F414191

General Info

Members Datasets Scaffolds Average Seq Length
340 228 680 144

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10250346|Ga0065707_102503462
Length 135
Sequence MRTLSLDLRERILACYDSEEGTREETAERYRVSLGMVKKLLQQRRRTGEIGPRHYRSGRKPIIRALLAKKPDLTLKELRAAVALECTLPAMHYALEKMGLTYKKRHSGLASKTAQTSRGRVGRGGGGKPVGIRPD

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
56 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
100 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
101 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
102 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
103 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
104 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
105 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
108 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
109 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
110 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
111 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
116 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
117 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
126 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
127 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
136 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
145 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
146 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
155 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
156 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
157 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
158 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
159 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
173 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
181 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
182 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
183 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
184 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
185 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
186 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
187 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
188 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
191 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
192 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
199 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
207 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
212 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
228 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 0.59
Rhizosphere 96.47
Stem 0
Stem Tuber 0
Unclassified 24.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10250346 3300005295 Bacteria 1127
2 rootH2_10244928 3300003320 Unclassified 1227
3 rootL2_10137951 3300003322 Bacteria 1282
4 Ga0070690_100271095 3300005330 Bacteria 1207
5 Ga0068869_100360063 3300005334 Bacteria 1188
6 Ga0070689_100233530 3300005340 Bacteria 1512
7 Ga0070689_100292094 3300005340 Bacteria 1355
8 Ga0070689_100319359 3300005340 Unclassified 1296
9 Ga0070689_100349710 3300005340 Bacteria 1239
10 Ga0070689_100945737 3300005340 Bacteria 764
11 Ga0070689_101676940 3300005340 Bacteria 578
12 Ga0070691_10305737 3300005341 Bacteria 870
13 Ga0070687_100295646 3300005343 Bacteria 1025
14 Ga0070687_100544998 3300005343 Bacteria 788
15 Ga0070673_100428990 3300005364 Bacteria 1186
