 3300005457 Bacteria 7360
32 Ga0070681_10000195 3300005458 Bacteria 47245
33 Ga0070681_10008458 3300005458 Bacteria 10072
34 Ga0070681_10028644 3300005458 Bacteria 5601
35 Ga0070681_10090992 3300005458 Bacteria 3001
36 Ga0070679_100000864 3300005530 Bacteria 26322
37 Ga0070684_100000009 3300005535 Bacteria 209881
38 Ga0068853_100000052 3300005539 Bacteria 86096
39 Ga0068853_100014901 3300005539 Bacteria 6385
40 Ga0070665_100000648 3300005548 Bacteria 47008
41 Ga0070665_100004287 3300005548 Bacteria 14990
42 Ga0070665_100009299 3300005548 Bacteria 9946
43 Ga0070665_100013491 3300005548 Bacteria 8222
44 Ga0068855_100000250 3300005563 Bacteria 67441
45 Ga0068855_100000978 3300005563 Bacteria 35574
46 Ga0068855_100005261 3300005563 Bacteria 15797
47 Ga0068855_100009728 3300005563 Bacteria 11600
48 Ga0068855_100021706 3300005563 Bacteria 7700
49 Ga0068855_100031670 3300005563 Bacteria 6314
50 Ga0068857_100002172 3300005577 Bacteria 15945
51 Ga0068854_100036852 3300005578 Bacteria 3430
52 Ga0068856_100000107 3300005614 Bacteria 81707
53 Ga0068856_100001248 3300005614 Bacteria 26722
54 Ga0068856_100002817 3300005614 Bacteria 17805
55 Ga0068856_100005406 3300005614 Bacteria 12587
56 Ga0068856_100014380 3300005614 Bacteria 7650
57 Ga0068856_100016550 3300005614 Bacteria 7137
58 Ga0068856_100020028 3300005614 Bacteria 6495
59 Ga0068856_100025827 3300005614 Bacteria 5727
60 Ga0068856_100032199 3300005614 Bacteria 5133
61 Ga0068856_100041283 3300005614 Bacteria 4533
62 Ga0068856_100073307 3300005614 Bacteria 3390
63 Ga0068852_100000010 3300005616 Bacteria 141683
64 Ga0068852_100000319 3300005616 Bacteria 32685
65 Ga0068859_100003018 3300005617 Bacteria 17065
66 Ga0068863_100009590 3300005841 Bacteria 9445
67 Ga0068858_100001302 3300005842 Bacteria 25776
68 Ga0068858_100021414 3300005842 Bacteria 6040
69 Ga0068858_100026056 3300005842 Bacteria 5436
70 Ga0068860_100000358 3300005843 Bacteria 60466
71 Ga0068860_100008247 3300005843 Bacteria 10368
72 Ga0068860_100031228 3300005843 Bacteria 5121
73 Ga0070712_100000067 3300006175 Bacteria 53056
74 Ga0070712_100017806 3300006175 Bacteria 4602
75 Ga0097621_100000735 3300006237 Bacteria 22947
76 Ga0097621_100007279 3300006237 Bacteria 7905
77 Ga0097621_100029308 3300006237 Bacteria 4346
78 Ga0068871_100000410 3300006358 Bacteria 29656
79 Ga0068871_100001081 3300006358 Bacteria 18287
80 Ga0075434_100050264 3300006871 Bacteria 4141
81 Ga0097620_100003018 3300006931 Bacteria 17065
82 Ga0105240_10000060 3300009093 Bacteria 219839
83 Ga0105240_10000436 3300009093 Bacteria 76985
84 Ga0105240_10000792 3300009093 Bacteria 57279
85 Ga0105240_10002230 3300009093 Bacteria 31523
86 Ga0105240_10002577 3300009093 Bacteria 29052
87 Ga0105240_10004439 3300009093 Bacteria 21395
88 Ga0105240_10006478 3300009093 Bacteria 17193
89 Ga0105240_10009459 3300009093 Bacteria 13797
90 Ga0105240_10020078 3300009093 Bacteria 8920
91 Ga0105240_10021620 3300009093 Bacteria 8557
92 Ga0105240_10033965 3300009093 Bacteria 6586
93 Ga0105240_10055810 3300009093 Bacteria 4945
