F414229
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 340 | 163 | 340 | 262 |
Family's Representative Sequence
| Representative Sequence | 3300005355|Ga0070671_100084290|Ga0070671_1000842903 |
| Length | 298 |
| Sequence | MDFPVAGSGPAVVSPCFQPESGLSKGYLKPLGEALGRSGDKRGIDMATLAQQPIAPAAGDERFFLRAAIVMTITIVAGFSFQYAMGRSTFGAPIRVHLHAFFFMGWVAIYLLQNIFVATGRMAFWIIPMVIMGCFVTIAMVRLGYVPFFFRPLQFLVFDPVTVFAFAALTVAAVKLRRRTEWHRRLHFCAMSLLLGPAFGRLLPMPLLQPWAWEAAFLPCILFPIAGVLADIRRNGQAHPAWRWGIATMLGTFVLIEAITYSPVGMSIYRVVTAGSPGETIEPLGFAPPPAGPVTGRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 5 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 6 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 127 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 128 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 129 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 130 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 131 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 132 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 134 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 135 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 136 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 137 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 138 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 139 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 140 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 141 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 142 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 143 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 144 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 145 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 146 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 147 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 148 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 149 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 150 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 151 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 152 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 153 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 154 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 158 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 161 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 162 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 163 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.29 |
| Nodule | 0 |
| Rhizoplane | 1.76 |
| Rhizosphere | 97.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.59 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000281 | 3300001979 | Bacteria | 21617 |
| 2 | JGI24740J21852_10024235 | 3300001979 | Bacteria | 2060 |
| 3 | JGI24740J21852_10037979 | 3300001979 | Bacteria | 1481 |
| 4 | JGI24739J22299_10000453 | 3300001989 | Bacteria | 14331 |
| 5 | JGI24739J22299_10042353 | 3300001989 | Bacteria | 1510 |
| 6 | JGI24737J22298_10000021 | 3300001990 | Bacteria | 45543 |
| 7 | JGI24735J21928_10020883 | 3300002067 | Bacteria | 2004 |
| 8 | JGI24738J21930_10000062 | 3300002075 | Bacteria | 22279 |
| 9 | JGI24035J26624_1000892 | 3300002126 | Bacteria | 2828 |
| 10 | rootH1_10145678 | 3300003323 | Bacteria | 3248 |
| 11 | Ga0065165_1042702 | 3300005262 | Bacteria | 1336 |
| 12 | Ga0070658_10183403 | 3300005327 | Bacteria | 1761 |
| 13 | Ga0070658_10252060 | 3300005327 | Bacteria | 1498 |
| 14 | Ga0070658_10396870 | 3300005327 | Bacteria | 1184 |
| 15 | Ga0070658_10456372 | 3300005327 | Bacteria | 1101 |
| 16 | Ga0070676_10014577 | 3300005328 | Bacteria | 4323 |
| 17 | Ga0070676_10039832 | 3300005328 | Bacteria | 2718 |
| 18 | Ga0070683_100194319 | 3300005329 | Bacteria | 1927 |
| 19 | Ga0070683_100227620 | 3300005329 | Bacteria | 1772 |
| 20 | Ga0070683_100308975 | 3300005329 | Unclassified | 1504 |
| 21 | Ga0070683_100458742 | 3300005329 | Bacteria | 1216 |
| 22 | Ga0070690_100036750 | 3300005330 | Bacteria | 3081 |
| 23 | Ga0070670_100001101 | 3300005331 | Bacteria | 21478 |
| 24 | Ga0070670_100063428 | 3300005331 | Bacteria | 3171 |
| 25 | Ga0070670_100185127 | 3300005331 | Bacteria | 1808 |
| 26 | Ga0070670_100322819 | 3300005331 | Bacteria | 1353 |
| 27 | Ga0070677_10030558 | 3300005333 | Bacteria | 2052 |
| 28 | Ga0070677_10031925 | 3300005333 | Bacteria | 2017 |
| 29 | Ga0068869_100012742 | 3300005334 | Bacteria | 5561 |
| 30 | Ga0070666_10009791 | 3300005335 | Bacteria | 5989 |
| 31 | Ga0070666_10035699 | 3300005335 | Bacteria | 3297 |
| 32 | Ga0068868_100000637 | 3300005338 | Bacteria | 23618 |
| 33 | Ga0068868_100442643 | 3300005338 | Unclassified | 1129 |
| 34 | Ga0070660_100002082 | 3300005339 | Bacteria | 13818 |
| 35 | Ga0070660_100002163 | 3300005339 | Bacteria | 13537 |
| 36 | Ga0070660_100074296 | 3300005339 | Bacteria | 2660 |
| 37 | Ga0070660_100117010 | 3300005339 | Bacteria | 2125 |
| 38 | Ga0070660_100191609 | 3300005339 | Bacteria | 1656 |
| 39 | Ga0070689_100009615 | 3300005340 | Bacteria | 6863 |
| 40 | Ga0070687_100185814 | 3300005343 | Bacteria | 1248 |
| 41 | Ga0070661_100017744 | 3300005344 | Bacteria | 5052 |
| 42 | Ga0070661_100329305 | 3300005344 | Bacteria | 1194 |
| 43 | Ga0070668_100000068 | 3300005347 | Bacteria | 64209 |
| 44 | Ga0070668_100039816 | 3300005347 | Bacteria | 3595 |
| 45 | Ga0070669_100000862 | 3300005353 | Bacteria | 22037 |
| 46 | Ga0070675_100043144 | 3300005354 | Bacteria | 3685 |
| 47 | Ga0070671_100001553 | 3300005355 | Bacteria | 17294 |
| 48 | Ga0070671_100017254 | 3300005355 | Bacteria | 5845 |
| 49 | Ga0070671_100028945 | 3300005355 | Bacteria | 4566 |
| 50 | Ga0070671_100084290 | 3300005355 | Bacteria | 2658 |
| 51 | Ga0070671_100107667 | 3300005355 | Bacteria | 2340 |
| 52 | Ga0070671_100281604 | 3300005355 | Bacteria | 1414 |
| 53 | Ga0070674_100040120 | 3300005356 | Bacteria | 3165 |
| 54 | Ga0070674_100072144 | 3300005356 | Bacteria | 2444 |
| 55 | Ga0070673_100000209 | 3300005364 | Bacteria | 29078 |
| 56 | Ga0070673_100048766 | 3300005364 | Bacteria | 3303 |
| 57 | Ga0070673_100080776 | 3300005364 | Bacteria | 2635 |
| 58 | Ga0070659_100004192 | 3300005366 | Bacteria | 10287 |