16 Ga0070688_100184671 3300005365 Bacteria 1449
17 Ga0070688_100813927 3300005365 Bacteria 731
18 Ga0070709_10385436 3300005434 Bacteria 1043
19 Ga0070714_100397424 3300005435 Bacteria 1302
20 Ga0070710_10275624 3300005437 Unclassified 1089
21 Ga0070710_10811277 3300005437 Unclassified 669
22 Ga0070701_10239143 3300005438 Bacteria 1091
23 Ga0070701_10246759 3300005438 Bacteria 1076
24 Ga0070711_100363449 3300005439 Bacteria 1166
25 Ga0070705_100126339 3300005440 Unclassified 1661
26 Ga0070705_100602260 3300005440 Bacteria 850
27 Ga0070700_100192076 3300005441 Bacteria 1428
28 Ga0070700_100358621 3300005441 Bacteria 1083
29 Ga0070694_100399452 3300005444 Bacteria 1076
30 Ga0070694_100962825 3300005444 Unclassified 707
31 Ga0070708_100326039 3300005445 Bacteria 1447
32 Ga0070708_100408106 3300005445 Unclassified 1281
33 Ga0068867_101100939 3300005459 Unclassified 725
34 Ga0070685_10214685 3300005466 Bacteria 1257
35 Ga0070685_10337473 3300005466 Bacteria 1026
36 Ga0070697_100140691 3300005536 Bacteria 2029
37 Ga0068853_100000062 3300005539 Bacteria 77196
38 Ga0070686_100139954 3300005544 Unclassified 1683
39 Ga0070695_100215308 3300005545 Bacteria 1381
40 Ga0070695_100368051 3300005545 Unclassified 1081
41 Ga0070693_100284167 3300005547 Bacteria 1109
42 Ga0070665_100122819 3300005548 Unclassified 2599
43 Ga0070704_100305509 3300005549 Bacteria 1327
44 Ga0070704_100388818 3300005549 Bacteria 1187
45 Ga0070704_100674610 3300005549 Unclassified 914
46 Ga0068857_100221434 3300005577 Bacteria 1728
47 Ga0068854_100414700 3300005578 Unclassified 1117
48 Ga0068856_100000961 3300005614 Bacteria 30770
49 Ga0070702_100087273 3300005615 Bacteria 1884
50 Ga0068859_100419107 3300005617 Bacteria 1435
51 Ga0068859_100469548 3300005617 Bacteria 1354
52 Ga0068864_100196056 3300005618 Bacteria 1853
53 Ga0068864_100333109 3300005618 Bacteria 1428
54 Ga0068864_100563716 3300005618 Unclassified 1102
55 Ga0068861_100913127 3300005719 Bacteria 832
56 Ga0068870_10283558 3300005840 Bacteria 1039
57 Ga0068863_100212191 3300005841 Bacteria 1864
58 Ga0068858_100458481 3300005842 Bacteria 1229
59 Ga0068858_101699212 3300005842 Bacteria 623
60 Ga0068860_101391031 3300005843 Unclassified 723
61 Ga0068862_100352912 3300005844 Bacteria 1365
62 Ga0068862_100570069 3300005844 Bacteria 1083
63 Ga0070716_100092220 3300006173 Bacteria 1836
64 Ga0070716_100382963 3300006173 Unclassified 1006
65 Ga0070712_100125820 3300006175 Bacteria 1936
66 Ga0070712_101109896 3300006175 Unclassified 687
67 Ga0068871_101111338 3300006358 Bacteria 739
68 Ga0075428_100574767 3300006844 Unclassified 1204
69 Ga0075428_101339629 3300006844 Bacteria 752
70 Ga0075430_100266744 3300006846 Bacteria 1417
71 Ga0075430_100616910 3300006846 Bacteria 895
72 Ga0075431_100559570 3300006847 Unclassified 1130
73 Ga0075434_101612533 3300006871 Unclassified 657
74 Ga0075434_101888812 3300006871 Bacteria 603
75 Ga0075429_100275457 3300006880 Bacteria 1473
76 Ga0097620_100419122 3300006931 Bacteria 1435
77 Ga0097620_100469567 3300006931 Bacteria 1354
78 Ga0097620_102921846 3300006931 Unclassified 523
79 Ga0075435_100342498 3300007076 Bacteria 1281
80 Ga0075435_100826369 3300007076 Unclassified 807
81 Ga0105240_11283076 3300009093 Bacteria 773
82 Ga0111539_10291211 3300009094 Bacteria 1900
83 Ga0111539_10636739 3300009094 Bacteria 1241
84 Ga0111539_10761465 3300009094 Bacteria 1127