94 Ga0105240_10070227 3300009093 Bacteria 4333
95 Ga0105240_10127687 3300009093 Bacteria 3054
96 Ga0105247_10000137 3300009101 Bacteria 70918
97 Ga0105247_10010902 3300009101 Bacteria 5491
98 Ga0105241_10000014 3300009174 Bacteria 171306
99 Ga0105241_10029522 3300009174 Bacteria 4093
100 Ga0105241_10039820 3300009174 Bacteria 3546
101 Ga0105241_10057238 3300009174 Bacteria 2990
102 Ga0105248_10000768 3300009177 Bacteria 36009
103 Ga0105248_10010546 3300009177 Bacteria 10180
104 Ga0105248_10022140 3300009177 Bacteria 7045
105 Ga0105248_10036409 3300009177 Bacteria 5503
106 Ga0105248_10081726 3300009177 Bacteria 3632
107 Ga0105237_10019278 3300009545 Bacteria 7047
108 Ga0105237_10019509 3300009545 Bacteria 7002
109 Ga0105237_10031903 3300009545 Bacteria 5336
110 Ga0105237_10050039 3300009545 Bacteria 4200
111 Ga0105238_10000090 3300009551 Bacteria 102374
112 Ga0105238_10001060 3300009551 Bacteria 27763
113 Ga0105238_10001481 3300009551 Bacteria 23573
114 Ga0105238_10004975 3300009551 Bacteria 13141
115 Ga0105238_10005061 3300009551 Bacteria 13033
116 Ga0105238_10011181 3300009551 Bacteria 9029
117 Ga0105238_10012541 3300009551 Bacteria 8555
118 Ga0105238_10021146 3300009551 Bacteria 6631
119 Ga0105238_10038112 3300009551 Bacteria 4883
120 Ga0105238_10042503 3300009551 Bacteria 4602
121 Ga0105249_10009117 3300009553 Bacteria 8679
122 Ga0105239_10015258 3300010375 Bacteria 8513
123 Ga0157373_10023392 3300013100 Bacteria 4480
124 Ga0157370_10000005 3300013104 Bacteria 288514
125 Ga0157370_10011091 3300013104 Bacteria 9447
126 Ga0157369_10000049 3300013105 Bacteria 169239
127 Ga0157369_10000062 3300013105 Bacteria 149758
128 Ga0157369_10001464 3300013105 Bacteria 28931
129 Ga0157369_10001678 3300013105 Bacteria 27009
130 Ga0157369_10002045 3300013105 Bacteria 24340
131 Ga0157369_10003116 3300013105 Bacteria 19813
132 Ga0157369_10006463 3300013105 Bacteria 13588
133 Ga0157369_10018414 3300013105 Bacteria 7830
134 Ga0157374_10000684 3300013296 Bacteria 29878
135 Ga0157374_10001112 3300013296 Bacteria 23158
136 Ga0157374_10001524 3300013296 Bacteria 19513
137 Ga0157374_10009547 3300013296 Bacteria 8332
138 Ga0157378_10001362 3300013297 Bacteria 21956
139 Ga0157378_10004149 3300013297 Bacteria 12796
140 Ga0157378_10014218 3300013297 Bacteria 6966
141 Ga0157378_10040256 3300013297 Bacteria 4143
142 Ga0163162_10000264 3300013306 Bacteria 47545
143 Ga0157372_10000047 3300013307 Bacteria 145881
144 Ga0157372_10002754 3300013307 Bacteria 19004
145 Ga0157372_10009660 3300013307 Bacteria 10254
146 Ga0157372_10019665 3300013307 Bacteria 7277
147 Ga0157372_10034462 3300013307 Bacteria 5565
148 Ga0163163_10015158 3300014325 Bacteria 7116
149 Ga0157379_10009285 3300014968 Bacteria 8563
150 Ga0157376_10000724 3300014969 Bacteria 21378
151 Ga0182007_10001909 3300015262 Bacteria 10824
152 Ga0207710_10000317 3300025900 Bacteria 37077
153 Ga0207684_10000668 3300025910 Bacteria 40657
154 Ga0207684_10037228 3300025910 Bacteria 4128
155 Ga0207654_10000018 3300025911 Bacteria 173245
156 Ga0207654_10000100 3300025911 Bacteria 57508