| 59 | Ga0070659_100022410 | 3300005366 | Bacteria | 4822 |
| 60 | Ga0070659_100096800 | 3300005366 | Bacteria | 2371 |
| 61 | Ga0070659_100111652 | 3300005366 | Bacteria | 2207 |
| 62 | Ga0070659_100301560 | 3300005366 | Bacteria | 1336 |
| 63 | Ga0070667_100004734 | 3300005367 | Bacteria | 11402 |
| 64 | Ga0070667_100021153 | 3300005367 | Bacteria | 5405 |
| 65 | Ga0070714_100106251 | 3300005435 | Unclassified | 2480 |
| 66 | Ga0070663_100011385 | 3300005455 | Bacteria | 5582 |
| 67 | Ga0070663_100018098 | 3300005455 | Bacteria | 4612 |
| 68 | Ga0070663_100024991 | 3300005455 | Bacteria | 4028 |
| 69 | Ga0070663_100050874 | 3300005455 | Bacteria | 2949 |
| 70 | Ga0070678_100001607 | 3300005456 | Bacteria | 12108 |
| 71 | Ga0070678_100469904 | 3300005456 | Bacteria | 1105 |
| 72 | Ga0070662_100001955 | 3300005457 | Bacteria | 12662 |
| 73 | Ga0070662_100016148 | 3300005457 | Bacteria | 5009 |
| 74 | Ga0070662_100071113 | 3300005457 | Bacteria | 2565 |
| 75 | Ga0070662_100248192 | 3300005457 | Bacteria | 1430 |
| 76 | Ga0070662_100263925 | 3300005457 | Bacteria | 1388 |
| 77 | Ga0070681_10517608 | 3300005458 | Unclassified | 1106 |
| 78 | Ga0068867_100000507 | 3300005459 | Bacteria | 25962 |
| 79 | Ga0070679_100063327 | 3300005530 | Bacteria | 3686 |
| 80 | Ga0070684_100632337 | 3300005535 | Bacteria | 996 |
| 81 | Ga0068853_100002778 | 3300005539 | Bacteria | 13234 |
| 82 | Ga0070672_100000770 | 3300005543 | Bacteria | 19069 |
| 83 | Ga0070672_100001213 | 3300005543 | Bacteria | 15800 |
| 84 | Ga0070672_100272792 | 3300005543 | Bacteria | 1429 |
| 85 | Ga0070686_100353851 | 3300005544 | Bacteria | 1104 |
| 86 | Ga0070665_100000590 | 3300005548 | Bacteria | 50563 |
| 87 | Ga0070665_100093528 | 3300005548 | Bacteria | 3011 |
| 88 | Ga0070665_100209710 | 3300005548 | Bacteria | 1949 |
| 89 | Ga0070665_100359240 | 3300005548 | Bacteria | 1462 |
| 90 | Ga0070665_100560972 | 3300005548 | Unclassified | 1154 |
| 91 | Ga0068855_100020105 | 3300005563 | Bacteria | 8018 |
| 92 | Ga0070664_100001534 | 3300005564 | Bacteria | 18443 |
| 93 | Ga0070664_100007940 | 3300005564 | Bacteria | 8571 |
| 94 | Ga0070664_100009081 | 3300005564 | Bacteria | 8067 |
| 95 | Ga0070664_100042961 | 3300005564 | Bacteria | 3813 |
| 96 | Ga0070664_100224632 | 3300005564 | Bacteria | 1681 |
| 97 | Ga0068857_100004161 | 3300005577 | Bacteria | 12189 |
| 98 | Ga0068857_100067881 | 3300005577 | Bacteria | 3174 |
| 99 | Ga0068857_100443771 | 3300005577 | Bacteria | 1212 |
| 100 | Ga0068854_100000614 | 3300005578 | Bacteria | 21116 |
| 101 | Ga0068854_100012490 | 3300005578 | Bacteria | 5565 |
| 102 | Ga0068856_100289728 | 3300005614 | Bacteria | 1654 |
| 103 | Ga0068852_100000804 | 3300005616 | Bacteria | 20664 |
| 104 | Ga0068852_100037699 | 3300005616 | Bacteria | 4055 |
| 105 | Ga0068852_100037820 | 3300005616 | Bacteria | 4050 |
| 106 | Ga0068852_100564920 | 3300005616 | Bacteria | 1139 |
| 107 | Ga0068859_100000478 | 3300005617 | Bacteria | 39430 |
| 108 | Ga0068859_100005823 | 3300005617 | Bacteria | 12519 |
| 109 | Ga0068864_100002459 | 3300005618 | Bacteria | 15294 |
| 110 | Ga0068864_100016819 | 3300005618 | Bacteria | 6094 |
| 111 | Ga0068866_10060546 | 3300005718 | Bacteria | 1963 |
| 112 | Ga0068861_100013120 | 3300005719 | Bacteria | 5794 |
| 113 | Ga0068851_10107581 | 3300005834 | Bacteria | 1486 |
| 114 | Ga0068863_100000001 | 3300005841 | Bacteria | 581116 |
| 115 | Ga0068863_100004878 | 3300005841 | Bacteria | 13216 |
| 116 | Ga0068858_100036350 | 3300005842 | Bacteria | 4567 |
| 117 | Ga0068860_100005690 | 3300005843 | Bacteria | 12583 |
| 118 | Ga0068862_100491458 | 3300005844 | Unclassified | 1163 |
| 119 | Ga0097621_100013235 | 3300006237 | Bacteria | 6141 |
| 120 | Ga0068871_100045904 | 3300006358 | Bacteria | 3518 |
| 121 | Ga0068865_100000240 | 3300006881 | Bacteria | 30384 |
| 122 | Ga0097620_100000478 | 3300006931 | Bacteria | 39430 |
| 123 | Ga0097620_100005823 | 3300006931 | Bacteria | 12519 |
| 124 | Ga0105245_10000300 | 3300009098 | Bacteria | 47446 |
| 125 | Ga0105241_10032081 | 3300009174 | Bacteria | 3935 |
| 126 | Ga0105248_10002741 | 3300009177 | Bacteria | 19562 |
| 127 | Ga0105248_10035266 | 3300009177 | Bacteria | 5596 |
| 128 | Ga0105248_10368975 | 3300009177 | Bacteria | 1616 |
| 129 | Ga0105237_10792731 | 3300009545 | Bacteria | 954 |
| 130 | Ga0105238_10043258 | 3300009551 | Bacteria | 4557 |
| 131 | Ga0105238_10218637 | 3300009551 | Bacteria | 1881 |
| 132 | Ga0105249_10009649 | 3300009553 | Bacteria | 8459 |
| 133 | Ga0105239_10088411 | 3300010375 | Bacteria | 3416 |
| 134 | Ga0105246_10007322 | 3300011119 | Bacteria | 6761 |
| 135 | Ga0157373_10006164 | 3300013100 | Bacteria | 8961 |
| 136 | Ga0157373_10054797 | 3300013100 | Bacteria | 2833 |
| 137 | Ga0157371_10000677 | 3300013102 | Bacteria | 40414 |
| 138 | Ga0157371_10049183 | 3300013102 | Bacteria | 2995 |
| 139 | Ga0157371_10089094 | 3300013102 | Bacteria | 2185 |
| 140 | Ga0157369_10176713 | 3300013105 | Bacteria | 2247 |
| 141 | Ga0157374_10021696 | 3300013296 | Bacteria | 5719 |
| 142 | Ga0157374_10218470 | 3300013296 | Bacteria | 1870 |
| 143 | Ga0157378_10002011 | 3300013297 | Bacteria | 18196 |
| 144 | Ga0163162_10022590 | 3300013306 | Bacteria | 6201 |
| 145 | Ga0157372_11149466 | 3300013307 | Bacteria | 898 |
| 146 | Ga0157375_10015287 | 3300013308 | Bacteria | 6869 |
| 147 | Ga0157375_10044689 | 3300013308 | Bacteria | 4306 |
| 148 | Ga0163163_10495699 | 3300014325 | Bacteria | 1283 |
| 149 | Ga0157377_10200890 | 3300014745 | Bacteria | 1265 |
| 150 | Ga0207673_1002252 | 3300025290 | Bacteria | 2182 |
| 151 | Ga0207697_10000026 | 3300025315 | Bacteria | 52498 |
| 152 | Ga0207656_10048618 | 3300025321 | Bacteria | 1827 |
| 153 | Ga0207656_10152493 | 3300025321 | Unclassified | 1095 |
| 154 | Ga0207682_10016246 | 3300025893 | Bacteria | 2901 |
| 155 | Ga0207688_10000055 | 3300025901 | Bacteria | 41067 |
| 156 | Ga0207688_10012513 | 3300025901 | Bacteria | 4618 |
| 157 | Ga0207680_10012693 | 3300025903 | Bacteria | 4300 |
| 158 | Ga0207680_10075005 | 3300025903 | Bacteria | 2108 |
| 159 | Ga0207680_10114278 | 3300025903 | Bacteria | 1756 |
| 160 | Ga0207647_10006361 | 3300025904 | Bacteria | 8588 |