85 Ga0111539_10805283 3300009094 Bacteria 1093
86 Ga0111539_11074240 3300009094 Bacteria 935
87 Ga0105245_10811957 3300009098 Bacteria 974
88 Ga0114129_10570982 3300009147 Unclassified 1469
89 Ga0114129_13191221 3300009147 Unclassified 533
90 Ga0105241_10291556 3300009174 Bacteria 1397
91 Ga0105241_10389637 3300009174 Bacteria 1219
92 Ga0105242_10925502 3300009176 Bacteria 874
93 Ga0105248_10511320 3300009177 Unclassified 1354
94 Ga0105248_11137135 3300009177 Unclassified 883
95 Ga0105238_10019844 3300009551 Bacteria 6842
96 Ga0105249_10982846 3300009553 Unclassified 913
97 Ga0105239_10772146 3300010375 Bacteria 1100
98 Ga0105239_11761824 3300010375 Bacteria 717
99 Ga0105246_10359068 3300011119 Bacteria 1196
100 Ga0157370_10602013 3300013104 Bacteria 1006
101 Ga0157374_11574010 3300013296 Unclassified 681
102 Ga0157375_11332579 3300013308 Bacteria 844
103 Ga0163163_10616230 3300014325 Bacteria 1149
104 Ga0157379_10406287 3300014968 Bacteria 1252
105 Ga0157376_11119004 3300014969 Unclassified 814
106 Ga0163161_11374308 3300017792 Bacteria 616
107 Ga0213872_10142851 3300021361 Bacteria 1049
108 Ga0213871_10051940 3300021441 Bacteria 1125
109 Ga0207656_10115265 3300025321 Unclassified 1246
110 Ga0207653_10145303 3300025885 Bacteria 870
111 Ga0207699_10348827 3300025906 Bacteria 1044
112 Ga0207699_10477786 3300025906 Unclassified 897
113 Ga0207643_10713992 3300025908 Bacteria 648
114 Ga0207654_10813585 3300025911 Unclassified 675
115 Ga0207654_10922780 3300025911 Unclassified 633
116 Ga0207695_10892585 3300025913 Bacteria 769
117 Ga0207693_10097273 3300025915 Bacteria 2308
118 Ga0207663_10270100 3300025916 Bacteria 1259
119 Ga0207662_10344466 3300025918 Bacteria 999
120 Ga0207681_11057497 3300025923 Unclassified 681
121 Ga0207686_11271623 3300025934 Bacteria 603
122 Ga0207670_10208905 3300025936 Bacteria 1487
123 Ga0207670_10394478 3300025936 Unclassified 1105
124 Ga0207670_10448092 3300025936 Bacteria 1040
125 Ga0207670_11473304 3300025936 Bacteria 578
126 Ga0207670_11787310 3300025936 Unclassified 523
127 Ga0207665_10024049 3300025939 Unclassified 4014
128 Ga0207665_10866214 3300025939 Unclassified 716
129 Ga0207661_10575046 3300025944 Bacteria 1033
130 Ga0207667_10884226 3300025949 Bacteria 886
131 Ga0207651_10548076 3300025960 Bacteria 1005
132 Ga0207712_10657685 3300025961 Unclassified 911
133 Ga0207703_11848412 3300026035 Bacteria 580
134 Ga0207639_10000053 3300026041 Bacteria 113162
135 Ga0207708_10019096 3300026075 Bacteria 5162
136 Ga0207708_10404781 3300026075 Bacteria 1129
137 Ga0207702_10001555 3300026078 Bacteria 22701
138 Ga0207702_10499948 3300026078 Unclassified 1185
139 Ga0207641_10656388 3300026088 Bacteria 1030
140 Ga0207676_10111706 3300026095 Bacteria 2288
141 Ga0207676_10466303 3300026095 Bacteria 1193
142 Ga0207676_10629190 3300026095 Bacteria 1033
143 Ga0207674_10193726 3300026116 Bacteria 1982
144 Ga0207674_10236449 3300026116 Bacteria 1774
145 Ga0207675_101128296 3300026118 Bacteria 804
146 Ga0207675_101988318 3300026118 Bacteria 599
147 Ga0207428_10340065 3300027907 Bacteria 1106
148 Ga0268266_10181572 3300028379 Unclassified 1916
149 Ga0268265_10624796 3300028380 Bacteria 1032
150 Ga0268265_10632810 3300028380 Bacteria 1026
151 Ga0265337_1036496 3300028556 Bacteria 1433
152 Ga0265326_10048500 3300028558 Bacteria 1204
153 Ga0265326_10155764 3300028558 Unclassified 653
154 Ga0265319_1005002 3300028563 Bacteria 6452