157 Ga0207654_10007996 3300025911 Bacteria 5331
158 Ga0207654_10017987 3300025911 Bacteria 3705
159 Ga0207707_10000796 3300025912 Bacteria 30935
160 Ga0207707_10023486 3300025912 Bacteria 5394
161 Ga0207695_10000025 3300025913 Bacteria 627211
162 Ga0207695_10000030 3300025913 Bacteria 533735
163 Ga0207695_10000507 3300025913 Bacteria 82878
164 Ga0207695_10003305 3300025913 Bacteria 22881
165 Ga0207695_10006198 3300025913 Bacteria 15587
166 Ga0207695_10017572 3300025913 Bacteria 8313
167 Ga0207695_10040953 3300025913 Bacteria 4961
168 Ga0207695_10069187 3300025913 Bacteria 3613
169 Ga0207695_10070903 3300025913 Bacteria 3560
170 Ga0207671_10000562 3300025914 Bacteria 49896
171 Ga0207671_10006539 3300025914 Bacteria 10360
172 Ga0207693_10000252 3300025915 Bacteria 49630
173 Ga0207693_10002771 3300025915 Bacteria 15175
174 Ga0207693_10004954 3300025915 Bacteria 11189
175 Ga0207663_10024423 3300025916 Bacteria 3481
176 Ga0207660_10006932 3300025917 Bacteria 7337
177 Ga0207660_10015966 3300025917 Bacteria 4964
178 Ga0207657_10001194 3300025919 Bacteria 27626
179 Ga0207657_10001956 3300025919 Bacteria 22232
180 Ga0207652_10004299 3300025921 Bacteria 11611
181 Ga0207652_10021207 3300025921 Bacteria 5361
182 Ga0207652_10023669 3300025921 Bacteria 5089
183 Ga0207694_10000749 3300025924 Bacteria 29171
184 Ga0207694_10001381 3300025924 Bacteria 20900
185 Ga0207694_10007101 3300025924 Bacteria 8510
186 Ga0207694_10008938 3300025924 Bacteria 7563
187 Ga0207694_10042363 3300025924 Bacteria 3511
188 Ga0207700_10000381 3300025928 Bacteria 25771
189 Ga0207700_10001805 3300025928 Bacteria 12162
190 Ga0207664_10000087 3300025929 Bacteria 88607
191 Ga0207664_10029191 3300025929 Bacteria 4199
192 Ga0207706_10009145 3300025933 Bacteria 9109
193 Ga0207665_10000948 3300025939 Bacteria 19619
194 Ga0207689_10001455 3300025942 Bacteria 22661
195 Ga0207661_10000017 3300025944 Bacteria 289163
196 Ga0207661_10009281 3300025944 Bacteria 7051
197 Ga0207667_10000949 3300025949 Bacteria 36988
198 Ga0207667_10001904 3300025949 Bacteria 26195
199 Ga0207667_10003377 3300025949 Bacteria 19699
200 Ga0207667_10013453 3300025949 Bacteria 9364
201 Ga0207640_10023799 3300025981 Bacteria 3686
202 Ga0207658_10003615 3300025986 Bacteria 10924
203 Ga0207658_10009732 3300025986 Bacteria 6525
204 Ga0207677_10016064 3300026023 Bacteria 4423
205 Ga0207677_10023041 3300026023 Bacteria 3838
206 Ga0207703_10001608 3300026035 Bacteria 20424
207 Ga0207639_10000666 3300026041 Bacteria 23711
208 Ga0207678_10002950 3300026067 Bacteria 15407
209 Ga0207678_10029696 3300026067 Bacteria 4773
210 Ga0207702_10000103 3300026078 Bacteria 99037
211 Ga0207702_10002192 3300026078 Bacteria 18717
212 Ga0207702_10005310 3300026078 Bacteria 11300
213 Ga0207702_10017107 3300026078 Bacteria 5997
214 Ga0207641_10000458 3300026088 Bacteria 46494
215 Ga0207641_10004515 3300026088 Bacteria 12028
216 Ga0207641_10010902 3300026088 Bacteria 7448
217 Ga0207648_10004931 3300026089 Bacteria 13584
218 Ga0207674_10000799 3300026116 Bacteria 40975