| 161 | Ga0207647_10015895 | 3300025904 | Bacteria | 5148 |
| 162 | Ga0207645_10006444 | 3300025907 | Bacteria | 8421 |
| 163 | Ga0207645_10057857 | 3300025907 | Bacteria | 2475 |
| 164 | Ga0207705_10000002 | 3300025909 | Bacteria | 2046852 |
| 165 | Ga0207705_10050791 | 3300025909 | Bacteria | 2985 |
| 166 | Ga0207705_10059207 | 3300025909 | Bacteria | 2764 |
| 167 | Ga0207705_10101707 | 3300025909 | Bacteria | 2114 |
| 168 | Ga0207705_10142586 | 3300025909 | Bacteria | 1790 |
| 169 | Ga0207705_10226893 | 3300025909 | Bacteria | 1420 |
| 170 | Ga0207662_10204485 | 3300025918 | Bacteria | 1279 |
| 171 | Ga0207657_10001150 | 3300025919 | Bacteria | 28145 |
| 172 | Ga0207657_10003629 | 3300025919 | Bacteria | 16433 |
| 173 | Ga0207657_10019760 | 3300025919 | Bacteria | 6386 |
| 174 | Ga0207657_10020235 | 3300025919 | Bacteria | 6295 |
| 175 | Ga0207657_10044834 | 3300025919 | Unclassified | 3885 |
| 176 | Ga0207657_10074991 | 3300025919 | Bacteria | 2855 |
| 177 | Ga0207657_10217008 | 3300025919 | Bacteria | 1534 |
| 178 | Ga0207657_10225108 | 3300025919 | Bacteria | 1501 |
| 179 | Ga0207649_10032666 | 3300025920 | Bacteria | 3104 |
| 180 | Ga0207649_10083309 | 3300025920 | Bacteria | 2076 |
| 181 | Ga0207649_10140056 | 3300025920 | Bacteria | 1654 |
| 182 | Ga0207649_10252118 | 3300025920 | Bacteria | 1272 |
| 183 | Ga0207652_10030330 | 3300025921 | Bacteria | 4527 |
| 184 | Ga0207681_10001514 | 3300025923 | Bacteria | 14993 |
| 185 | Ga0207681_10039298 | 3300025923 | Bacteria | 3141 |
| 186 | Ga0207650_10100505 | 3300025925 | Bacteria | 2225 |
| 187 | Ga0207650_10101750 | 3300025925 | Bacteria | 2213 |
| 188 | Ga0207650_10209285 | 3300025925 | Bacteria | 1566 |
| 189 | Ga0207659_10017372 | 3300025926 | Bacteria | 4700 |
| 190 | Ga0207687_10005922 | 3300025927 | Bacteria | 8088 |
| 191 | Ga0207664_10125403 | 3300025929 | Bacteria | 2155 |
| 192 | Ga0207664_10128518 | 3300025929 | Bacteria | 2130 |
| 193 | Ga0207644_10000544 | 3300025931 | Bacteria | 24497 |
| 194 | Ga0207644_10005910 | 3300025931 | Bacteria | 7980 |
| 195 | Ga0207644_10034891 | 3300025931 | Bacteria | 3521 |
| 196 | Ga0207644_10048152 | 3300025931 | Bacteria | 3046 |
| 197 | Ga0207644_10224863 | 3300025931 | Bacteria | 1489 |
| 198 | Ga0207690_10002238 | 3300025932 | Bacteria | 11806 |
| 199 | Ga0207690_10015330 | 3300025932 | Bacteria | 4643 |
| 200 | Ga0207690_10137739 | 3300025932 | Bacteria | 1794 |
| 201 | Ga0207690_10156562 | 3300025932 | Bacteria | 1694 |
| 202 | Ga0207706_10000278 | 3300025933 | Bacteria | 55758 |
| 203 | Ga0207706_10009641 | 3300025933 | Bacteria | 8864 |
| 204 | Ga0207706_10010239 | 3300025933 | Bacteria | 8573 |
| 205 | Ga0207706_10011861 | 3300025933 | Bacteria | 7935 |
| 206 | Ga0207706_10090359 | 3300025933 | Bacteria | 2693 |
| 207 | Ga0207669_10039274 | 3300025937 | Bacteria | 2733 |
| 208 | Ga0207704_10004742 | 3300025938 | Bacteria | 6243 |
| 209 | Ga0207691_10000045 | 3300025940 | Bacteria | 99798 |
| 210 | Ga0207691_10000143 | 3300025940 | Bacteria | 65645 |
| 211 | Ga0207691_10479826 | 3300025940 | Bacteria | 1057 |
| 212 | Ga0207711_10003154 | 3300025941 | Bacteria | 14370 |
| 213 | Ga0207711_10149306 | 3300025941 | Bacteria | 2108 |
| 214 | Ga0207689_10000182 | 3300025942 | Bacteria | 54476 |
| 215 | Ga0207661_10018659 | 3300025944 | Bacteria | 5156 |
| 216 | Ga0207661_10148002 | 3300025944 | Bacteria | 2028 |
| 217 | Ga0207661_10319356 | 3300025944 | Bacteria | 1396 |
| 218 | Ga0207679_10005269 | 3300025945 | Bacteria | 8106 |
| 219 | Ga0207679_10007755 | 3300025945 | Bacteria | 6821 |
| 220 | Ga0207679_10008246 | 3300025945 | Bacteria | 6634 |
| 221 | Ga0207679_10021010 | 3300025945 | Bacteria | 4417 |
| 222 | Ga0207679_10042998 | 3300025945 | Bacteria | 3250 |
| 223 | Ga0207667_10007486 | 3300025949 | Bacteria | 13111 |
| 224 | Ga0207651_10002558 | 3300025960 | Bacteria | 8693 |
| 225 | Ga0207651_10022290 | 3300025960 | Bacteria | 3869 |
| 226 | Ga0207651_10049315 | 3300025960 | Bacteria | 2852 |
| 227 | Ga0207651_10059534 | 3300025960 | Bacteria | 2646 |
| 228 | Ga0207668_10000056 | 3300025972 | Bacteria | 93913 |
| 229 | Ga0207640_10000849 | 3300025981 | Bacteria | 17357 |
| 230 | Ga0207640_10022375 | 3300025981 | Bacteria | 3782 |
| 231 | Ga0207640_10104839 | 3300025981 | Bacteria | 1991 |
| 232 | Ga0207658_10030876 | 3300025986 | Bacteria | 3799 |
| 233 | Ga0207677_10003889 | 3300026023 | Bacteria | 7950 |
| 234 | Ga0207703_10012911 | 3300026035 | Bacteria | 6510 |
| 235 | Ga0207639_10002187 | 3300026041 | Bacteria | 13159 |
| 236 | Ga0207678_10000680 | 3300026067 | Bacteria | 31116 |
| 237 | Ga0207678_10004644 | 3300026067 | Bacteria | 12335 |
| 238 | Ga0207678_10007594 | 3300026067 | Bacteria | 9580 |
| 239 | Ga0207678_10030312 | 3300026067 | Bacteria | 4723 |
| 240 | Ga0207678_10050500 | 3300026067 | Bacteria | 3593 |
| 241 | Ga0207702_10119114 | 3300026078 | Bacteria | 2360 |
| 242 | Ga0207702_10138257 | 3300026078 | Unclassified | 2201 |
| 243 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 244 | Ga0207641_10004210 | 3300026088 | Bacteria | 12546 |
| 245 | Ga0207641_10606876 | 3300026088 | Unclassified | 1072 |
| 246 | Ga0207648_10000222 | 3300026089 | Bacteria | 61156 |
| 247 | Ga0207676_10000878 | 3300026095 | Bacteria | 23329 |
| 248 | Ga0207676_10016379 | 3300026095 | Bacteria | 5366 |
| 249 | Ga0207674_10006997 | 3300026116 | Bacteria | 13192 |
| 250 | Ga0207674_10016334 | 3300026116 | Bacteria | 8131 |
| 251 | Ga0207683_10004874 | 3300026121 | Bacteria | 11545 |
| 252 | Ga0207683_10350254 | 3300026121 | Bacteria | 1355 |
| 253 | Ga0207698_10004080 | 3300026142 | Bacteria | 8867 |
| 254 | Ga0207698_10160090 | 3300026142 | Bacteria | 1967 |
| 255 | Ga0268266_10001084 | 3300028379 | Bacteria | 34117 |
| 256 | Ga0268266_10124838 | 3300028379 | Bacteria | 2295 |
| 257 | Ga0268266_10245083 | 3300028379 | Bacteria | 1655 |
| 258 | Ga0268265_10620950 | 3300028380 | Unclassified | 1035 |
| 259 | Ga0268264_10033036 | 3300028381 | Bacteria | 4247 |
| 260 | Ga0268264_10157094 | 3300028381 | Bacteria | 2045 |
| 261 | Ga0307408_100042097 | 3300031548 | Bacteria | 3242 |
| 262 | Ga0307408_100060069 | 3300031548 | Bacteria | 2770 |