155 Ga0265319_1105833 3300028563 Unclassified 881
156 Ga0265318_10066240 3300028577 Bacteria 1342
157 Ga0265323_10076613 3300028653 Bacteria 1134
158 Ga0265322_10006436 3300028654 Bacteria 3458
159 Ga0265322_10076808 3300028654 Bacteria 947
160 Ga0307517_10418100 3300028786 Unclassified 704
161 Ga0265338_10002156 3300028800 Bacteria 30250
162 Ga0265338_10010260 3300028800 Bacteria 11027
163 Ga0265338_10171370 3300028800 Unclassified 1664
164 Ga0265338_10320761 3300028800 Bacteria 1121
165 Ga0265338_10353794 3300028800 Bacteria 1055
166 Ga0265338_10413323 3300028800 Unclassified 960
167 Ga0265324_10070485 3300029957 Bacteria 1191
168 Ga0265324_10072791 3300029957 Bacteria 1170
169 Ga0265330_10060165 3300031235 Bacteria 1654
170 Ga0265330_10157001 3300031235 Bacteria 966
171 Ga0265330_10184703 3300031235 Unclassified 883
172 Ga0265332_10027829 3300031238 Bacteria 2476
173 Ga0265328_10045945 3300031239 Bacteria 1606
174 Ga0265328_10417624 3300031239 Bacteria 527
175 Ga0265320_10049051 3300031240 Unclassified 2057
176 Ga0265320_10063746 3300031240 Bacteria 1752
177 Ga0265320_10085120 3300031240 Bacteria 1472
178 Ga0265320_10122641 3300031240 Bacteria 1184
179 Ga0265320_10175266 3300031240 Bacteria 962
180 Ga0265325_10039398 3300031241 Bacteria 2489
181 Ga0265325_10157641 3300031241 Bacteria 1070
182 Ga0265329_10067094 3300031242 Unclassified 1135
183 Ga0265329_10074062 3300031242 Bacteria 1077
184 Ga0265329_10078857 3300031242 Bacteria 1042
185 Ga0265339_10169323 3300031249 Bacteria 1094
186 Ga0265331_10005673 3300031250 Bacteria 7497
187 Ga0265331_10192531 3300031250 Bacteria 920
188 Ga0265331_10403444 3300031250 Unclassified 613
189 Ga0265327_10066988 3300031251 Bacteria 1810
190 Ga0265327_10156000 3300031251 Unclassified 1057
191 Ga0265327_10167634 3300031251 Bacteria 1011
192 Ga0265316_10018410 3300031344 Bacteria 6003
193 Ga0265316_10029451 3300031344 Bacteria 4513
194 Ga0265316_10036336 3300031344 Bacteria 3984
195 Ga0265316_10109089 3300031344 Bacteria 2098
196 Ga0265316_10158861 3300031344 Bacteria 1690
197 Ga0265316_10288940 3300031344 Bacteria 1196
198 Ga0265316_10289944 3300031344 Bacteria 1194
199 Ga0307408_100000011 3300031548 Bacteria 414737
200 Ga0265313_10123561 3300031595 Bacteria 1127
201 Ga0265313_10137691 3300031595 Bacteria 1052
202 Ga0307508_10348281 3300031616 Bacteria 1073
203 Ga0316575_10093823 3300031665 Bacteria 1217
204 Ga0265314_10056840 3300031711 Unclassified 2691
205 Ga0265314_10168731 3300031711 Unclassified 1323
206 Ga0265314_10274268 3300031711 Bacteria 957
207 Ga0265314_10407499 3300031711 Bacteria 733
208 Ga0265342_10037566 3300031712 Eukaryota 2952
209 Ga0265342_10045148 3300031712 Unclassified 2653
210 Ga0265342_10102899 3300031712 Bacteria 1624
211 Ga0307405_10691484 3300031731 Bacteria 843
212 Ga0307413_10497173 3300031824 Bacteria 978
213 Ga0307410_10000004 3300031852 Bacteria 120355
214 Ga0307406_10191220 3300031901 Bacteria 1498
215 Ga0307406_11361015 3300031901 Bacteria 621
216 Ga0307407_10033585 3300031903 Bacteria 2800
217 Ga0307409_100000405 3300031995 Bacteria 18407
218 Ga0307416_100000035 3300032002 Bacteria 144188
219 Ga0307411_10241472 3300032005 Bacteria 1414
220 Ga0307510_10300254 3300033180 Bacteria 1068
221 Ga0373944_0047125 3300035089 Bacteria 1349
222 Ga0373923_0132721 3300035111 Bacteria 1120
223 Ga0373923_0395396 3300035111 Bacteria 665