219 Ga0207674_10007556 3300026116 Bacteria 12664
220 Ga0207674_10014847 3300026116 Bacteria 8589
221 Ga0207683_10027311 3300026121 Bacteria 4932
222 Ga0207698_10000003 3300026142 Bacteria 321303
223 Ga0268266_10001605 3300028379 Bacteria 26384
224 Ga0268266_10002193 3300028379 Bacteria 21353
225 Ga0268266_10012785 3300028379 Bacteria 7252
226 Ga0268264_10000047 3300028381 Bacteria 349944
227 Ga0268264_10001478 3300028381 Bacteria 21925
228 Ga0268264_10016890 3300028381 Bacteria 5975
229 Ga0265323_10003237 3300028653 Bacteria 7254
230 Ga0265336_10004529 3300028666 Bacteria 5242
231 Ga0265338_10003365 3300028800 Bacteria 22571
232 Ga0265338_10008595 3300028800 Bacteria 12356
233 Ga0265338_10029319 3300028800 Bacteria 5456
234 Ga0265338_10045616 3300028800 Bacteria 4027
235 Ga0265320_10001228 3300031240 Bacteria 18819
236 Ga0265325_10001576 3300031241 Bacteria 15900
237 Ga0265339_10000003 3300031249 Bacteria 305994
238 Ga0265339_10008842 3300031249 Bacteria 6376
239 Ga0265331_10003684 3300031250 Bacteria 9758
240 Ga0265316_10003071 3300031344 Bacteria 17030
241 Ga0307408_100047659 3300031548 Bacteria 3070
242 Ga0265314_10000261 3300031711 Bacteria 77506
243 Ga0265314_10040133 3300031711 Bacteria 3363
244 Ga0265342_10018234 3300031712 Bacteria 4551
245 Ga0265342_10018312 3300031712 Bacteria 4538
246 Ga0307510_10000016 3300033180 Bacteria 206932
247 Ga0307510_10002386 3300033180 Bacteria 21282
248 Ga0373953_0004181 3300035117 Bacteria 4580
249 Ga0373954_0001017 3300035118 Bacteria 11102
250 Ga0373943_0011111 3300035170 Bacteria 4046
251 Ga0373946_0009327 3300035171 Bacteria 3612
252 Ga0373955_0005619 3300035172 Bacteria 5641
253 Ga0316574_0009269 3300035398 Bacteria 5506
254 Ga0373935_0038303 3300035692 Unclassified 3002
255 Ga0373933_0000438 3300035724 Bacteria 26060
256 Ga0373947_0020725 3300035725 Bacteria 3799
257 Ga0373937_0000322 3300036401 Bacteria 45481
258 Ga0373937_0028719 3300036401 Bacteria 5035
259 Ga0373925_0016755 3300037068 Bacteria 5307
260 Ga0373925_0027604 3300037068 Bacteria 4155
261 Ga0395905_0030071 3300037471 Bacteria 5120
262 Ga0436364_1460896 3300037853 Bacteria 6826
263 Ga0436361_0038755 3300039447 Bacteria 48544
264 Ga0436363_0013612 3300039450 Bacteria 6153
265 Ga0439448_0004360 3300042005 Bacteria 3994
266 Ga0439455_0001081 3300042012 Bacteria 4343
267 Ga0451577_0000639 3300042876 Bacteria 55755
268 Ga0451577_0002106 3300042876 Bacteria 24519
269 Ga0451577_0026913 3300042876 Bacteria 5207
270 Ga0466972_0039710 3300044658 Bacteria 2296
271 Ga0453683_0000322 3300044673 Bacteria 58997
272 Ga0451576_0000071 3300045051 Bacteria 258795
273 Ga0451576_0000932 3300045051 Bacteria 55136
274 Ga0466967_0036770 3300045976 Bacteria 4183
275 Ga0495651_0014095 3300046462 Bacteria 6183
276 Ga0495653_0002965 3300046463 Bacteria 13593
277 Ga0495580_0002296 3300046472 Bacteria 16692
278 Ga0495580_0047922 3300046472 Bacteria 3028
279 Ga0495582_0013068 3300046473 Bacteria 4571
280 Ga0495662_0001310 3300046476 Bacteria 12313
281 Ga0495594_0000451 3300046499 Bacteria 20841
282 Ga0495606_0025348 3300046507 Bacteria 4249