| 263 | Ga0307408_100082578 | 3300031548 | Bacteria | 2405 |
| 264 | Ga0307408_100140771 | 3300031548 | Bacteria | 1893 |
| 265 | Ga0307405_10022844 | 3300031731 | Bacteria | 3544 |
| 266 | Ga0307405_10024724 | 3300031731 | Bacteria | 3437 |
| 267 | Ga0307413_10104651 | 3300031824 | Bacteria | 1879 |
| 268 | Ga0307413_10143993 | 3300031824 | Bacteria | 1651 |
| 269 | Ga0307413_10643394 | 3300031824 | Unclassified | 873 |
| 270 | Ga0307410_10000253 | 3300031852 | Bacteria | 20310 |
| 271 | Ga0307410_10000490 | 3300031852 | Bacteria | 16059 |
| 272 | Ga0307410_10309404 | 3300031852 | Bacteria | 1249 |
| 273 | Ga0307410_10408939 | 3300031852 | Bacteria | 1098 |
| 274 | Ga0307406_10013538 | 3300031901 | Bacteria | 4674 |
| 275 | Ga0307406_10120902 | 3300031901 | Bacteria | 1821 |
| 276 | Ga0307407_10007214 | 3300031903 | Bacteria | 5017 |
| 277 | Ga0307407_10009659 | 3300031903 | Bacteria | 4506 |
| 278 | Ga0307407_10034822 | 3300031903 | Bacteria | 2761 |
| 279 | Ga0307412_10083817 | 3300031911 | Bacteria | 2211 |
| 280 | Ga0307412_10115524 | 3300031911 | Bacteria | 1924 |
| 281 | Ga0307409_100001697 | 3300031995 | Bacteria | 11090 |
| 282 | Ga0307409_100017331 | 3300031995 | Bacteria | 4796 |
| 283 | Ga0307409_100031098 | 3300031995 | Bacteria | 3847 |
| 284 | Ga0307409_100040682 | 3300031995 | Bacteria | 3463 |
| 285 | Ga0307409_100129182 | 3300031995 | Bacteria | 2155 |
| 286 | Ga0307409_100552236 | 3300031995 | Bacteria | 1131 |
| 287 | Ga0307416_100009461 | 3300032002 | Bacteria | 6381 |
| 288 | Ga0307416_100050621 | 3300032002 | Bacteria | 3312 |
| 289 | Ga0307416_100097993 | 3300032002 | Bacteria | 2541 |
| 290 | Ga0307416_100357816 | 3300032002 | Bacteria | 1480 |
| 291 | Ga0307414_10077070 | 3300032004 | Bacteria | 2425 |
| 292 | Ga0307411_10020488 | 3300032005 | Bacteria | 3847 |
| 293 | Ga0307415_100054756 | 3300032126 | Bacteria | 2725 |
| 294 | Ga0307415_100216669 | 3300032126 | Bacteria | 1532 |
| 295 | Ga0307510_10307662 | 3300033180 | Bacteria | 1045 |
| 296 | Ga0373959_0056103 | 3300034820 | Unclassified | 862 |
| 297 | Ga0373931_0034545 | 3300035691 | Bacteria | 2625 |
| 298 | Ga0373931_0293377 | 3300035691 | Unclassified | 1002 |
| 299 | Ga0373935_0302515 | 3300035692 | Bacteria | 1131 |
| 300 | Ga0395899_0057782 | 3300037312 | Bacteria | 2862 |
| 301 | Ga0395899_0058966 | 3300037312 | Bacteria | 2830 |
| 302 | Ga0395899_0196916 | 3300037312 | Bacteria | 1407 |
| 303 | Ga0395900_0021708 | 3300037418 | Bacteria | 6564 |
| 304 | Ga0395900_0033620 | 3300037418 | Bacteria | 5277 |
| 305 | Ga0395900_0240880 | 3300037418 | Bacteria | 1814 |
| 306 | Ga0395900_0270340 | 3300037418 | Bacteria | 1694 |
| 307 | Ga0395898_0016515 | 3300037466 | Bacteria | 7551 |
| 308 | Ga0395898_0346580 | 3300037466 | Bacteria | 1416 |
| 309 | Ga0395905_0010392 | 3300037471 | Bacteria | 9061 |
| 310 | Ga0395905_0015171 | 3300037471 | Bacteria | 7331 |
| 311 | Ga0395905_0043337 | 3300037471 | Bacteria | 4221 |
| 312 | Ga0395905_0082325 | 3300037471 | Bacteria | 3016 |
| 313 | Ga0395905_0107183 | 3300037471 | Bacteria | 2623 |
| 314 | Ga0395905_0153412 | 3300037471 | Bacteria | 2167 |
| 315 | Ga0395905_0229542 | 3300037471 | Unclassified | 1736 |
| 316 | Ga0395901_0008531 | 3300038443 | Bacteria | 10352 |
| 317 | Ga0395901_0013211 | 3300038443 | Bacteria | 8384 |
| 318 | Ga0395901_0015810 | 3300038443 | Bacteria | 7690 |
| 319 | Ga0395901_0090386 | 3300038443 | Bacteria | 3205 |
| 320 | Ga0395901_0097246 | 3300038443 | Bacteria | 3086 |
| 321 | Ga0439432_020938 | 3300042006 | Bacteria | 2171 |
| 322 | Ga0450920_032625 | 3300042122 | Unclassified | 1028 |
| 323 | Ga0450908_007214 | 3300042184 | Bacteria | 2099 |
| 324 | Ga0466966_0017406 | 3300044684 | Unclassified | 4749 |
| 325 | Ga0466961_0220949 | 3300044693 | Unclassified | 1168 |
| 326 | Ga0466958_0117727 | 3300045836 | Bacteria | 1661 |
| 327 | Ga0466967_0038074 | 3300045976 | Bacteria | 4122 |
| 328 | Ga0466967_0113250 | 3300045976 | Bacteria | 2495 |
| 329 | Ga0466967_0143414 | 3300045976 | Bacteria | 2226 |
| 330 | Ga0495668_0023174 | 3300046616 | Bacteria | 3543 |
| 331 | Ga0495600_0260059 | 3300046809 | Unclassified | 1103 |
| 332 | Ga0496108_0519702 | 3300048911 | Unclassified | 1039 |
| 333 | Ga0496110_0017288 | 3300048913 | Bacteria | 6033 |
| 334 | Ga0496110_0156482 | 3300048913 | Bacteria | 2064 |
| 335 | Ga0496112_0087653 | 3300048915 | Bacteria | 3080 |
| 336 | Ga0496114_0038765 | 3300048917 | Bacteria | 3942 |
| 337 | Ga0496115_0006838 | 3300048918 | Bacteria | 8371 |
| 338 | Ga0501230_048482 | 3300049667 | Bacteria | 839 |
| 339 | Ga0501283_005351 | 3300049779 | Bacteria | 1763 |
| 340 | Ga0590071_009828 | 3300059421 | Bacteria | 2243 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005331 | Ga0070670_100322819 | Ga0070670_1003228191 | 238 |
| 2 | 3300035691 | Ga0373931_0293377 | Ga0373931_0293377_14_733 | 239 |
| 3 | 3300037312 | Ga0395899_0196916 | Ga0395899_0196916_661_1380 | 239 |
| 4 | 3300031852 | Ga0307410_10000253 | Ga0307410_1000025318 | 240 |
| 5 | 3300031995 | Ga0307409_100001697 | Ga0307409_1000016972 | 240 |
| 6 | 3300032002 | Ga0307416_100357816 | Ga0307416_1003578161 | 240 |
| 7 | 3300046616 | Ga0495668_0023174 | Ga0495668_0023174_1988_2752 | 243 |
| 8 | 3300035692 | Ga0373935_0302515 | Ga0373935_0302515_184_966 | 244 |
| 9 | 3300046809 | Ga0495600_0260059 | Ga0495600_0260059_288_1070 | 244 |
| 10 | 3300031995 | Ga0307409_100552236 | Ga0307409_1005522361 | 247 |
| 11 | 3300042122 | Ga0450920_032625 | Ga0450920_032625_90_884 | 247 |
| 12 | 3300005327 | Ga0070658_10252060 | Ga0070658_102520603 | 248 |
| 13 | 3300005329 | Ga0070683_100227620 | Ga0070683_1002276202 | 248 |
| 14 | 3300005455 | Ga0070663_100018098 | Ga0070663_1000180985 | 248 |
| 15 | 3300005535 | Ga0070684_100632337 | Ga0070684_1006323371 | 248 |
| 16 | 3300025909 | Ga0207705_10101707 | Ga0207705_101017072 | 248 |
| 17 | 3300025920 | Ga0207649_10252118 | Ga0207649_102521181 | 248 |
| 18 | 3300025944 | Ga0207661_10018659 | Ga0207661_100186594 | 248 |
| 19 | 3300026067 | Ga0207678_10004644 | Ga0207678_100046444 | 248 |
| 20 | 3300037312 | Ga0395899_0057782 | Ga0395899_0057782_1614_2405 | 248 |