224 Ga0373936_0055734 3300035113 Bacteria 1605
225 Ga0373945_0055827 3300035116 Bacteria 1463
226 Ga0373954_0690494 3300035118 Bacteria 506
227 Ga0373954_0700780 3300035118 Bacteria 502
228 Ga0373956_0580286 3300035119 Unclassified 535
229 Ga0373943_0147657 3300035170 Bacteria 1271
230 Ga0373943_0219764 3300035170 Bacteria 1058
231 Ga0373946_0126535 3300035171 Bacteria 1171
232 Ga0373955_0716714 3300035172 Bacteria 614
233 Ga0373931_0207506 3300035691 Bacteria 1173
234 Ga0373935_0321760 3300035692 Bacteria 1097
235 Ga0373927_0057015 3300035695 Bacteria 2526
236 Ga0373927_0074640 3300035695 Bacteria 2195
237 Ga0373933_0234039 3300035724 Bacteria 1180
238 Ga0373947_0058067 3300035725 Bacteria 2344
239 Ga0373937_0297469 3300036401 Bacteria 1525
240 Ga0373937_0399753 3300036401 Bacteria 1303
241 Ga0373937_0472361 3300036401 Unclassified 1191
242 Ga0373937_0942488 3300036401 Unclassified 812
243 Ga0373925_0191816 3300037068 Bacteria 1621
244 Ga0373925_0612348 3300037068 Bacteria 897
245 Ga0395905_1502062 3300037471 Unclassified 578
246 Ga0436360_0167949 3300039438 Bacteria 2038
247 Ga0436360_1266494 3300039438 Bacteria 1554
248 Ga0436361_0156671 3300039447 Unclassified 973
249 Ga0436361_0415133 3300039447 Unclassified 2733
250 Ga0436363_0158878 3300039450 Bacteria 7240
251 Ga0436362_0983158 3300039453 Bacteria 1294
252 Ga0436362_1036089 3300039453 Bacteria 876
253 Ga0439441_093582 3300042001 Bacteria 667
254 Ga0439443_079985 3300042003 Bacteria 606
255 Ga0439445_0037162 3300042004 Bacteria 1284
256 Ga0450916_008609 3300042530 Unclassified 1244
257 Ga0451577_0881225 3300042876 Bacteria 806
258 Ga0453683_0242792 3300044673 Unclassified 1147
259 Ga0453684_0124928 3300044712 Unclassified 3099
260 Ga0453684_0534018 3300044712 Bacteria 1294
261 Ga0466957_0892219 3300044842 Unclassified 635
262 Ga0466959_0859784 3300045049 Unclassified 605
263 Ga0451576_0066180 3300045051 Bacteria 3762
264 Ga0451576_0299179 3300045051 Bacteria 1682
265 Ga0451576_0642926 3300045051 Bacteria 1114
266 Ga0466958_0882171 3300045836 Unclassified 583
267 Ga0495603_0185137 3300046455 Bacteria 1204
268 Ga0495629_0259921 3300046459 Bacteria 1193
269 Ga0495641_0054566 3300046461 Bacteria 1815
270 Ga0495641_0465322 3300046461 Unclassified 576
271 Ga0495651_0506821 3300046462 Unclassified 772
272 Ga0495580_0259454 3300046472 Bacteria 1188
273 Ga0495580_0336977 3300046472 Bacteria 1023
274 Ga0495582_0010730 3300046473 Bacteria 5039
275 Ga0495639_0016525 3300046475 Unclassified 3204
276 Ga0495662_0175342 3300046476 Bacteria 1056
277 Ga0495664_0138387 3300046477 Bacteria 1475
278 Ga0495618_0034394 3300046514 Bacteria 3177
279 Ga0495630_0434629 3300046517 Bacteria 1005
280 Ga0495666_0161862 3300046526 Bacteria 1037
281 Ga0495665_0083223 3300046531 Bacteria 1682
282 Ga0495640_0065694 3300046533 Unclassified 2448
283 Ga0495586_0194759 3300046535 Bacteria 1148
284 Ga0495586_0252393 3300046535 Bacteria 1006
285 Ga0495586_0380301 3300046535 Unclassified 812
286 Ga0495667_0501731 3300046559 Unclassified 760
287 Ga0495634_0001649 3300046642 Bacteria 19424
288 Ga0495588_0177924 3300046674 Bacteria 1124
289 Ga0495647_0007192 3300046681 Bacteria 3721
290 Ga0495658_0021998 3300046683 Bacteria 3367
291 Ga0495613_0097370 3300046689 Bacteria 2126
292 Ga0495624_0058526 3300046690 Bacteria 2419
293 Ga0495624_0782485 3300046690 Bacteria 564
294 Ga0495660_0391853 3300046810 Unclassified 610