283 Ga0495644_0000580 3300046523 Bacteria 15324
284 Ga0495666_0000349 3300046526 Bacteria 20177
285 Ga0495652_0011242 3300046529 Bacteria 8103
286 Ga0495652_0013288 3300046529 Bacteria 7409
287 Ga0495665_0001001 3300046531 Bacteria 15001
288 Ga0495640_0001051 3300046533 Bacteria 21466
289 Ga0495586_0002005 3300046535 Bacteria 11051
290 Ga0495587_0003574 3300046536 Bacteria 10359
291 Ga0495645_0000178 3300046543 Bacteria 44629
292 Ga0495645_0037299 3300046543 Bacteria 3543
293 Ga0495667_0008171 3300046559 Bacteria 7103
294 Ga0495634_0002336 3300046642 Bacteria 15851
295 Ga0495635_0006444 3300046663 Bacteria 8183
296 Ga0495588_0012009 3300046674 Bacteria 4081
297 Ga0495646_0010600 3300046680 Bacteria 5854
298 Ga0495624_0003415 3300046690 Bacteria 11777
299 Ga0495600_0000127 3300046809 Bacteria 42749
300 Ga0495581_0001009 3300047315 Bacteria 15209
301 Ga0495604_0000783 3300047317 Bacteria 26772
302 Ga0495604_0002410 3300047317 Bacteria 14966
303 Ga0495674_0010605 3300047319 Bacteria 8719
304 Ga0495676_0000532 3300047321 Bacteria 31321
305 Ga0495675_0000425 3300047444 Bacteria 28334
306 Ga0495675_0004573 3300047444 Bacteria 8392
307 Ga0495684_0046661 3300047471 Bacteria 3314
308 Ga0495602_0011230 3300048088 Bacteria 9262
309 Ga0495602_0042967 3300048088 Bacteria 4114
310 Ga0496101_0071720 3300048904 Bacteria 2540
311 Ga0496102_0009752 3300048905 Bacteria 8257
312 Ga0496102_0038164 3300048905 Bacteria 4334
313 Ga0496104_0042990 3300048907 Bacteria 4243
314 Ga0496105_0008434 3300048908 Bacteria 8009
315 Ga0496110_0031533 3300048913 Bacteria 4573
316 Ga0496112_0004218 3300048915 Bacteria 12125
317 Ga0496114_0012261 3300048917 Bacteria 6860
318 Ga0496115_0025330 3300048918 Bacteria 4618
319 Ga0496117_0001731 3300048920 Bacteria 30192
320 Ga0496118_0000005 3300048921 Bacteria 697350
321 Ga0496119_0001923 3300048922 Bacteria 23713
322 Ga0496120_0000242 3300048923 Bacteria 93148
323 Ga0496121_0001771 3300048924 Bacteria 35100
324 Ga0496122_0001352 3300048925 Bacteria 39977
325 Ga0496123_0000465 3300048926 Bacteria 70986
326 Ga0496125_0000781 3300048928 Bacteria 52034
327 Ga0496125_0007118 3300048928 Bacteria 11940
328 Ga0496125_0061216 3300048928 Bacteria 3020
329 Ga0496126_0001566 3300048929 Bacteria 35078
330 Ga0496126_0057449 3300048929 Bacteria 3512
331 Ga0501032_0000913 3300049569 Bacteria 23895
332 Ga0501046_0005267 3300049580 Bacteria 11567
333 Ga0501047_0008103 3300049581 Bacteria 9914
334 Ga0501044_0000738 3300049823 Bacteria 39419
335 nmdc:mga0n895_36259_c1 3300050512 Bacteria 4762
336 nmdc:mga08x19_1155_c1 3300050514 Bacteria 16493
337 Ga0500616_0000105 3300053153 Bacteria 157881
338 2788437427 2786546940 Bacteria 6396474
339 2919712306 2919709256 Bacteria 4318106
340 2928532099 2928531327 Bacteria 5101314
341 Ga0495580_0001878
342 rootH1_10033593
343 rootL2_10076151
344 Ga0065712_10075645
345 Ga0070683_100000004
346 Ga0070683_100001452
347 Ga0070683_100028187
348 Ga0070683_100048123
349 Ga0070683_100057389
350 Ga0068869_100003419
351 Ga0070680_100006173
352 Ga0070680_100015000