| 21 | 3300037418 | Ga0395900_0240880 | Ga0395900_0240880_543_1334 | 248 |
| 22 | 3300037466 | Ga0395898_0016515 | Ga0395898_0016515_4727_5518 | 248 |
| 23 | 3300037471 | Ga0395905_0043337 | Ga0395905_0043337_1397_2188 | 248 |
| 24 | 3300037471 | Ga0395905_0229542 | Ga0395905_0229542_37_828 | 248 |
| 25 | 3300038443 | Ga0395901_0013211 | Ga0395901_0013211_6584_7375 | 248 |
| 26 | 3300032005 | Ga0307411_10020488 | Ga0307411_100204884 | 249 |
| 27 | 3300005458 | Ga0070681_10517608 | Ga0070681_105176082 | 250 |
| 28 | 3300005530 | Ga0070679_100063327 | Ga0070679_1000633273 | 250 |
| 29 | 3300025921 | Ga0207652_10030330 | Ga0207652_100303303 | 250 |
| 30 | 3300031824 | Ga0307413_10143993 | Ga0307413_101439931 | 250 |
| 31 | 3300001979 | JGI24740J21852_10024235 | JGI24740J21852_100242352 | 253 |
| 32 | 3300001989 | JGI24739J22299_10042353 | JGI24739J22299_100423531 | 253 |
| 33 | 3300005327 | Ga0070658_10183403 | Ga0070658_101834032 | 253 |
| 34 | 3300005329 | Ga0070683_100194319 | Ga0070683_1001943192 | 253 |
| 35 | 3300005331 | Ga0070670_100063428 | Ga0070670_1000634283 | 253 |
| 36 | 3300005331 | Ga0070670_100185127 | Ga0070670_1001851272 | 253 |
| 37 | 3300005335 | Ga0070666_10035699 | Ga0070666_100356991 | 253 |
| 38 | 3300005338 | Ga0068868_100442643 | Ga0068868_1004426431 | 253 |
| 39 | 3300005339 | Ga0070660_100117010 | Ga0070660_1001170102 | 253 |
| 40 | 3300005347 | Ga0070668_100000068 | Ga0070668_10000006849 | 253 |
| 41 | 3300005355 | Ga0070671_100001553 | Ga0070671_10000155312 | 253 |
| 42 | 3300005355 | Ga0070671_100107667 | Ga0070671_1001076672 | 253 |
| 43 | 3300005364 | Ga0070673_100080776 | Ga0070673_1000807763 | 253 |
| 44 | 3300005366 | Ga0070659_100096800 | Ga0070659_1000968003 | 253 |
| 45 | 3300005367 | Ga0070667_100021153 | Ga0070667_1000211532 | 253 |
| 46 | 3300005544 | Ga0070686_100353851 | Ga0070686_1003538512 | 253 |
| 47 | 3300005548 | Ga0070665_100093528 | Ga0070665_1000935283 | 253 |
| 48 | 3300005548 | Ga0070665_100560972 | Ga0070665_1005609722 | 253 |
| 49 | 3300005577 | Ga0068857_100443771 | Ga0068857_1004437712 | 253 |
| 50 | 3300005616 | Ga0068852_100037699 | Ga0068852_1000376992 | 253 |
| 51 | 3300005617 | Ga0068859_100005823 | Ga0068859_10000582310 | 253 |
| 52 | 3300005841 | Ga0068863_100000001 | Ga0068863_100000001210 | 253 |
| 53 | 3300005844 | Ga0068862_100491458 | Ga0068862_1004914581 | 253 |
| 54 | 3300006931 | Ga0097620_100005823 | Ga0097620_10000582310 | 253 |
| 55 | 3300009553 | Ga0105249_10009649 | Ga0105249_100096499 | 253 |
| 56 | 3300013102 | Ga0157371_10049183 | Ga0157371_100491832 | 253 |
| 57 | 3300013307 | Ga0157372_11149466 | Ga0157372_111494661 | 253 |
| 58 | 3300025903 | Ga0207680_10114278 | Ga0207680_101142782 | 253 |
| 59 | 3300025904 | Ga0207647_10015895 | Ga0207647_100158952 | 253 |
| 60 | 3300025909 | Ga0207705_10142586 | Ga0207705_101425862 | 253 |
| 61 | 3300025919 | Ga0207657_10019760 | Ga0207657_100197607 | 253 |
| 62 | 3300025923 | Ga0207681_10039298 | Ga0207681_100392981 | 253 |
| 63 | 3300025925 | Ga0207650_10209285 | Ga0207650_102092852 | 253 |
| 64 | 3300025931 | Ga0207644_10000544 | Ga0207644_1000054417 | 253 |
| 65 | 3300025931 | Ga0207644_10048152 | Ga0207644_100481523 | 253 |
| 66 | 3300025932 | Ga0207690_10137739 | Ga0207690_101377391 | 253 |
| 67 | 3300025933 | Ga0207706_10010239 | Ga0207706_1001023911 | 253 |
| 68 | 3300025944 | Ga0207661_10148002 | Ga0207661_101480022 | 253 |
| 69 | 3300025960 | Ga0207651_10022290 | Ga0207651_100222904 | 253 |
| 70 | 3300025972 | Ga0207668_10000056 | Ga0207668_1000005696 | 253 |
| 71 | 3300025981 | Ga0207640_10104839 | Ga0207640_101048392 | 253 |
| 72 | 3300026067 | Ga0207678_10000680 | Ga0207678_1000068022 | 253 |
| 73 | 3300026088 | Ga0207641_10000001 | Ga0207641_10000001547 | 253 |
| 74 | 3300026116 | Ga0207674_10016334 | Ga0207674_100163342 | 253 |
| 75 | 3300026142 | Ga0207698_10160090 | Ga0207698_101600902 | 253 |
| 76 | 3300028379 | Ga0268266_10124838 | Ga0268266_101248382 | 253 |
| 77 | 3300028379 | Ga0268266_10245083 | Ga0268266_102450832 | 253 |
| 78 | 3300028380 | Ga0268265_10620950 | Ga0268265_106209501 | 253 |
| 79 | 3300028381 | Ga0268264_10157094 | Ga0268264_101570942 | 253 |
| 80 | 3300037471 | Ga0395905_0107183 | Ga0395905_0107183_1064_1900 | 253 |
| 81 | 3300005355 | Ga0070671_100084290 | Ga0070671_1000842903 | 254 |
| 82 | 3300005457 | Ga0070662_100263925 | Ga0070662_1002639252 | 254 |
| 83 | 3300009177 | Ga0105248_10368975 | Ga0105248_103689752 | 254 |
| 84 | 3300025893 | Ga0207682_10016246 | Ga0207682_100162462 | 254 |
| 85 | 3300048917 | Ga0496114_0038765 | Ga0496114_0038765_373_1140 | 254 |
| 86 | 3300013102 | Ga0157371_10089094 | Ga0157371_100890942 | 256 |
| 87 | 3300031852 | Ga0307410_10408939 | Ga0307410_104089392 | 256 |
| 88 | 3300032126 | Ga0307415_100216669 | Ga0307415_1002166692 | 256 |
| 89 | 3300033180 | Ga0307510_10307662 | Ga0307510_103076621 | 256 |
| 90 | 3300005355 | Ga0070671_100281604 | Ga0070671_1002816042 | 257 |
| 91 | 3300025931 | Ga0207644_10224863 | Ga0207644_102248631 | 257 |
| 92 | 3300037312 | Ga0395899_0058966 | Ga0395899_0058966_451_1227 | 257 |
| 93 | 3300037418 | Ga0395900_0021708 | Ga0395900_0021708_1383_2159 | 257 |
| 94 | 3300037471 | Ga0395905_0015171 | Ga0395905_0015171_4798_5574 | 257 |
| 95 | 3300038443 | Ga0395901_0008531 | Ga0395901_0008531_6007_6783 | 257 |
| 96 | 3300031548 | Ga0307408_100042097 | Ga0307408_1000420973 | 258 |
| 97 | 3300031731 | Ga0307405_10022844 | Ga0307405_100228442 | 258 |
| 98 | 3300031903 | Ga0307407_10009659 | Ga0307407_100096594 | 258 |
| 99 | 3300031995 | Ga0307409_100031098 | Ga0307409_1000310982 | 258 |
| 100 | 3300032004 | Ga0307414_10077070 | Ga0307414_100770702 | 258 |
| 101 | 3300042184 | Ga0450908_007214 | Ga0450908_007214_634_1413 | 259 |
| 102 | 3300005262 | Ga0065165_1042702 | Ga0065165_10427022 | 261 |
| 103 | 3300005329 | Ga0070683_100458742 | Ga0070683_1004587422 | 262 |
| 104 | 3300005339 | Ga0070660_100074296 | Ga0070660_1000742962 | 262 |
| 105 | 3300005366 | Ga0070659_100004192 | Ga0070659_1000041922 | 262 |
| 106 | 3300005455 | Ga0070663_100024991 | Ga0070663_1000249913 | 262 |