295 Ga0495581_0018850 3300047315 Bacteria 4005
296 Ga0495604_0620535 3300047317 Unclassified 692
297 Ga0495636_0162781 3300047318 Unclassified 1006
298 Ga0495674_0469314 3300047319 Bacteria 1009
299 Ga0495676_0236153 3300047321 Bacteria 1253
300 Ga0495684_0146336 3300047471 Unclassified 1769
301 Ga0495593_0183205 3300047673 Bacteria 1054
302 Ga0495614_0064459 3300048089 Bacteria 1575
303 Ga0496106_0557686 3300048909 Bacteria 919
304 Ga0496110_0642275 3300048913 Bacteria 961
305 Ga0501290_010835 3300049513 Bacteria 1169
306 Ga0501034_0447067 3300049571 Bacteria 1210
307 Ga0501038_0111148 3300049574 Bacteria 2270
308 Ga0501039_0390268 3300049575 Bacteria 1093
309 Ga0501046_0026873 3300049580 Bacteria 4700
310 Ga0501046_0030546 3300049580 Bacteria 4372
311 Ga0501047_0007104 3300049581 Bacteria 10515
312 Ga0501068_0071926 3300049584 Bacteria 2111
313 Ga0501070_0300621 3300049586 Bacteria 1307
314 Ga0501070_0859938 3300049586 Bacteria 709
315 Ga0501071_1145613 3300049587 Bacteria 601
316 Ga0501072_0528013 3300049588 Bacteria 933
317 Ga0501073_0555819 3300049589 Unclassified 793
318 Ga0501074_0336519 3300049590 Bacteria 1071
319 Ga0501076_0458880 3300049592 Bacteria 1049
320 Ga0501198_043092 3300049649 Bacteria 786
321 Ga0501227_002179 3300049665 Bacteria 4330
322 Ga0501083_0241682 3300049744 Bacteria 1175
323 Ga0501035_0386616 3300049822 Bacteria 1166
324 Ga0501045_0794855 3300049824 Bacteria 697
325 nmdc:mga0k408_137360_c1 3300050493 Bacteria 1453
326 nmdc:mga05p37_611644_c1 3300050507 Unclassified 1228
327 nmdc:mga09592_204628_c1 3300050508 Unclassified 1710
328 nmdc:mga0qj67_153591_c1 3300050509 Bacteria 1868
329 nmdc:mga0qj67_886120_c1 3300050509 Unclassified 704
330 nmdc:mga06r32_87527_c1 3300050510 Unclassified 3040
331 nmdc:mga08y16_1417587_c1 3300050511 Bacteria 657
332 nmdc:mga08y16_382010_c1 3300050511 Unclassified 1444
333 nmdc:mga08y16_462492_c1 3300050511 Bacteria 1293
334 nmdc:mga0rr50_789176_c1 3300050513 Bacteria 810
335 Ga0495601_0294733 3300053077 Bacteria 1057
336 Ga0495612_0425260 3300053078 Bacteria 605
337 Ga0500597_347680 3300053120 Bacteria 578
338 Ga0500614_166163 3300053123 Bacteria 670
339 Ga0500636_0297839 3300053177 Bacteria 796
340 Ga0501084_1079500 3300054114 Bacteria 674
341 Ga0065707_10250346
342 rootH2_10244928
343 rootL2_10137951
344 Ga0070690_100271095
345 Ga0068869_100360063
346 Ga0070689_100233530
347 Ga0070689_100292094
348 Ga0070689_100319359
349 Ga0070689_100349710
350 Ga0070689_100945737
351 Ga0070689_101676940
352 Ga0070691_10305737
353 Ga0070687_100295646
354 Ga0070687_100544998
355 Ga0070673_100428990
356 Ga0070688_100184671
357 Ga0070688_100813927
358 Ga0070709_10385436
359 Ga0070714_100397424
360 Ga0070710_10275624
361 Ga0070710_10811277
362 Ga0070701_10239143
363 Ga0070701_10246759
364 Ga0070711_100363449
365 Ga0070705_100126339
366 Ga0070705_100602260
367 Ga0070700_100192076
368 Ga0070700_100358621
369 Ga0070694_100399452
370 Ga0070694_100962825
371 Ga0070708_100326039
372 Ga0070708_100408106
373 Ga0068867_101100939
374 Ga0070685_10214685
375 Ga0070685_10337473
376 Ga0070697_100140691
377 Ga0068853_100000062
378 Ga0070686_100139954
379 Ga0070695_100215308
380 Ga0070695_100368051
381 Ga0070693_100284167
382 Ga0070665_100122819
383 Ga0070704_100305509
384 Ga0070704_100388818
385 Ga0070704_100674610
386 Ga0068857_100221434
387 Ga0068854_100414700
388 Ga0068856_100000961
389 Ga0070702_100087273