353 Ga0070682_100026993
354 Ga0068868_100007085
355 Ga0068868_100029895
356 Ga0070668_100008822
357 Ga0070671_100000799
358 Ga0070671_100002601
359 Ga0070671_100003017
360 Ga0070667_100015932
361 Ga0070714_100000096
362 Ga0070713_100000125
363 Ga0070713_100000788
364 Ga0070713_100006012
365 Ga0070713_100012798
366 Ga0070711_100000408
367 Ga0070711_100013289
368 Ga0070711_100022730
369 Ga0070708_100020170
370 Ga0070662_100006877
371 Ga0070681_10000195
372 Ga0070681_10008458
373 Ga0070681_10028644
374 Ga0070681_10090992
375 Ga0070679_100000864
376 Ga0070684_100000009
377 Ga0068853_100000052
378 Ga0068853_100014901
379 Ga0070665_100000648
380 Ga0070665_100004287
381 Ga0070665_100009299
382 Ga0070665_100013491
383 Ga0068855_100000250
384 Ga0068855_100000978
385 Ga0068855_100005261
386 Ga0068855_100009728
387 Ga0068855_100021706
388 Ga0068855_100031670
389 Ga0068857_100002172
390 Ga0068854_100036852
391 Ga0068856_100000107
392 Ga0068856_100001248
393 Ga0068856_100002817
394 Ga0068856_100005406
395 Ga0068856_100014380
396 Ga0068856_100016550
397 Ga0068856_100020028
398 Ga0068856_100025827
399 Ga0068856_100032199
400 Ga0068856_100041283
401 Ga0068856_100073307
402 Ga0068852_100000010
403 Ga0068852_100000319
404 Ga0068859_100003018
405 Ga0068863_100009590
406 Ga0068858_100001302
407 Ga0068858_100021414
408 Ga0068858_100026056
409 Ga0068860_100000358
410 Ga0068860_100008247
411 Ga0068860_100031228
412 Ga0070712_100000067
413 Ga0070712_100017806
414 Ga0097621_100000735
415 Ga0097621_100007279
416 Ga0097621_100029308
417 Ga0068871_100000410
418 Ga0068871_100001081
419 Ga0075434_100050264
420 Ga0097620_100003018
421 Ga0105240_10000060
422 Ga0105240_10000436
423 Ga0105240_10000792
424 Ga0105240_10002230
425 Ga0105240_10002577
426 Ga0105240_10004439
427 Ga0105240_10006478
428 Ga0105240_10009459
429 Ga0105240_10020078
430 Ga0105240_10021620
431 Ga0105240_10033965
432 Ga0105240_10055810
433 Ga0105240_10070227
434 Ga0105240_10127687
435 Ga0105247_10000137
436 Ga0105247_10010902
437 Ga0105241_10000014
438 Ga0105241_10029522
439 Ga0105241_10039820
440 Ga0105241_10057238
441 Ga0105248_10000768
442 Ga0105248_10010546
443 Ga0105248_10022140
444 Ga0105248_10036409
445 Ga0105248_10081726
446 Ga0105237_10019278
447 Ga0105237_10019509
448 Ga0105237_10031903
449 Ga0105237_10050039
450 Ga0105238_10000090
451 Ga0105238_10001060
452 Ga0105238_10001481
453 Ga0105238_10004975
454 Ga0105238_10005061
455 Ga0105238_10011181
456 Ga0105238_10012541
457 Ga0105238_10021146
458 Ga0105238_10038112
459 Ga0105238_10042503
460 Ga0105249_10009117
461 Ga0105239_10015258
462 Ga0157373_10023392
463 Ga0157370_10000005
464 Ga0157370_10011091
465 Ga0157369_10000049
466 Ga0157369_10000062
467 Ga0157369_10001464
468 Ga0157369_10001678
469 Ga0157369_10002045
470 Ga0157369_10003116
471 Ga0157369_10006463
472 Ga0157369_10018414
473 Ga0157374_10000684
474 Ga0157374_10001112
475 Ga0157374_10001524
476 Ga0157374_10009547
477 Ga0157378_10001362
478 Ga0157378_10004149
479 Ga0157378_10014218
480 Ga0157378_10040256
481 Ga0163162_10000264
482 Ga0157372_10000047
483 Ga0157372_10002754
484 Ga0157372_10009660
485 Ga0157372_10019665
486 Ga0157372_10034462
487 Ga0163163_10015158
488 Ga0157379_10009285
489 Ga0157376_10000724
490 Ga0182007_10001909
491 Ga0207710_10000317
492 Ga0207684_10000668
493 Ga0207684_10037228
494 Ga0207654_10000018
495 Ga0207654_10000100
496 Ga0207654_10007996
497 Ga0207654_10017987
498 Ga0207707_10000796
499 Ga0207707_10023486
500 Ga0207695_10000025
501 Ga0207695_10000030
502 Ga0207695_10000507
503 Ga0207695_10003305
504 Ga0207695_10006198
505 Ga0207695_10017572
506 Ga0207695_10040953
507 Ga0207695_10069187
508 Ga0207695_10070903
509 Ga0207671_10000562
510 Ga0207671_10006539
511 Ga0207693_10000252
512 Ga0207693_10002771
513 Ga0207693_10004954
514 Ga0207663_10024423
515 Ga0207660_10006932
516 Ga0207660_10015966
517 Ga0207657_10001194
518 Ga0207657_10001956
519 Ga0207652_10004299
520 Ga0207652_10021207
521 Ga0207652_10023669
522 Ga0207694_10000749
523 Ga0207694_10001381
524 Ga0207694_10007101
525 Ga0207694_10008938
526 Ga0207694_10042363
527 Ga0207700_10000381
528 Ga0207700_10001805
529 Ga0207664_10000087
530 Ga0207664_10029191
531 Ga0207706_10009145
532 Ga0207665_10000948
533 Ga0207689_10001455
534 Ga0207661_10000017
535 Ga0207661_10009281
536 Ga0207667_10000949
537 Ga0207667_10001904
538 Ga0207667_10003377
539 Ga0207667_10013453
540 Ga0207640_10023799
541 Ga0207658_10003615
542 Ga0207658_10009732
543 Ga0207677_10016064
544 Ga0207677_10023041
545 Ga0207703_10001608
546 Ga0207639_10000666
547 Ga0207678_10002950
548 Ga0207678_10029696
549 Ga0207702_10000103
550 Ga0207702_10002192
551 Ga0207702_10005310
552 Ga0207702_10017107
553 Ga0207641_10000458
554 Ga0207641_10004515
555 Ga0207641_10010902
556 Ga0207648_10004931
557 Ga0207674_10000799
558 Ga0207674_10007556
559 Ga0207674_10014847
560 Ga0207683_10027311
561 Ga0207698_10000003
562 Ga0268266_10001605
563 Ga0268266_10002193
564 Ga0268266_10012785
565 Ga0268264_10000047
566 Ga0268264_10001478
567 Ga0268264_10016890
568 Ga0265323_10003237
569 Ga0265336_10004529
570 Ga0265338_10003365
571 Ga0265338_10008595
572 Ga0265338_10029319
573 Ga0265338_10045616
574 Ga0265320_10001228
575 Ga0265325_10001576
576 Ga0265339_10000003
577 Ga0265339_10008842
578 Ga0265331_10003684
579 Ga0265316_10003071
580 Ga0307408_100047659
581 Ga0265314_10000261
582 Ga0265314_10040133
583 Ga0265342_10018234
584 Ga0265342_10018312
585 Ga0307510_10000016
586 Ga0307510_10002386
587 Ga0373953_0004181
588 Ga0373954_0001017
589 Ga0373943_0011111
590 Ga0373946_0009327
591 Ga0373955_0005619
592 Ga0316574_0009269
593 Ga0373935_0038303
594 Ga0373933_0000438
595 Ga0373947_0020725
596 Ga0373937_0000322
597 Ga0373937_0028719
598 Ga0373925_0016755
599 Ga0373925_0027604
600 Ga0395905_0030071
601 Ga0436364_1460896
602 Ga0436361_0038755
603 Ga0436363_0013612
604 Ga0439448_0004360
605 Ga0439455_0001081
606 Ga0451577_0000639
607 Ga0451577_0002106
608 Ga0451577_0026913
609 Ga0466972_0039710
610 Ga0453683_0000322
611 Ga0451576_0000071
612 Ga0451576_0000932
613 Ga0466967_0036770
614 Ga0495651_0014095
615 Ga0495653_0002965
616 Ga0495580_0002296
617 Ga0495580_0047922
618 Ga0495582_0013068
619 Ga0495662_0001310
620 Ga0495594_0000451
621 Ga0495606_0025348
622 Ga0495644_0000580
623 Ga0495666_0000349
624 Ga0495652_0011242
625 Ga0495652_0013288
626 Ga0495665_0001001
627 Ga0495640_0001051
628 Ga0495586_0002005
629 Ga0495587_0003574
630 Ga0495645_0000178
631 Ga0495645_0037299
632 Ga0495667_0008171
633 Ga0495634_0002336
634 Ga0495635_0006444
635 Ga0495588_0012009
636 Ga0495646_0010600
637 Ga0495624_0003415
638 Ga0495600_0000127
639 Ga0495581_0001009
640 Ga0495604_0000783
641 Ga0495604_0002410
642 Ga0495674_0010605
643 Ga0495676_0000532
644 Ga0495675_0000425
645 Ga0495675_0004573
646 Ga0495684_0046661
647 Ga0495602_0011230
648 Ga0495602_0042967
649 Ga0496101_0071720
650 Ga0496102_0009752
651 Ga0496102_0038164
652 Ga0496104_0042990
653 Ga0496105_0008434
654 Ga0496110_0031533
655 Ga0496112_0004218
656 Ga0496114_0012261
657 Ga0496115_0025330
658 Ga0496117_0001731
659 Ga0496118_0000005
660 Ga0496119_0001923
661 Ga0496120_0000242
662 Ga0496121_0001771
663 Ga0496122_0001352
664 Ga0496123_0000465
665 Ga0496125_0000781
666 Ga0496125_0007118
667 Ga0496125_0061216
668 Ga0496126_0001566
669 Ga0496126_0057449
670 Ga0501032_0000913
671 Ga0501046_0005267
672 Ga0501047_0008103
673 Ga0501044_0000738
674 nmdc:mga0n895_36259_c1
675 nmdc:mga08x19_1155_c1
676 Ga0500616_0000105
677 2788437427
678 2919712306
679 2928532099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02927

CelD_N

Cellulase N-terminal ig-like domain

400

487

0.87

PF00759

Glyco_hydro_9

Glycosyl hydrolase family 9

497

918

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fhj-assembly1.cif.gz_A structural dynamics and catalytic properties of a multi-modular xanthanase, native. 0.7004 282 847
6fhn-assembly1.cif.gz_A structural dynamics and catalytic properties of a multi-modular xanthanase (pt derivative) 0.677 282 847
6dht-assembly1.cif.gz_A bacteroides ovatus gh9 bacova_02649 0.6668 282 848
1ut9-assembly1.cif.gz_A structural basis for the exocellulase activity of the cellobiohydrolase cbha from c. thermocellum 0.6601 282 848
6dht-assembly1.cif.gz_A bacteroides ovatus gh9 bacova_02649 0.6591 282 848
ID Description Score Start End Superfamily
3h7lA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8201 282 370 2.60.40.10
5e2jA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8066 279 370 2.60.40.10
5e2jA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7889 279 370 2.60.40.10
3h7lA01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7795 282 370 2.60.40.10
3x17B01 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7783 280 370 2.60.40.10
ID Description Score Start End GO Terms
AF-W4UXP0-F1-model_v4 Glycoside hydrolase 0.9531 20 256
AF-A0A3D2SG80-F1-model_v4 Glycoside hydrolase 0.9422 20 273
AF-A0A7C3DAZ7-F1-model_v4 Glycoside hydrolase 0.9373 19 237 GO:0016787
AF-A0A353TXV0-F1-model_v4 Glycoside hydrolase 0.9354 20 522 GO:0005975
GO:0008810
AF-A0A7C5AVI9-F1-model_v4 Glycoside hydrolase 0.9333 19 400 GO:0005975
GO:0008810

Map