| 107 | 3300005564 | Ga0070664_100224632 | Ga0070664_1002246322 | 262 |
| 108 | 3300005616 | Ga0068852_100037820 | Ga0068852_1000378205 | 262 |
| 109 | 3300005834 | Ga0068851_10107581 | Ga0068851_101075812 | 262 |
| 110 | 3300013105 | Ga0157369_10176713 | Ga0157369_101767133 | 262 |
| 111 | 3300013296 | Ga0157374_10218470 | Ga0157374_102184702 | 262 |
| 112 | 3300025321 | Ga0207656_10048618 | Ga0207656_100486181 | 262 |
| 113 | 3300025909 | Ga0207705_10000002 | Ga0207705_10000002708 | 262 |
| 114 | 3300025919 | Ga0207657_10001150 | Ga0207657_100011501 | 262 |
| 115 | 3300025919 | Ga0207657_10020235 | Ga0207657_100202357 | 262 |
| 116 | 3300025932 | Ga0207690_10002238 | Ga0207690_100022385 | 262 |
| 117 | 3300026067 | Ga0207678_10030312 | Ga0207678_100303127 | 262 |
| 118 | 3300038443 | Ga0395901_0097246 | Ga0395901_0097246_992_1786 | 262 |
| 119 | 3300005327 | Ga0070658_10456372 | Ga0070658_104563721 | 263 |
| 120 | 3300005339 | Ga0070660_100002163 | Ga0070660_10000216315 | 263 |
| 121 | 3300005355 | Ga0070671_100017254 | Ga0070671_1000172543 | 263 |
| 122 | 3300005435 | Ga0070714_100106251 | Ga0070714_1001062512 | 263 |
| 123 | 3300005564 | Ga0070664_100042961 | Ga0070664_1000429613 | 263 |
| 124 | 3300005616 | Ga0068852_100564920 | Ga0068852_1005649202 | 263 |
| 125 | 3300013296 | Ga0157374_10021696 | Ga0157374_100216962 | 263 |
| 126 | 3300025909 | Ga0207705_10059207 | Ga0207705_100592072 | 263 |
| 127 | 3300025919 | Ga0207657_10225108 | Ga0207657_102251082 | 263 |
| 128 | 3300025920 | Ga0207649_10083309 | Ga0207649_100833092 | 263 |
| 129 | 3300025925 | Ga0207650_10100505 | Ga0207650_101005052 | 263 |
| 130 | 3300025929 | Ga0207664_10125403 | Ga0207664_101254032 | 263 |
| 131 | 3300025931 | Ga0207644_10034891 | Ga0207644_100348912 | 263 |
| 132 | 3300025945 | Ga0207679_10042998 | Ga0207679_100429982 | 263 |
| 133 | 3300031548 | Ga0307408_100060069 | Ga0307408_1000600692 | 263 |
| 134 | 3300031824 | Ga0307413_10643394 | Ga0307413_106433941 | 263 |
| 135 | 3300031852 | Ga0307410_10000490 | Ga0307410_100004904 | 263 |
| 136 | 3300031903 | Ga0307407_10007214 | Ga0307407_100072145 | 263 |
| 137 | 3300031911 | Ga0307412_10115524 | Ga0307412_101155242 | 263 |
| 138 | 3300032002 | Ga0307416_100097993 | Ga0307416_1000979932 | 263 |
| 139 | 3300032126 | Ga0307415_100054756 | Ga0307415_1000547563 | 263 |
| 140 | 3300038443 | Ga0395901_0090386 | Ga0395901_0090386_122_919 | 263 |
| 141 | 3300044693 | Ga0466961_0220949 | Ga0466961_0220949_255_1046 | 263 |
| 142 | 3300045976 | Ga0466967_0143414 | Ga0466967_0143414_1005_1796 | 263 |
| 143 | 3300048913 | Ga0496110_0156482 | Ga0496110_0156482_16_810 | 263 |
| 144 | 3300048915 | Ga0496112_0087653 | Ga0496112_0087653_392_1186 | 263 |
| 145 | 3300048918 | Ga0496115_0006838 | Ga0496115_0006838_7398_8192 | 263 |
| 146 | 3300001979 | JGI24740J21852_10037979 | JGI24740J21852_100379791 | 264 |
| 147 | 3300001989 | JGI24739J22299_10000453 | JGI24739J22299_1000045312 | 264 |
| 148 | 3300002075 | JGI24738J21930_10000062 | JGI24738J21930_1000006215 | 264 |
| 149 | 3300003323 | rootH1_10145678 | rootH1_101456784 | 264 |
| 150 | 3300005327 | Ga0070658_10396870 | Ga0070658_103968702 | 264 |
| 151 | 3300005328 | Ga0070676_10039832 | Ga0070676_100398323 | 264 |
| 152 | 3300005329 | Ga0070683_100308975 | Ga0070683_1003089752 | 264 |
| 153 | 3300005330 | Ga0070690_100036750 | Ga0070690_1000367505 | 264 |
| 154 | 3300005331 | Ga0070670_100001101 | Ga0070670_1000011018 | 264 |
| 155 | 3300005333 | Ga0070677_10030558 | Ga0070677_100305582 | 264 |
| 156 | 3300005333 | Ga0070677_10031925 | Ga0070677_100319252 | 264 |
| 157 | 3300005334 | Ga0068869_100012742 | Ga0068869_1000127425 | 264 |
| 158 | 3300005335 | Ga0070666_10009791 | Ga0070666_100097915 | 264 |
| 159 | 3300005339 | Ga0070660_100002082 | Ga0070660_1000020827 | 264 |
| 160 | 3300005339 | Ga0070660_100191609 | Ga0070660_1001916092 | 264 |
| 161 | 3300005340 | Ga0070689_100009615 | Ga0070689_10000961510 | 264 |
| 162 | 3300005343 | Ga0070687_100185814 | Ga0070687_1001858142 | 264 |
| 163 | 3300005344 | Ga0070661_100017744 | Ga0070661_1000177442 | 264 |
| 164 | 3300005344 | Ga0070661_100329305 | Ga0070661_1003293051 | 264 |
| 165 | 3300005347 | Ga0070668_100039816 | Ga0070668_1000398164 | 264 |
| 166 | 3300005353 | Ga0070669_100000862 | Ga0070669_10000086211 | 264 |
| 167 | 3300005354 | Ga0070675_100043144 | Ga0070675_1000431445 | 264 |
| 168 | 3300005356 | Ga0070674_100040120 | Ga0070674_1000401203 | 264 |
| 169 | 3300005356 | Ga0070674_100072144 | Ga0070674_1000721442 | 264 |
| 170 | 3300005364 | Ga0070673_100048766 | Ga0070673_1000487663 | 264 |
| 171 | 3300005366 | Ga0070659_100022410 | Ga0070659_1000224102 | 264 |
| 172 | 3300005366 | Ga0070659_100111652 | Ga0070659_1001116522 | 264 |
| 173 | 3300005366 | Ga0070659_100301560 | Ga0070659_1003015601 | 264 |
| 174 | 3300005367 | Ga0070667_100004734 | Ga0070667_10000473412 | 264 |
| 175 | 3300005455 | Ga0070663_100011385 | Ga0070663_1000113852 | 264 |
| 176 | 3300005455 | Ga0070663_100050874 | Ga0070663_1000508742 | 264 |
| 177 | 3300005456 | Ga0070678_100001607 | Ga0070678_1000016074 | 264 |
| 178 | 3300005456 | Ga0070678_100469904 | Ga0070678_1004699041 | 264 |
| 179 | 3300005457 | Ga0070662_100001955 | Ga0070662_10000195510 | 264 |
| 180 | 3300005457 | Ga0070662_100016148 | Ga0070662_1000161483 | 264 |
| 181 | 3300005457 | Ga0070662_100071113 | Ga0070662_1000711132 | 264 |
| 182 | 3300005457 | Ga0070662_100248192 | Ga0070662_1002481922 | 264 |
| 183 | 3300005543 | Ga0070672_100000770 | Ga0070672_10000077012 | 264 |
| 184 | 3300005543 | Ga0070672_100001213 | Ga0070672_1000012137 | 264 |
| 185 | 3300005543 | Ga0070672_100272792 | Ga0070672_1002727922 | 264 |
| 186 | 3300005548 | Ga0070665_100000590 | Ga0070665_10000059047 | 264 |
| 187 | 3300005548 | Ga0070665_100209710 | Ga0070665_1002097102 | 264 |
| 188 | 3300005548 | Ga0070665_100359240 | Ga0070665_1003592402 | 264 |
| 189 | 3300005563 | Ga0068855_100020105 | Ga0068855_1000201054 | 264 |
| 190 | 3300005564 | Ga0070664_100001534 | Ga0070664_1000015347 | 264 |
| 191 | 3300005564 | Ga0070664_100007940 | Ga0070664_1000079407 | 264 |
| 192 | 3300005564 | Ga0070664_100009081 | Ga0070664_10000908110 | 264 |