390 Ga0068859_100419107
391 Ga0068859_100469548
392 Ga0068864_100196056
393 Ga0068864_100333109
394 Ga0068864_100563716
395 Ga0068861_100913127
396 Ga0068870_10283558
397 Ga0068863_100212191
398 Ga0068858_100458481
399 Ga0068858_101699212
400 Ga0068860_101391031
401 Ga0068862_100352912
402 Ga0068862_100570069
403 Ga0070716_100092220
404 Ga0070716_100382963
405 Ga0070712_100125820
406 Ga0070712_101109896
407 Ga0068871_101111338
408 Ga0075428_100574767
409 Ga0075428_101339629
410 Ga0075430_100266744
411 Ga0075430_100616910
412 Ga0075431_100559570
413 Ga0075434_101612533
414 Ga0075434_101888812
415 Ga0075429_100275457
416 Ga0097620_100419122
417 Ga0097620_100469567
418 Ga0097620_102921846
419 Ga0075435_100342498
420 Ga0075435_100826369
421 Ga0105240_11283076
422 Ga0111539_10291211
423 Ga0111539_10636739
424 Ga0111539_10761465
425 Ga0111539_10805283
426 Ga0111539_11074240
427 Ga0105245_10811957
428 Ga0114129_10570982
429 Ga0114129_13191221
430 Ga0105241_10291556
431 Ga0105241_10389637
432 Ga0105242_10925502
433 Ga0105248_10511320
434 Ga0105248_11137135
435 Ga0105238_10019844
436 Ga0105249_10982846
437 Ga0105239_10772146
438 Ga0105239_11761824
439 Ga0105246_10359068
440 Ga0157370_10602013
441 Ga0157374_11574010
442 Ga0157375_11332579
443 Ga0163163_10616230
444 Ga0157379_10406287
445 Ga0157376_11119004
446 Ga0163161_11374308
447 Ga0213872_10142851
448 Ga0213871_10051940
449 Ga0207656_10115265
450 Ga0207653_10145303
451 Ga0207699_10348827
452 Ga0207699_10477786
453 Ga0207643_10713992
454 Ga0207654_10813585
455 Ga0207654_10922780
456 Ga0207695_10892585
457 Ga0207693_10097273
458 Ga0207663_10270100
459 Ga0207662_10344466
460 Ga0207681_11057497
461 Ga0207686_11271623
462 Ga0207670_10208905
463 Ga0207670_10394478
464 Ga0207670_10448092
465 Ga0207670_11473304
466 Ga0207670_11787310
467 Ga0207665_10024049
468 Ga0207665_10866214
469 Ga0207661_10575046
470 Ga0207667_10884226
471 Ga0207651_10548076
472 Ga0207712_10657685
473 Ga0207703_11848412
474 Ga0207639_10000053
475 Ga0207708_10019096
476 Ga0207708_10404781
477 Ga0207702_10001555
478 Ga0207702_10499948
479 Ga0207641_10656388
480 Ga0207676_10111706
481 Ga0207676_10466303
482 Ga0207676_10629190
483 Ga0207674_10193726
484 Ga0207674_10236449
485 Ga0207675_101128296
486 Ga0207675_101988318
487 Ga0207428_10340065
488 Ga0268266_10181572
489 Ga0268265_10624796
490 Ga0268265_10632810
491 Ga0265337_1036496
492 Ga0265326_10048500
493 Ga0265326_10155764
494 Ga0265319_1005002
495 Ga0265319_1105833
496 Ga0265318_10066240
497 Ga0265323_10076613
498 Ga0265322_10006436
499 Ga0265322_10076808
500 Ga0307517_10418100
501 Ga0265338_10002156
502 Ga0265338_10010260
503 Ga0265338_10171370
504 Ga0265338_10320761
505 Ga0265338_10353794
506 Ga0265338_10413323
507 Ga0265324_10070485
508 Ga0265324_10072791
509 Ga0265330_10060165
510 Ga0265330_10157001
511 Ga0265330_10184703
512 Ga0265332_10027829
513 Ga0265328_10045945
514 Ga0265328_10417624
515 Ga0265320_10049051
516 Ga0265320_10063746
517 Ga0265320_10085120
518 Ga0265320_10122641
519 Ga0265320_10175266
520 Ga0265325_10039398
521 Ga0265325_10157641
522 Ga0265329_10067094
523 Ga0265329_10074062
524 Ga0265329_10078857
525 Ga0265339_10169323
526 Ga0265331_10005673
527 Ga0265331_10192531
528 Ga0265331_10403444
529 Ga0265327_10066988
530 Ga0265327_10156000
531 Ga0265327_10167634
532 Ga0265316_10018410
533 Ga0265316_10029451
534 Ga0265316_10036336
535 Ga0265316_10109089
536 Ga0265316_10158861
537 Ga0265316_10288940
538 Ga0265316_10289944
539 Ga0307408_100000011
540 Ga0265313_10123561
541 Ga0265313_10137691
542 Ga0307508_10348281
543 Ga0316575_10093823
544 Ga0265314_10056840
545 Ga0265314_10168731
546 Ga0265314_10274268
547 Ga0265314_10407499
548 Ga0265342_10037566
549 Ga0265342_10045148
550 Ga0265342_10102899
551 Ga0307405_10691484
552 Ga0307413_10497173
553 Ga0307410_10000004
554 Ga0307406_10191220
555 Ga0307406_11361015
556 Ga0307407_10033585
557 Ga0307409_100000405
558 Ga0307416_100000035
559 Ga0307411_10241472
560 Ga0307510_10300254
561 Ga0373944_0047125
562 Ga0373923_0132721
563 Ga0373923_0395396
564 Ga0373936_0055734
565 Ga0373945_0055827
566 Ga0373954_0690494
567 Ga0373954_0700780
568 Ga0373956_0580286
569 Ga0373943_0147657
570 Ga0373943_0219764
571 Ga0373946_0126535
572 Ga0373955_0716714
573 Ga0373931_0207506
574 Ga0373935_0321760
575 Ga0373927_0057015
576 Ga0373927_0074640
577 Ga0373933_0234039
578 Ga0373947_0058067
579 Ga0373937_0297469
580 Ga0373937_0399753
581 Ga0373937_0472361
582 Ga0373937_0942488
583 Ga0373925_0191816
584 Ga0373925_0612348
585 Ga0395905_1502062
586 Ga0436360_0167949
587 Ga0436360_1266494
588 Ga0436361_0156671
589 Ga0436361_0415133
590 Ga0436363_0158878
591 Ga0436362_0983158
592 Ga0436362_1036089
593 Ga0439441_093582
594 Ga0439443_079985
595 Ga0439445_0037162
596 Ga0450916_008609
597 Ga0451577_0881225
598 Ga0453683_0242792
599 Ga0453684_0124928
600 Ga0453684_0534018
601 Ga0466957_0892219
602 Ga0466959_0859784
603 Ga0451576_0066180
604 Ga0451576_0299179
605 Ga0451576_0642926
606 Ga0466958_0882171
607 Ga0495603_0185137
608 Ga0495629_0259921
609 Ga0495641_0054566
610 Ga0495641_0465322
611 Ga0495651_0506821
612 Ga0495580_0259454
613 Ga0495580_0336977
614 Ga0495582_0010730
615 Ga0495639_0016525
616 Ga0495662_0175342
617 Ga0495664_0138387
618 Ga0495618_0034394
619 Ga0495630_0434629
620 Ga0495666_0161862
621 Ga0495665_0083223
622 Ga0495640_0065694
623 Ga0495586_0194759
624 Ga0495586_0252393
625 Ga0495586_0380301
626 Ga0495667_0501731
627 Ga0495634_0001649
628 Ga0495588_0177924
629 Ga0495647_0007192
630 Ga0495658_0021998
631 Ga0495613_0097370
632 Ga0495624_0058526
633 Ga0495624_0782485
634 Ga0495660_0391853
635 Ga0495581_0018850
636 Ga0495604_0620535
637 Ga0495636_0162781
638 Ga0495674_0469314
639 Ga0495676_0236153
640 Ga0495684_0146336
641 Ga0495593_0183205
642 Ga0495614_0064459
643 Ga0496106_0557686
644 Ga0496110_0642275
645 Ga0501290_010835
646 Ga0501034_0447067
647 Ga0501038_0111148
648 Ga0501039_0390268
649 Ga0501046_0026873
650 Ga0501046_0030546
651 Ga0501047_0007104
652 Ga0501068_0071926
653 Ga0501070_0300621
654 Ga0501070_0859938
655 Ga0501071_1145613
656 Ga0501072_0528013
657 Ga0501073_0555819
658 Ga0501074_0336519
659 Ga0501076_0458880
660 Ga0501198_043092
661 Ga0501227_002179
662 Ga0501083_0241682
663 Ga0501035_0386616
664 Ga0501045_0794855
665 nmdc:mga0k408_137360_c1
666 nmdc:mga05p37_611644_c1
667 nmdc:mga09592_204628_c1
668 nmdc:mga0qj67_153591_c1
669 nmdc:mga0qj67_886120_c1
670 nmdc:mga06r32_87527_c1
671 nmdc:mga08y16_1417587_c1
672 nmdc:mga08y16_382010_c1
673 nmdc:mga08y16_462492_c1
674 nmdc:mga0rr50_789176_c1
675 Ga0495601_0294733
676 Ga0495612_0425260
677 Ga0500597_347680
678 Ga0500614_166163
679 Ga0500636_0297839
680 Ga0501084_1079500

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01710

HTH_Tnp_IS630

Transposase

2

121

0.78

Map