| 193 | 3300005577 | Ga0068857_100004161 | Ga0068857_10000416110 | 264 |
| 194 | 3300005577 | Ga0068857_100067881 | Ga0068857_1000678812 | 264 |
| 195 | 3300005578 | Ga0068854_100000614 | Ga0068854_10000061415 | 264 |
| 196 | 3300005578 | Ga0068854_100012490 | Ga0068854_1000124904 | 264 |
| 197 | 3300005614 | Ga0068856_100289728 | Ga0068856_1002897282 | 264 |
| 198 | 3300005616 | Ga0068852_100000804 | Ga0068852_10000080416 | 264 |
| 199 | 3300005617 | Ga0068859_100000478 | Ga0068859_10000047840 | 264 |
| 200 | 3300005618 | Ga0068864_100002459 | Ga0068864_10000245912 | 264 |
| 201 | 3300005618 | Ga0068864_100016819 | Ga0068864_1000168193 | 264 |
| 202 | 3300005719 | Ga0068861_100013120 | Ga0068861_1000131204 | 264 |
| 203 | 3300005841 | Ga0068863_100004878 | Ga0068863_10000487811 | 264 |
| 204 | 3300005842 | Ga0068858_100036350 | Ga0068858_1000363505 | 264 |
| 205 | 3300005843 | Ga0068860_100005690 | Ga0068860_10000569015 | 264 |
| 206 | 3300006237 | Ga0097621_100013235 | Ga0097621_10001323510 | 264 |
| 207 | 3300006358 | Ga0068871_100045904 | Ga0068871_1000459045 | 264 |
| 208 | 3300006881 | Ga0068865_100000240 | Ga0068865_10000024023 | 264 |
| 209 | 3300006931 | Ga0097620_100000478 | Ga0097620_10000047840 | 264 |
| 210 | 3300009177 | Ga0105248_10035266 | Ga0105248_100352665 | 264 |
| 211 | 3300009551 | Ga0105238_10218637 | Ga0105238_102186371 | 264 |
| 212 | 3300013100 | Ga0157373_10054797 | Ga0157373_100547973 | 264 |
| 213 | 3300013308 | Ga0157375_10015287 | Ga0157375_100152874 | 264 |
| 214 | 3300014325 | Ga0163163_10495699 | Ga0163163_104956991 | 264 |
| 215 | 3300025315 | Ga0207697_10000026 | Ga0207697_1000002640 | 264 |
| 216 | 3300025321 | Ga0207656_10152493 | Ga0207656_101524932 | 264 |
| 217 | 3300025901 | Ga0207688_10000055 | Ga0207688_100000558 | 264 |
| 218 | 3300025901 | Ga0207688_10012513 | Ga0207688_100125137 | 264 |
| 219 | 3300025903 | Ga0207680_10012693 | Ga0207680_100126933 | 264 |
| 220 | 3300025903 | Ga0207680_10075005 | Ga0207680_100750054 | 264 |
| 221 | 3300025904 | Ga0207647_10006361 | Ga0207647_100063615 | 264 |
| 222 | 3300025907 | Ga0207645_10006444 | Ga0207645_1000644410 | 264 |
| 223 | 3300025907 | Ga0207645_10057857 | Ga0207645_100578573 | 264 |
| 224 | 3300025909 | Ga0207705_10050791 | Ga0207705_100507911 | 264 |
| 225 | 3300025909 | Ga0207705_10226893 | Ga0207705_102268932 | 264 |
| 226 | 3300025918 | Ga0207662_10204485 | Ga0207662_102044851 | 264 |
| 227 | 3300025919 | Ga0207657_10003629 | Ga0207657_100036298 | 264 |
| 228 | 3300025919 | Ga0207657_10044834 | Ga0207657_100448346 | 264 |
| 229 | 3300025919 | Ga0207657_10074991 | Ga0207657_100749912 | 264 |
| 230 | 3300025919 | Ga0207657_10217008 | Ga0207657_102170082 | 264 |
| 231 | 3300025920 | Ga0207649_10032666 | Ga0207649_100326664 | 264 |
| 232 | 3300025920 | Ga0207649_10140056 | Ga0207649_101400563 | 264 |
| 233 | 3300025923 | Ga0207681_10001514 | Ga0207681_100015148 | 264 |
| 234 | 3300025925 | Ga0207650_10101750 | Ga0207650_101017503 | 264 |
| 235 | 3300025926 | Ga0207659_10017372 | Ga0207659_100173724 | 264 |
| 236 | 3300025927 | Ga0207687_10005922 | Ga0207687_100059227 | 264 |
| 237 | 3300025929 | Ga0207664_10128518 | Ga0207664_101285182 | 264 |
| 238 | 3300025931 | Ga0207644_10005910 | Ga0207644_100059104 | 264 |
| 239 | 3300025932 | Ga0207690_10015330 | Ga0207690_100153302 | 264 |
| 240 | 3300025932 | Ga0207690_10156562 | Ga0207690_101565622 | 264 |
| 241 | 3300025933 | Ga0207706_10000278 | Ga0207706_1000027820 | 264 |
| 242 | 3300025933 | Ga0207706_10009641 | Ga0207706_100096411 | 264 |
| 243 | 3300025933 | Ga0207706_10011861 | Ga0207706_100118613 | 264 |
| 244 | 3300025933 | Ga0207706_10090359 | Ga0207706_100903592 | 264 |
| 245 | 3300025937 | Ga0207669_10039274 | Ga0207669_100392745 | 264 |
| 246 | 3300025938 | Ga0207704_10004742 | Ga0207704_100047425 | 264 |
| 247 | 3300025940 | Ga0207691_10000045 | Ga0207691_1000004520 | 264 |
| 248 | 3300025940 | Ga0207691_10000143 | Ga0207691_1000014326 | 264 |
| 249 | 3300025940 | Ga0207691_10479826 | Ga0207691_104798262 | 264 |
| 250 | 3300025941 | Ga0207711_10003154 | Ga0207711_1000315411 | 264 |
| 251 | 3300025941 | Ga0207711_10149306 | Ga0207711_101493062 | 264 |
| 252 | 3300025942 | Ga0207689_10000182 | Ga0207689_1000018237 | 264 |
| 253 | 3300025944 | Ga0207661_10319356 | Ga0207661_103193562 | 264 |
| 254 | 3300025945 | Ga0207679_10005269 | Ga0207679_100052693 | 264 |
| 255 | 3300025945 | Ga0207679_10007755 | Ga0207679_100077559 | 264 |
| 256 | 3300025945 | Ga0207679_10008246 | Ga0207679_100082468 | 264 |
| 257 | 3300025945 | Ga0207679_10021010 | Ga0207679_100210105 | 264 |
| 258 | 3300025949 | Ga0207667_10007486 | Ga0207667_100074867 | 264 |
| 259 | 3300025960 | Ga0207651_10002558 | Ga0207651_100025584 | 264 |
| 260 | 3300025960 | Ga0207651_10049315 | Ga0207651_100493153 | 264 |
| 261 | 3300025960 | Ga0207651_10059534 | Ga0207651_100595342 | 264 |
| 262 | 3300025981 | Ga0207640_10000849 | Ga0207640_100008497 | 264 |
| 263 | 3300025981 | Ga0207640_10022375 | Ga0207640_100223755 | 264 |
| 264 | 3300025986 | Ga0207658_10030876 | Ga0207658_100308765 | 264 |
| 265 | 3300026023 | Ga0207677_10003889 | Ga0207677_1000388911 | 264 |
| 266 | 3300026035 | Ga0207703_10012911 | Ga0207703_100129115 | 264 |
| 267 | 3300026041 | Ga0207639_10002187 | Ga0207639_1000218710 | 264 |
| 268 | 3300026067 | Ga0207678_10007594 | Ga0207678_100075944 | 264 |
| 269 | 3300026067 | Ga0207678_10050500 | Ga0207678_100505004 | 264 |
| 270 | 3300026078 | Ga0207702_10119114 | Ga0207702_101191142 | 264 |
| 271 | 3300026078 | Ga0207702_10138257 | Ga0207702_101382573 | 264 |
| 272 | 3300026088 | Ga0207641_10004210 | Ga0207641_1000421014 | 264 |
| 273 | 3300026088 | Ga0207641_10606876 | Ga0207641_106068761 | 264 |
| 274 | 3300026089 | Ga0207648_10000222 | Ga0207648_1000022243 | 264 |
| 275 | 3300026095 | Ga0207676_10000878 | Ga0207676_1000087816 | 264 |
| 276 | 3300026095 | Ga0207676_10016379 | Ga0207676_100163793 | 264 |
| 277 | 3300026116 | Ga0207674_10006997 | Ga0207674_100069977 | 264 |
| 278 | 3300026121 | Ga0207683_10004874 | Ga0207683_1000487411 | 264 |
| 279 | 3300026121 | Ga0207683_10350254 | Ga0207683_103502542 | 264 |
| 280 | 3300026142 | Ga0207698_10004080 | Ga0207698_100040806 | 264 |
| 281 | 3300028379 | Ga0268266_10001084 | Ga0268266_1000108418 | 264 |
| 282 | 3300028381 | Ga0268264_10033036 | Ga0268264_100330361 | 264 |
| 283 | 3300031548 | Ga0307408_100140771 | Ga0307408_1001407712 | 264 |
| 284 | 3300031731 | Ga0307405_10024724 | Ga0307405_100247242 | 264 |
| 285 | 3300031901 | Ga0307406_10013538 | Ga0307406_100135386 | 264 |
| 286 | 3300031901 | Ga0307406_10120902 | Ga0307406_101209022 | 264 |
| 287 | 3300031903 | Ga0307407_10034822 | Ga0307407_100348223 | 264 |
| 288 | 3300031911 | Ga0307412_10083817 | Ga0307412_100838171 | 264 |
| 289 | 3300031995 | Ga0307409_100040682 | Ga0307409_1000406825 | 264 |
| 290 | 3300031995 | Ga0307409_100129182 | Ga0307409_1001291821 | 264 |
| 291 | 3300032002 | Ga0307416_100009461 | Ga0307416_1000094612 | 264 |
| 292 | 3300032002 | Ga0307416_100050621 | Ga0307416_1000506214 | 264 |
| 293 | 3300034820 | Ga0373959_0056103 | Ga0373959_0056103_53_850 | 264 |
| 294 | 3300035691 | Ga0373931_0034545 | Ga0373931_0034545_785_1579 | 264 |
| 295 | 3300037418 | Ga0395900_0033620 | Ga0395900_0033620_2836_3636 | 264 |
| 296 | 3300037418 | Ga0395900_0270340 | Ga0395900_0270340_221_1021 | 264 |
| 297 | 3300037466 | Ga0395898_0346580 | Ga0395898_0346580_262_1062 | 264 |
| 298 | 3300037471 | Ga0395905_0010392 | Ga0395905_0010392_5934_6734 | 264 |
| 299 | 3300037471 | Ga0395905_0082325 | Ga0395905_0082325_957_1751 | 264 |
| 300 | 3300037471 | Ga0395905_0153412 | Ga0395905_0153412_934_1728 | 264 |
| 301 | 3300038443 | Ga0395901_0015810 | Ga0395901_0015810_6774_7574 | 264 |
| 302 | 3300042006 | Ga0439432_020938 | Ga0439432_020938_1029_1823 | 264 |
| 303 | 3300044684 | Ga0466966_0017406 | Ga0466966_0017406_1050_1850 | 264 |
| 304 | 3300045836 | Ga0466958_0117727 | Ga0466958_0117727_24_818 | 264 |
| 305 | 3300045976 | Ga0466967_0038074 | Ga0466967_0038074_2924_3724 | 264 |
| 306 | 3300045976 | Ga0466967_0113250 | Ga0466967_0113250_1348_2142 | 264 |
| 307 | 3300048911 | Ga0496108_0519702 | Ga0496108_0519702_166_960 | 264 |
| 308 | 3300048913 | Ga0496110_0017288 | Ga0496110_0017288_4806_5600 | 264 |
| 309 | 3300049667 | Ga0501230_048482 | Ga0501230_048482_34_828 | 264 |
| 310 | 3300049779 | Ga0501283_005351 | Ga0501283_005351_212_1006 | 264 |
| 311 | 3300059421 | Ga0590071_009828 | Ga0590071_009828_1122_1916 | 264 |
| 312 | 3300001979 | JGI24740J21852_10000281 | JGI24740J21852_1000028120 | 265 |
| 313 | 3300001990 | JGI24737J22298_10000021 | JGI24737J22298_1000002129 | 265 |
| 314 | 3300002067 | JGI24735J21928_10020883 | JGI24735J21928_100208833 | 265 |
| 315 | 3300002126 | JGI24035J26624_1000892 | JGI24035J26624_10008923 | 265 |
| 316 | 3300005328 | Ga0070676_10014577 | Ga0070676_100145774 | 265 |
| 317 | 3300005338 | Ga0068868_100000637 | Ga0068868_1000006373 | 265 |
| 318 | 3300005355 | Ga0070671_100028945 | Ga0070671_1000289454 | 265 |
| 319 | 3300005364 | Ga0070673_100000209 | Ga0070673_1000002096 | 265 |
| 320 | 3300005459 | Ga0068867_100000507 | Ga0068867_1000005074 | 265 |
| 321 | 3300005539 | Ga0068853_100002778 | Ga0068853_10000277812 | 265 |
| 322 | 3300005718 | Ga0068866_10060546 | Ga0068866_100605463 | 265 |
| 323 | 3300009098 | Ga0105245_10000300 | Ga0105245_1000030031 | 265 |
| 324 | 3300009174 | Ga0105241_10032081 | Ga0105241_100320814 | 265 |
| 325 | 3300009177 | Ga0105248_10002741 | Ga0105248_1000274118 | 265 |
| 326 | 3300009545 | Ga0105237_10792731 | Ga0105237_107927311 | 265 |
| 327 | 3300009551 | Ga0105238_10043258 | Ga0105238_100432584 | 265 |
| 328 | 3300010375 | Ga0105239_10088411 | Ga0105239_100884113 | 265 |
| 329 | 3300011119 | Ga0105246_10007322 | Ga0105246_100073225 | 265 |
| 330 | 3300013100 | Ga0157373_10006164 | Ga0157373_1000616410 | 265 |
| 331 | 3300013102 | Ga0157371_10000677 | Ga0157371_1000067734 | 265 |
| 332 | 3300013297 | Ga0157378_10002011 | Ga0157378_1000201119 | 265 |
| 333 | 3300013306 | Ga0163162_10022590 | Ga0163162_100225906 | 265 |
| 334 | 3300013308 | Ga0157375_10044689 | Ga0157375_100446895 | 265 |
| 335 | 3300014745 | Ga0157377_10200890 | Ga0157377_102008902 | 265 |
| 336 | 3300025290 | Ga0207673_1002252 | Ga0207673_10022522 | 265 |
| 337 | 3300031548 | Ga0307408_100082578 | Ga0307408_1000825784 | 265 |
| 338 | 3300031824 | Ga0307413_10104651 | Ga0307413_101046513 | 265 |
| 339 | 3300031852 | Ga0307410_10309404 | Ga0307410_103094042 | 265 |
| 340 | 3300031995 | Ga0307409_100017331 | Ga0307409_1000173312 | 265 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6w6x-assembly1.cif.gz_A | crystal structure of able apo-protein | 0.6851 | 51 | 165 |
| 6w6x-assembly1.cif.gz_A | crystal structure of able apo-protein | 0.6294 | 51 | 165 |
| 6ek9-assembly1.cif.gz_A | cytosolic copper storage protein csp from streptomyces lividans: cu loaded form | 0.4853 | 127 | 223 |
| 6qyb-assembly1.cif.gz_A | streptomyces lividans ccsp mutant - h111a | 0.4789 | 127 | 223 |
| 6ek9-assembly1.cif.gz_A | cytosolic copper storage protein csp from streptomyces lividans: cu loaded form | 0.4059 | 127 | 223 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q9H3V2_49_189_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5968 | 23 | 106 | 1.20.140.150 |
| af_Q96PG2_59_193_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.587 | 16 | 99 | 1.20.140.150 |
| af_A6NC51_4_206_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.5634 | 16 | 168 | 1.20.1070.10 |
| af_A0A2R8RK24_6_216_1.20.1070.10 | Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins | 0.558 | 16 | 161 | 1.20.1070.10 |
| af_X1WFQ3_50_164_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.5175 | 17 | 105 | 1.20.140.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A4IA10-F1-model_v4 | Adenylate cyclase | 0.9797 | 16 | 259 |
GO:0016020
|
| AF-A0A0Q4KJR6-F1-model_v4 | Uncharacterized protein | 0.9778 | 15 | 256 |
GO:0016020
|
| AF-A0A6N0X514-F1-model_v4 | DUF2306 domain-containing protein | 0.9767 | 28 | 256 |
GO:0016020
|
| AF-A0A7Y4YWN1-F1-model_v4 | DUF2306 domain-containing protein | 0.9748 | 28 | 259 |
GO:0016020
|
| AF-A0A1E3M072-F1-model_v4 | Uncharacterized protein | 0.9743 | 24 | 256 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar