F414229

General Info

Members Datasets Scaffolds Average Seq Length
340 163 340 262

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100084290|Ga0070671_1000842903
Length 298
Sequence MDFPVAGSGPAVVSPCFQPESGLSKGYLKPLGEALGRSGDKRGIDMATLAQQPIAPAAGDERFFLRAAIVMTITIVAGFSFQYAMGRSTFGAPIRVHLHAFFFMGWVAIYLLQNIFVATGRMAFWIIPMVIMGCFVTIAMVRLGYVPFFFRPLQFLVFDPVTVFAFAALTVAAVKLRRRTEWHRRLHFCAMSLLLGPAFGRLLPMPLLQPWAWEAAFLPCILFPIAGVLADIRRNGQAHPAWRWGIATMLGTFVLIEAITYSPVGMSIYRVVTAGSPGETIEPLGFAPPPAGPVTGRS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
80 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
139 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
148 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
149 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
150 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
151 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
152 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
162 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
163 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.35
Stem 0
Stem Tuber 0
Unclassified 0.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000281 3300001979 Bacteria 21617
2 JGI24740J21852_10024235 3300001979 Bacteria 2060
3 JGI24740J21852_10037979 3300001979 Bacteria 1481
4 JGI24739J22299_10000453 3300001989 Bacteria 14331
5 JGI24739J22299_10042353 3300001989 Bacteria 1510
6 JGI24737J22298_10000021 3300001990 Bacteria 45543
7 JGI24735J21928_10020883 3300002067 Bacteria 2004
8 JGI24738J21930_10000062 3300002075 Bacteria 22279
9 JGI24035J26624_1000892 3300002126 Bacteria 2828
10 rootH1_10145678 3300003323 Bacteria 3248
11 Ga0065165_1042702 3300005262 Bacteria 1336
12 Ga0070658_10183403 3300005327 Bacteria 1761
13 Ga0070658_10252060 3300005327 Bacteria 1498
14 Ga0070658_10396870 3300005327 Bacteria 1184
15 Ga0070658_10456372 3300005327 Bacteria 1101
16 Ga0070676_10014577 3300005328 Bacteria 4323
17 Ga0070676_10039832 3300005328 Bacteria 2718
18 Ga0070683_100194319 3300005329 Bacteria 1927
19 Ga0070683_100227620 3300005329 Bacteria 1772
20 Ga0070683_100308975 3300005329 Unclassified 1504
21 Ga0070683_100458742 3300005329 Bacteria 1216
22 Ga0070690_100036750 3300005330 Bacteria 3081
23 Ga0070670_100001101 3300005331 Bacteria 21478
24 Ga0070670_100063428 3300005331 Bacteria 3171
25 Ga0070670_100185127 3300005331 Bacteria 1808
26 Ga0070670_100322819 3300005331 Bacteria 1353
27 Ga0070677_10030558 3300005333 Bacteria 2052
28 Ga0070677_10031925 3300005333 Bacteria 2017
29 Ga0068869_100012742 3300005334 Bacteria 5561
30 Ga0070666_10009791 3300005335 Bacteria 5989
31 Ga0070666_10035699 3300005335 Bacteria 3297
32 Ga0068868_100000637 3300005338 Bacteria 23618
33 Ga0068868_100442643 3300005338 Unclassified 1129
34 Ga0070660_100002082 3300005339 Bacteria 13818
35 Ga0070660_100002163 3300005339 Bacteria 13537
36 Ga0070660_100074296 3300005339 Bacteria 2660
37 Ga0070660_100117010 3300005339 Bacteria 2125
38 Ga0070660_100191609 3300005339 Bacteria 1656
39 Ga0070689_100009615 3300005340 Bacteria 6863
40 Ga0070687_100185814 3300005343 Bacteria 1248
41 Ga0070661_100017744 3300005344 Bacteria 5052
42 Ga0070661_100329305 3300005344 Bacteria 1194
43 Ga0070668_100000068 3300005347 Bacteria 64209
44 Ga0070668_100039816 3300005347 Bacteria 3595
45 Ga0070669_100000862 3300005353 Bacteria 22037
46 Ga0070675_100043144 3300005354 Bacteria 3685
47 Ga0070671_100001553 3300005355 Bacteria 17294
48 Ga0070671_100017254 3300005355 Bacteria 5845
49 Ga0070671_100028945 3300005355 Bacteria 4566
50 Ga0070671_100084290 3300005355 Bacteria 2658
51 Ga0070671_100107667 3300005355 Bacteria 2340
52 Ga0070671_100281604 3300005355 Bacteria 1414
53 Ga0070674_100040120 3300005356 Bacteria 3165
54 Ga0070674_100072144 3300005356 Bacteria 2444
55 Ga0070673_100000209 3300005364 Bacteria 29078
56 Ga0070673_100048766 3300005364 Bacteria 3303
57 Ga0070673_100080776 3300005364 Bacteria 2635
58 Ga0070659_100004192 3300005366 Bacteria 10287
59 Ga0070659_100022410 3300005366 Bacteria 4822
60 Ga0070659_100096800 3300005366 Bacteria 2371
61 Ga0070659_100111652 3300005366 Bacteria 2207
62 Ga0070659_100301560 3300005366 Bacteria 1336
63 Ga0070667_100004734 3300005367 Bacteria 11402
64 Ga0070667_100021153 3300005367 Bacteria 5405
65 Ga0070714_100106251 3300005435 Unclassified 2480
66 Ga0070663_100011385 3300005455 Bacteria 5582
67 Ga0070663_100018098 3300005455 Bacteria 4612
68 Ga0070663_100024991 3300005455 Bacteria 4028
69 Ga0070663_100050874 3300005455 Bacteria 2949
70 Ga0070678_100001607 3300005456 Bacteria 12108
71 Ga0070678_100469904 3300005456 Bacteria 1105
72 Ga0070662_100001955 3300005457 Bacteria 12662
73 Ga0070662_100016148 3300005457 Bacteria 5009
74 Ga0070662_100071113 3300005457 Bacteria 2565
75 Ga0070662_100248192 3300005457 Bacteria 1430
76 Ga0070662_100263925 3300005457 Bacteria 1388
77 Ga0070681_10517608 3300005458 Unclassified 1106
78 Ga0068867_100000507 3300005459 Bacteria 25962
79 Ga0070679_100063327 3300005530 Bacteria 3686
80 Ga0070684_100632337 3300005535 Bacteria 996
81 Ga0068853_100002778 3300005539 Bacteria 13234
82 Ga0070672_100000770 3300005543 Bacteria 19069
83 Ga0070672_100001213 3300005543 Bacteria 15800
84 Ga0070672_100272792 3300005543 Bacteria 1429
85 Ga0070686_100353851 3300005544 Bacteria 1104
86 Ga0070665_100000590 3300005548 Bacteria 50563
87 Ga0070665_100093528 3300005548 Bacteria 3011
88 Ga0070665_100209710 3300005548 Bacteria 1949
89 Ga0070665_100359240 3300005548 Bacteria 1462
90 Ga0070665_100560972 3300005548 Unclassified 1154
91 Ga0068855_100020105 3300005563 Bacteria 8018
92 Ga0070664_100001534 3300005564 Bacteria 18443
93 Ga0070664_100007940 3300005564 Bacteria 8571
94 Ga0070664_100009081 3300005564 Bacteria 8067
95 Ga0070664_100042961 3300005564 Bacteria 3813
96 Ga0070664_100224632 3300005564 Bacteria 1681
97 Ga0068857_100004161 3300005577 Bacteria 12189
98 Ga0068857_100067881 3300005577 Bacteria 3174
99 Ga0068857_100443771 3300005577 Bacteria 1212
100 Ga0068854_100000614 3300005578 Bacteria 21116
101 Ga0068854_100012490 3300005578 Bacteria 5565
102 Ga0068856_100289728 3300005614 Bacteria 1654
103 Ga0068852_100000804 3300005616 Bacteria 20664
104 Ga0068852_100037699 3300005616 Bacteria 4055
105 Ga0068852_100037820 3300005616 Bacteria 4050
106 Ga0068852_100564920 3300005616 Bacteria 1139
107 Ga0068859_100000478 3300005617 Bacteria 39430
108 Ga0068859_100005823 3300005617 Bacteria 12519
109 Ga0068864_100002459 3300005618 Bacteria 15294
110 Ga0068864_100016819 3300005618 Bacteria 6094
111 Ga0068866_10060546 3300005718 Bacteria 1963
112 Ga0068861_100013120 3300005719 Bacteria 5794
113 Ga0068851_10107581 3300005834 Bacteria 1486
114 Ga0068863_100000001 3300005841 Bacteria 581116
115 Ga0068863_100004878 3300005841 Bacteria 13216
116 Ga0068858_100036350 3300005842 Bacteria 4567
117 Ga0068860_100005690 3300005843 Bacteria 12583
118 Ga0068862_100491458 3300005844 Unclassified 1163
119 Ga0097621_100013235 3300006237 Bacteria 6141
120 Ga0068871_100045904 3300006358 Bacteria 3518
121 Ga0068865_100000240 3300006881 Bacteria 30384
122 Ga0097620_100000478 3300006931 Bacteria 39430
123 Ga0097620_100005823 3300006931 Bacteria 12519
124 Ga0105245_10000300 3300009098 Bacteria 47446
125 Ga0105241_10032081 3300009174 Bacteria 3935
126 Ga0105248_10002741 3300009177 Bacteria 19562
127 Ga0105248_10035266 3300009177 Bacteria 5596
128 Ga0105248_10368975 3300009177 Bacteria 1616
129 Ga0105237_10792731 3300009545 Bacteria 954
130 Ga0105238_10043258 3300009551 Bacteria 4557
131 Ga0105238_10218637 3300009551 Bacteria 1881
132 Ga0105249_10009649 3300009553 Bacteria 8459
133 Ga0105239_10088411 3300010375 Bacteria 3416
134 Ga0105246_10007322 3300011119 Bacteria 6761
135 Ga0157373_10006164 3300013100 Bacteria 8961
136 Ga0157373_10054797 3300013100 Bacteria 2833
137 Ga0157371_10000677 3300013102 Bacteria 40414
138 Ga0157371_10049183 3300013102 Bacteria 2995
139 Ga0157371_10089094 3300013102 Bacteria 2185
140 Ga0157369_10176713 3300013105 Bacteria 2247
141 Ga0157374_10021696 3300013296 Bacteria 5719
142 Ga0157374_10218470 3300013296 Bacteria 1870
143 Ga0157378_10002011 3300013297 Bacteria 18196
144 Ga0163162_10022590 3300013306 Bacteria 6201
145 Ga0157372_11149466 3300013307 Bacteria 898
146 Ga0157375_10015287 3300013308 Bacteria 6869
147 Ga0157375_10044689 3300013308 Bacteria 4306
148 Ga0163163_10495699 3300014325 Bacteria 1283
149 Ga0157377_10200890 3300014745 Bacteria 1265
150 Ga0207673_1002252 3300025290 Bacteria 2182
151 Ga0207697_10000026 3300025315 Bacteria 52498
152 Ga0207656_10048618 3300025321 Bacteria 1827
153 Ga0207656_10152493 3300025321 Unclassified 1095
154 Ga0207682_10016246 3300025893 Bacteria 2901
155 Ga0207688_10000055 3300025901 Bacteria 41067
156 Ga0207688_10012513 3300025901 Bacteria 4618
157 Ga0207680_10012693 3300025903 Bacteria 4300
158 Ga0207680_10075005 3300025903 Bacteria 2108
159 Ga0207680_10114278 3300025903 Bacteria 1756
160 Ga0207647_10006361 3300025904 Bacteria 8588
161 Ga0207647_10015895 3300025904 Bacteria 5148
162 Ga0207645_10006444 3300025907 Bacteria 8421
163 Ga0207645_10057857 3300025907 Bacteria 2475
164 Ga0207705_10000002 3300025909 Bacteria 2046852
165 Ga0207705_10050791 3300025909 Bacteria 2985
166 Ga0207705_10059207 3300025909 Bacteria 2764
167 Ga0207705_10101707 3300025909 Bacteria 2114
168 Ga0207705_10142586 3300025909 Bacteria 1790
169 Ga0207705_10226893 3300025909 Bacteria 1420
170 Ga0207662_10204485 3300025918 Bacteria 1279
171 Ga0207657_10001150 3300025919 Bacteria 28145
172 Ga0207657_10003629 3300025919 Bacteria 16433
173 Ga0207657_10019760 3300025919 Bacteria 6386
174 Ga0207657_10020235 3300025919 Bacteria 6295
175 Ga0207657_10044834 3300025919 Unclassified 3885
176 Ga0207657_10074991 3300025919 Bacteria 2855
177 Ga0207657_10217008 3300025919 Bacteria 1534
178 Ga0207657_10225108 3300025919 Bacteria 1501
179 Ga0207649_10032666 3300025920 Bacteria 3104
180 Ga0207649_10083309 3300025920 Bacteria 2076
181 Ga0207649_10140056 3300025920 Bacteria 1654
182 Ga0207649_10252118 3300025920 Bacteria 1272
183 Ga0207652_10030330 3300025921 Bacteria 4527
184 Ga0207681_10001514 3300025923 Bacteria 14993
185 Ga0207681_10039298 3300025923 Bacteria 3141
186 Ga0207650_10100505 3300025925 Bacteria 2225
187 Ga0207650_10101750 3300025925 Bacteria 2213
188 Ga0207650_10209285 3300025925 Bacteria 1566
189 Ga0207659_10017372 3300025926 Bacteria 4700
190 Ga0207687_10005922 3300025927 Bacteria 8088
191 Ga0207664_10125403 3300025929 Bacteria 2155
192 Ga0207664_10128518 3300025929 Bacteria 2130
193 Ga0207644_10000544 3300025931 Bacteria 24497
194 Ga0207644_10005910 3300025931 Bacteria 7980
195 Ga0207644_10034891 3300025931 Bacteria 3521
196 Ga0207644_10048152 3300025931 Bacteria 3046
197 Ga0207644_10224863 3300025931 Bacteria 1489
198 Ga0207690_10002238 3300025932 Bacteria 11806
199 Ga0207690_10015330 3300025932 Bacteria 4643
200 Ga0207690_10137739 3300025932 Bacteria 1794
201 Ga0207690_10156562 3300025932 Bacteria 1694
202 Ga0207706_10000278 3300025933 Bacteria 55758
203 Ga0207706_10009641 3300025933 Bacteria 8864
204 Ga0207706_10010239 3300025933 Bacteria 8573
205 Ga0207706_10011861 3300025933 Bacteria 7935
206 Ga0207706_10090359 3300025933 Bacteria 2693
207 Ga0207669_10039274 3300025937 Bacteria 2733
208 Ga0207704_10004742 3300025938 Bacteria 6243
209 Ga0207691_10000045 3300025940 Bacteria 99798
210 Ga0207691_10000143 3300025940 Bacteria 65645
211 Ga0207691_10479826 3300025940 Bacteria 1057
212 Ga0207711_10003154 3300025941 Bacteria 14370
213 Ga0207711_10149306 3300025941 Bacteria 2108
214 Ga0207689_10000182 3300025942 Bacteria 54476
215 Ga0207661_10018659 3300025944 Bacteria 5156
216 Ga0207661_10148002 3300025944 Bacteria 2028
217 Ga0207661_10319356 3300025944 Bacteria 1396
218 Ga0207679_10005269 3300025945 Bacteria 8106
219 Ga0207679_10007755 3300025945 Bacteria 6821
220 Ga0207679_10008246 3300025945 Bacteria 6634
221 Ga0207679_10021010 3300025945 Bacteria 4417
222 Ga0207679_10042998 3300025945 Bacteria 3250
223 Ga0207667_10007486 3300025949 Bacteria 13111
224 Ga0207651_10002558 3300025960 Bacteria 8693
225 Ga0207651_10022290 3300025960 Bacteria 3869
226 Ga0207651_10049315 3300025960 Bacteria 2852
227 Ga0207651_10059534 3300025960 Bacteria 2646
228 Ga0207668_10000056 3300025972 Bacteria 93913
229 Ga0207640_10000849 3300025981 Bacteria 17357
230 Ga0207640_10022375 3300025981 Bacteria 3782
231 Ga0207640_10104839 3300025981 Bacteria 1991
232 Ga0207658_10030876 3300025986 Bacteria 3799
233 Ga0207677_10003889 3300026023 Bacteria 7950
234 Ga0207703_10012911 3300026035 Bacteria 6510
235 Ga0207639_10002187 3300026041 Bacteria 13159
236 Ga0207678_10000680 3300026067 Bacteria 31116
237 Ga0207678_10004644 3300026067 Bacteria 12335
238 Ga0207678_10007594 3300026067 Bacteria 9580
239 Ga0207678_10030312 3300026067 Bacteria 4723
240 Ga0207678_10050500 3300026067 Bacteria 3593
241 Ga0207702_10119114 3300026078 Bacteria 2360
242 Ga0207702_10138257 3300026078 Unclassified 2201
243 Ga0207641_10000001 3300026088 Bacteria 1180841
244 Ga0207641_10004210 3300026088 Bacteria 12546
245 Ga0207641_10606876 3300026088 Unclassified 1072
246 Ga0207648_10000222 3300026089 Bacteria 61156
247 Ga0207676_10000878 3300026095 Bacteria 23329
248 Ga0207676_10016379 3300026095 Bacteria 5366
249 Ga0207674_10006997 3300026116 Bacteria 13192
250 Ga0207674_10016334 3300026116 Bacteria 8131
251 Ga0207683_10004874 3300026121 Bacteria 11545
252 Ga0207683_10350254 3300026121 Bacteria 1355
253 Ga0207698_10004080 3300026142 Bacteria 8867
254 Ga0207698_10160090 3300026142 Bacteria 1967
255 Ga0268266_10001084 3300028379 Bacteria 34117
256 Ga0268266_10124838 3300028379 Bacteria 2295
257 Ga0268266_10245083 3300028379 Bacteria 1655
258 Ga0268265_10620950 3300028380 Unclassified 1035
259 Ga0268264_10033036 3300028381 Bacteria 4247
260 Ga0268264_10157094 3300028381 Bacteria 2045
261 Ga0307408_100042097 3300031548 Bacteria 3242
262 Ga0307408_100060069 3300031548 Bacteria 2770
263 Ga0307408_100082578 3300031548 Bacteria 2405
264 Ga0307408_100140771 3300031548 Bacteria 1893
265 Ga0307405_10022844 3300031731 Bacteria 3544
266 Ga0307405_10024724 3300031731 Bacteria 3437
267 Ga0307413_10104651 3300031824 Bacteria 1879
268 Ga0307413_10143993 3300031824 Bacteria 1651
269 Ga0307413_10643394 3300031824 Unclassified 873
270 Ga0307410_10000253 3300031852 Bacteria 20310
271 Ga0307410_10000490 3300031852 Bacteria 16059
272 Ga0307410_10309404 3300031852 Bacteria 1249
273 Ga0307410_10408939 3300031852 Bacteria 1098
274 Ga0307406_10013538 3300031901 Bacteria 4674
275 Ga0307406_10120902 3300031901 Bacteria 1821
276 Ga0307407_10007214 3300031903 Bacteria 5017
277 Ga0307407_10009659 3300031903 Bacteria 4506
278 Ga0307407_10034822 3300031903 Bacteria 2761
279 Ga0307412_10083817 3300031911 Bacteria 2211
280 Ga0307412_10115524 3300031911 Bacteria 1924
281 Ga0307409_100001697 3300031995 Bacteria 11090
282 Ga0307409_100017331 3300031995 Bacteria 4796
283 Ga0307409_100031098 3300031995 Bacteria 3847
284 Ga0307409_100040682 3300031995 Bacteria 3463
285 Ga0307409_100129182 3300031995 Bacteria 2155
286 Ga0307409_100552236 3300031995 Bacteria 1131
287 Ga0307416_100009461 3300032002 Bacteria 6381
288 Ga0307416_100050621 3300032002 Bacteria 3312
289 Ga0307416_100097993 3300032002 Bacteria 2541
290 Ga0307416_100357816 3300032002 Bacteria 1480
291 Ga0307414_10077070 3300032004 Bacteria 2425
292 Ga0307411_10020488 3300032005 Bacteria 3847
293 Ga0307415_100054756 3300032126 Bacteria 2725
294 Ga0307415_100216669 3300032126 Bacteria 1532
295 Ga0307510_10307662 3300033180 Bacteria 1045
296 Ga0373959_0056103 3300034820 Unclassified 862
297 Ga0373931_0034545 3300035691 Bacteria 2625
298 Ga0373931_0293377 3300035691 Unclassified 1002
299 Ga0373935_0302515 3300035692 Bacteria 1131
300 Ga0395899_0057782 3300037312 Bacteria 2862
301 Ga0395899_0058966 3300037312 Bacteria 2830
302 Ga0395899_0196916 3300037312 Bacteria 1407
303 Ga0395900_0021708 3300037418 Bacteria 6564
304 Ga0395900_0033620 3300037418 Bacteria 5277
305 Ga0395900_0240880 3300037418 Bacteria 1814
306 Ga0395900_0270340 3300037418 Bacteria 1694
307 Ga0395898_0016515 3300037466 Bacteria 7551
308 Ga0395898_0346580 3300037466 Bacteria 1416
309 Ga0395905_0010392 3300037471 Bacteria 9061
310 Ga0395905_0015171 3300037471 Bacteria 7331
311 Ga0395905_0043337 3300037471 Bacteria 4221
312 Ga0395905_0082325 3300037471 Bacteria 3016
313 Ga0395905_0107183 3300037471 Bacteria 2623
314 Ga0395905_0153412 3300037471 Bacteria 2167
315 Ga0395905_0229542 3300037471 Unclassified 1736
316 Ga0395901_0008531 3300038443 Bacteria 10352
317 Ga0395901_0013211 3300038443 Bacteria 8384
318 Ga0395901_0015810 3300038443 Bacteria 7690
319 Ga0395901_0090386 3300038443 Bacteria 3205
320 Ga0395901_0097246 3300038443 Bacteria 3086
321 Ga0439432_020938 3300042006 Bacteria 2171
322 Ga0450920_032625 3300042122 Unclassified 1028
323 Ga0450908_007214 3300042184 Bacteria 2099
324 Ga0466966_0017406 3300044684 Unclassified 4749
325 Ga0466961_0220949 3300044693 Unclassified 1168
326 Ga0466958_0117727 3300045836 Bacteria 1661
327 Ga0466967_0038074 3300045976 Bacteria 4122
328 Ga0466967_0113250 3300045976 Bacteria 2495
329 Ga0466967_0143414 3300045976 Bacteria 2226
330 Ga0495668_0023174 3300046616 Bacteria 3543
331 Ga0495600_0260059 3300046809 Unclassified 1103
332 Ga0496108_0519702 3300048911 Unclassified 1039
333 Ga0496110_0017288 3300048913 Bacteria 6033
334 Ga0496110_0156482 3300048913 Bacteria 2064
335 Ga0496112_0087653 3300048915 Bacteria 3080
336 Ga0496114_0038765 3300048917 Bacteria 3942
337 Ga0496115_0006838 3300048918 Bacteria 8371
338 Ga0501230_048482 3300049667 Bacteria 839
339 Ga0501283_005351 3300049779 Bacteria 1763
340 Ga0590071_009828 3300059421 Bacteria 2243

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100322819 Ga0070670_1003228191 238
2 3300035691 Ga0373931_0293377 Ga0373931_0293377_14_733 239
3 3300037312 Ga0395899_0196916 Ga0395899_0196916_661_1380 239
4 3300031852 Ga0307410_10000253 Ga0307410_1000025318 240
5 3300031995 Ga0307409_100001697 Ga0307409_1000016972 240
6 3300032002 Ga0307416_100357816 Ga0307416_1003578161 240
7 3300046616 Ga0495668_0023174 Ga0495668_0023174_1988_2752 243
8 3300035692 Ga0373935_0302515 Ga0373935_0302515_184_966 244
9 3300046809 Ga0495600_0260059 Ga0495600_0260059_288_1070 244
10 3300031995 Ga0307409_100552236 Ga0307409_1005522361 247
11 3300042122 Ga0450920_032625 Ga0450920_032625_90_884 247
12 3300005327 Ga0070658_10252060 Ga0070658_102520603 248
13 3300005329 Ga0070683_100227620 Ga0070683_1002276202 248
14 3300005455 Ga0070663_100018098 Ga0070663_1000180985 248
15 3300005535 Ga0070684_100632337 Ga0070684_1006323371 248
16 3300025909 Ga0207705_10101707 Ga0207705_101017072 248
17 3300025920 Ga0207649_10252118 Ga0207649_102521181 248
18 3300025944 Ga0207661_10018659 Ga0207661_100186594 248
19 3300026067 Ga0207678_10004644 Ga0207678_100046444 248
20 3300037312 Ga0395899_0057782 Ga0395899_0057782_1614_2405 248
21 3300037418 Ga0395900_0240880 Ga0395900_0240880_543_1334 248
22 3300037466 Ga0395898_0016515 Ga0395898_0016515_4727_5518 248
23 3300037471 Ga0395905_0043337 Ga0395905_0043337_1397_2188 248
24 3300037471 Ga0395905_0229542 Ga0395905_0229542_37_828 248
25 3300038443 Ga0395901_0013211 Ga0395901_0013211_6584_7375 248
26 3300032005 Ga0307411_10020488 Ga0307411_100204884 249
27 3300005458 Ga0070681_10517608 Ga0070681_105176082 250
28 3300005530 Ga0070679_100063327 Ga0070679_1000633273 250
29 3300025921 Ga0207652_10030330 Ga0207652_100303303 250
30 3300031824 Ga0307413_10143993 Ga0307413_101439931 250
31 3300001979 JGI24740J21852_10024235 JGI24740J21852_100242352 253
32 3300001989 JGI24739J22299_10042353 JGI24739J22299_100423531 253
33 3300005327 Ga0070658_10183403 Ga0070658_101834032 253
34 3300005329 Ga0070683_100194319 Ga0070683_1001943192 253
35 3300005331 Ga0070670_100063428 Ga0070670_1000634283 253
36 3300005331 Ga0070670_100185127 Ga0070670_1001851272 253
37 3300005335 Ga0070666_10035699 Ga0070666_100356991 253
38 3300005338 Ga0068868_100442643 Ga0068868_1004426431 253
39 3300005339 Ga0070660_100117010 Ga0070660_1001170102 253
40 3300005347 Ga0070668_100000068 Ga0070668_10000006849 253
41 3300005355 Ga0070671_100001553 Ga0070671_10000155312 253
42 3300005355 Ga0070671_100107667 Ga0070671_1001076672 253
43 3300005364 Ga0070673_100080776 Ga0070673_1000807763 253
44 3300005366 Ga0070659_100096800 Ga0070659_1000968003 253
45 3300005367 Ga0070667_100021153 Ga0070667_1000211532 253
46 3300005544 Ga0070686_100353851 Ga0070686_1003538512 253
47 3300005548 Ga0070665_100093528 Ga0070665_1000935283 253
48 3300005548 Ga0070665_100560972 Ga0070665_1005609722 253
49 3300005577 Ga0068857_100443771 Ga0068857_1004437712 253
50 3300005616 Ga0068852_100037699 Ga0068852_1000376992 253
51 3300005617 Ga0068859_100005823 Ga0068859_10000582310 253
52 3300005841 Ga0068863_100000001 Ga0068863_100000001210 253
53 3300005844 Ga0068862_100491458 Ga0068862_1004914581 253
54 3300006931 Ga0097620_100005823 Ga0097620_10000582310 253
55 3300009553 Ga0105249_10009649 Ga0105249_100096499 253
56 3300013102 Ga0157371_10049183 Ga0157371_100491832 253
57 3300013307 Ga0157372_11149466 Ga0157372_111494661 253
58 3300025903 Ga0207680_10114278 Ga0207680_101142782 253
59 3300025904 Ga0207647_10015895 Ga0207647_100158952 253
60 3300025909 Ga0207705_10142586 Ga0207705_101425862 253
61 3300025919 Ga0207657_10019760 Ga0207657_100197607 253
62 3300025923 Ga0207681_10039298 Ga0207681_100392981 253
63 3300025925 Ga0207650_10209285 Ga0207650_102092852 253
64 3300025931 Ga0207644_10000544 Ga0207644_1000054417 253
65 3300025931 Ga0207644_10048152 Ga0207644_100481523 253
66 3300025932 Ga0207690_10137739 Ga0207690_101377391 253
67 3300025933 Ga0207706_10010239 Ga0207706_1001023911 253
68 3300025944 Ga0207661_10148002 Ga0207661_101480022 253
69 3300025960 Ga0207651_10022290 Ga0207651_100222904 253
70 3300025972 Ga0207668_10000056 Ga0207668_1000005696 253
71 3300025981 Ga0207640_10104839 Ga0207640_101048392 253
72 3300026067 Ga0207678_10000680 Ga0207678_1000068022 253
73 3300026088 Ga0207641_10000001 Ga0207641_10000001547 253
74 3300026116 Ga0207674_10016334 Ga0207674_100163342 253
75 3300026142 Ga0207698_10160090 Ga0207698_101600902 253
76 3300028379 Ga0268266_10124838 Ga0268266_101248382 253
77 3300028379 Ga0268266_10245083 Ga0268266_102450832 253
78 3300028380 Ga0268265_10620950 Ga0268265_106209501 253
79 3300028381 Ga0268264_10157094 Ga0268264_101570942 253
80 3300037471 Ga0395905_0107183 Ga0395905_0107183_1064_1900 253
81 3300005355 Ga0070671_100084290 Ga0070671_1000842903 254
82 3300005457 Ga0070662_100263925 Ga0070662_1002639252 254
83 3300009177 Ga0105248_10368975 Ga0105248_103689752 254
84 3300025893 Ga0207682_10016246 Ga0207682_100162462 254
85 3300048917 Ga0496114_0038765 Ga0496114_0038765_373_1140 254
86 3300013102 Ga0157371_10089094 Ga0157371_100890942 256
87 3300031852 Ga0307410_10408939 Ga0307410_104089392 256
88 3300032126 Ga0307415_100216669 Ga0307415_1002166692 256
89 3300033180 Ga0307510_10307662 Ga0307510_103076621 256
90 3300005355 Ga0070671_100281604 Ga0070671_1002816042 257
91 3300025931 Ga0207644_10224863 Ga0207644_102248631 257
92 3300037312 Ga0395899_0058966 Ga0395899_0058966_451_1227 257
93 3300037418 Ga0395900_0021708 Ga0395900_0021708_1383_2159 257
94 3300037471 Ga0395905_0015171 Ga0395905_0015171_4798_5574 257
95 3300038443 Ga0395901_0008531 Ga0395901_0008531_6007_6783 257
96 3300031548 Ga0307408_100042097 Ga0307408_1000420973 258
97 3300031731 Ga0307405_10022844 Ga0307405_100228442 258
98 3300031903 Ga0307407_10009659 Ga0307407_100096594 258
99 3300031995 Ga0307409_100031098 Ga0307409_1000310982 258
100 3300032004 Ga0307414_10077070 Ga0307414_100770702 258
101 3300042184 Ga0450908_007214 Ga0450908_007214_634_1413 259
102 3300005262 Ga0065165_1042702 Ga0065165_10427022 261
103 3300005329 Ga0070683_100458742 Ga0070683_1004587422 262
104 3300005339 Ga0070660_100074296 Ga0070660_1000742962 262
105 3300005366 Ga0070659_100004192 Ga0070659_1000041922 262
106 3300005455 Ga0070663_100024991 Ga0070663_1000249913 262
107 3300005564 Ga0070664_100224632 Ga0070664_1002246322 262
108 3300005616 Ga0068852_100037820 Ga0068852_1000378205 262
109 3300005834 Ga0068851_10107581 Ga0068851_101075812 262
110 3300013105 Ga0157369_10176713 Ga0157369_101767133 262
111 3300013296 Ga0157374_10218470 Ga0157374_102184702 262
112 3300025321 Ga0207656_10048618 Ga0207656_100486181 262
113 3300025909 Ga0207705_10000002 Ga0207705_10000002708 262
114 3300025919 Ga0207657_10001150 Ga0207657_100011501 262
115 3300025919 Ga0207657_10020235 Ga0207657_100202357 262
116 3300025932 Ga0207690_10002238 Ga0207690_100022385 262
117 3300026067 Ga0207678_10030312 Ga0207678_100303127 262
118 3300038443 Ga0395901_0097246 Ga0395901_0097246_992_1786 262
119 3300005327 Ga0070658_10456372 Ga0070658_104563721 263
120 3300005339 Ga0070660_100002163 Ga0070660_10000216315 263
121 3300005355 Ga0070671_100017254 Ga0070671_1000172543 263
122 3300005435 Ga0070714_100106251 Ga0070714_1001062512 263
123 3300005564 Ga0070664_100042961 Ga0070664_1000429613 263
124 3300005616 Ga0068852_100564920 Ga0068852_1005649202 263
125 3300013296 Ga0157374_10021696 Ga0157374_100216962 263
126 3300025909 Ga0207705_10059207 Ga0207705_100592072 263
127 3300025919 Ga0207657_10225108 Ga0207657_102251082 263
128 3300025920 Ga0207649_10083309 Ga0207649_100833092 263
129 3300025925 Ga0207650_10100505 Ga0207650_101005052 263
130 3300025929 Ga0207664_10125403 Ga0207664_101254032 263
131 3300025931 Ga0207644_10034891 Ga0207644_100348912 263
132 3300025945 Ga0207679_10042998 Ga0207679_100429982 263
133 3300031548 Ga0307408_100060069 Ga0307408_1000600692 263
134 3300031824 Ga0307413_10643394 Ga0307413_106433941 263
135 3300031852 Ga0307410_10000490 Ga0307410_100004904 263
136 3300031903 Ga0307407_10007214 Ga0307407_100072145 263
137 3300031911 Ga0307412_10115524 Ga0307412_101155242 263
138 3300032002 Ga0307416_100097993 Ga0307416_1000979932 263
139 3300032126 Ga0307415_100054756 Ga0307415_1000547563 263
140 3300038443 Ga0395901_0090386 Ga0395901_0090386_122_919 263
141 3300044693 Ga0466961_0220949 Ga0466961_0220949_255_1046 263
142 3300045976 Ga0466967_0143414 Ga0466967_0143414_1005_1796 263
143 3300048913 Ga0496110_0156482 Ga0496110_0156482_16_810 263
144 3300048915 Ga0496112_0087653 Ga0496112_0087653_392_1186 263
145 3300048918 Ga0496115_0006838 Ga0496115_0006838_7398_8192 263
146 3300001979 JGI24740J21852_10037979 JGI24740J21852_100379791 264
147 3300001989 JGI24739J22299_10000453 JGI24739J22299_1000045312 264
148 3300002075 JGI24738J21930_10000062 JGI24738J21930_1000006215 264
149 3300003323 rootH1_10145678 rootH1_101456784 264
150 3300005327 Ga0070658_10396870 Ga0070658_103968702 264
151 3300005328 Ga0070676_10039832 Ga0070676_100398323 264
152 3300005329 Ga0070683_100308975 Ga0070683_1003089752 264
153 3300005330 Ga0070690_100036750 Ga0070690_1000367505 264
154 3300005331 Ga0070670_100001101 Ga0070670_1000011018 264
155 3300005333 Ga0070677_10030558 Ga0070677_100305582 264
156 3300005333 Ga0070677_10031925 Ga0070677_100319252 264
157 3300005334 Ga0068869_100012742 Ga0068869_1000127425 264
158 3300005335 Ga0070666_10009791 Ga0070666_100097915 264
159 3300005339 Ga0070660_100002082 Ga0070660_1000020827 264
160 3300005339 Ga0070660_100191609 Ga0070660_1001916092 264
161 3300005340 Ga0070689_100009615 Ga0070689_10000961510 264
162 3300005343 Ga0070687_100185814 Ga0070687_1001858142 264
163 3300005344 Ga0070661_100017744 Ga0070661_1000177442 264
164 3300005344 Ga0070661_100329305 Ga0070661_1003293051 264
165 3300005347 Ga0070668_100039816 Ga0070668_1000398164 264
166 3300005353 Ga0070669_100000862 Ga0070669_10000086211 264
167 3300005354 Ga0070675_100043144 Ga0070675_1000431445 264
168 3300005356 Ga0070674_100040120 Ga0070674_1000401203 264
169 3300005356 Ga0070674_100072144 Ga0070674_1000721442 264
170 3300005364 Ga0070673_100048766 Ga0070673_1000487663 264
171 3300005366 Ga0070659_100022410 Ga0070659_1000224102 264
172 3300005366 Ga0070659_100111652 Ga0070659_1001116522 264
173 3300005366 Ga0070659_100301560 Ga0070659_1003015601 264
174 3300005367 Ga0070667_100004734 Ga0070667_10000473412 264
175 3300005455 Ga0070663_100011385 Ga0070663_1000113852 264
176 3300005455 Ga0070663_100050874 Ga0070663_1000508742 264
177 3300005456 Ga0070678_100001607 Ga0070678_1000016074 264
178 3300005456 Ga0070678_100469904 Ga0070678_1004699041 264
179 3300005457 Ga0070662_100001955 Ga0070662_10000195510 264
180 3300005457 Ga0070662_100016148 Ga0070662_1000161483 264
181 3300005457 Ga0070662_100071113 Ga0070662_1000711132 264
182 3300005457 Ga0070662_100248192 Ga0070662_1002481922 264
183 3300005543 Ga0070672_100000770 Ga0070672_10000077012 264
184 3300005543 Ga0070672_100001213 Ga0070672_1000012137 264
185 3300005543 Ga0070672_100272792 Ga0070672_1002727922 264
186 3300005548 Ga0070665_100000590 Ga0070665_10000059047 264
187 3300005548 Ga0070665_100209710 Ga0070665_1002097102 264
188 3300005548 Ga0070665_100359240 Ga0070665_1003592402 264
189 3300005563 Ga0068855_100020105 Ga0068855_1000201054 264
190 3300005564 Ga0070664_100001534 Ga0070664_1000015347 264
191 3300005564 Ga0070664_100007940 Ga0070664_1000079407 264
192 3300005564 Ga0070664_100009081 Ga0070664_10000908110 264
193 3300005577 Ga0068857_100004161 Ga0068857_10000416110 264
194 3300005577 Ga0068857_100067881 Ga0068857_1000678812 264
195 3300005578 Ga0068854_100000614 Ga0068854_10000061415 264
196 3300005578 Ga0068854_100012490 Ga0068854_1000124904 264
197 3300005614 Ga0068856_100289728 Ga0068856_1002897282 264
198 3300005616 Ga0068852_100000804 Ga0068852_10000080416 264
199 3300005617 Ga0068859_100000478 Ga0068859_10000047840 264
200 3300005618 Ga0068864_100002459 Ga0068864_10000245912 264
201 3300005618 Ga0068864_100016819 Ga0068864_1000168193 264
202 3300005719 Ga0068861_100013120 Ga0068861_1000131204 264
203 3300005841 Ga0068863_100004878 Ga0068863_10000487811 264
204 3300005842 Ga0068858_100036350 Ga0068858_1000363505 264
205 3300005843 Ga0068860_100005690 Ga0068860_10000569015 264
206 3300006237 Ga0097621_100013235 Ga0097621_10001323510 264
207 3300006358 Ga0068871_100045904 Ga0068871_1000459045 264
208 3300006881 Ga0068865_100000240 Ga0068865_10000024023 264
209 3300006931 Ga0097620_100000478 Ga0097620_10000047840 264
210 3300009177 Ga0105248_10035266 Ga0105248_100352665 264
211 3300009551 Ga0105238_10218637 Ga0105238_102186371 264
212 3300013100 Ga0157373_10054797 Ga0157373_100547973 264
213 3300013308 Ga0157375_10015287 Ga0157375_100152874 264
214 3300014325 Ga0163163_10495699 Ga0163163_104956991 264
215 3300025315 Ga0207697_10000026 Ga0207697_1000002640 264
216 3300025321 Ga0207656_10152493 Ga0207656_101524932 264
217 3300025901 Ga0207688_10000055 Ga0207688_100000558 264
218 3300025901 Ga0207688_10012513 Ga0207688_100125137 264
219 3300025903 Ga0207680_10012693 Ga0207680_100126933 264
220 3300025903 Ga0207680_10075005 Ga0207680_100750054 264
221 3300025904 Ga0207647_10006361 Ga0207647_100063615 264
222 3300025907 Ga0207645_10006444 Ga0207645_1000644410 264
223 3300025907 Ga0207645_10057857 Ga0207645_100578573 264
224 3300025909 Ga0207705_10050791 Ga0207705_100507911 264
225 3300025909 Ga0207705_10226893 Ga0207705_102268932 264
226 3300025918 Ga0207662_10204485 Ga0207662_102044851 264
227 3300025919 Ga0207657_10003629 Ga0207657_100036298 264
228 3300025919 Ga0207657_10044834 Ga0207657_100448346 264
229 3300025919 Ga0207657_10074991 Ga0207657_100749912 264
230 3300025919 Ga0207657_10217008 Ga0207657_102170082 264
231 3300025920 Ga0207649_10032666 Ga0207649_100326664 264
232 3300025920 Ga0207649_10140056 Ga0207649_101400563 264
233 3300025923 Ga0207681_10001514 Ga0207681_100015148 264
234 3300025925 Ga0207650_10101750 Ga0207650_101017503 264
235 3300025926 Ga0207659_10017372 Ga0207659_100173724 264
236 3300025927 Ga0207687_10005922 Ga0207687_100059227 264
237 3300025929 Ga0207664_10128518 Ga0207664_101285182 264
238 3300025931 Ga0207644_10005910 Ga0207644_100059104 264
239 3300025932 Ga0207690_10015330 Ga0207690_100153302 264
240 3300025932 Ga0207690_10156562 Ga0207690_101565622 264
241 3300025933 Ga0207706_10000278 Ga0207706_1000027820 264
242 3300025933 Ga0207706_10009641 Ga0207706_100096411 264
243 3300025933 Ga0207706_10011861 Ga0207706_100118613 264
244 3300025933 Ga0207706_10090359 Ga0207706_100903592 264
245 3300025937 Ga0207669_10039274 Ga0207669_100392745 264
246 3300025938 Ga0207704_10004742 Ga0207704_100047425 264
247 3300025940 Ga0207691_10000045 Ga0207691_1000004520 264
248 3300025940 Ga0207691_10000143 Ga0207691_1000014326 264
249 3300025940 Ga0207691_10479826 Ga0207691_104798262 264
250 3300025941 Ga0207711_10003154 Ga0207711_1000315411 264
251 3300025941 Ga0207711_10149306 Ga0207711_101493062 264
252 3300025942 Ga0207689_10000182 Ga0207689_1000018237 264
253 3300025944 Ga0207661_10319356 Ga0207661_103193562 264
254 3300025945 Ga0207679_10005269 Ga0207679_100052693 264
255 3300025945 Ga0207679_10007755 Ga0207679_100077559 264
256 3300025945 Ga0207679_10008246 Ga0207679_100082468 264
257 3300025945 Ga0207679_10021010 Ga0207679_100210105 264
258 3300025949 Ga0207667_10007486 Ga0207667_100074867 264
259 3300025960 Ga0207651_10002558 Ga0207651_100025584 264
260 3300025960 Ga0207651_10049315 Ga0207651_100493153 264
261 3300025960 Ga0207651_10059534 Ga0207651_100595342 264
262 3300025981 Ga0207640_10000849 Ga0207640_100008497 264
263 3300025981 Ga0207640_10022375 Ga0207640_100223755 264
264 3300025986 Ga0207658_10030876 Ga0207658_100308765 264
265 3300026023 Ga0207677_10003889 Ga0207677_1000388911 264
266 3300026035 Ga0207703_10012911 Ga0207703_100129115 264
267 3300026041 Ga0207639_10002187 Ga0207639_1000218710 264
268 3300026067 Ga0207678_10007594 Ga0207678_100075944 264
269 3300026067 Ga0207678_10050500 Ga0207678_100505004 264
270 3300026078 Ga0207702_10119114 Ga0207702_101191142 264
271 3300026078 Ga0207702_10138257 Ga0207702_101382573 264
272 3300026088 Ga0207641_10004210 Ga0207641_1000421014 264
273 3300026088 Ga0207641_10606876 Ga0207641_106068761 264
274 3300026089 Ga0207648_10000222 Ga0207648_1000022243 264
275 3300026095 Ga0207676_10000878 Ga0207676_1000087816 264
276 3300026095 Ga0207676_10016379 Ga0207676_100163793 264
277 3300026116 Ga0207674_10006997 Ga0207674_100069977 264
278 3300026121 Ga0207683_10004874 Ga0207683_1000487411 264
279 3300026121 Ga0207683_10350254 Ga0207683_103502542 264
280 3300026142 Ga0207698_10004080 Ga0207698_100040806 264
281 3300028379 Ga0268266_10001084 Ga0268266_1000108418 264
282 3300028381 Ga0268264_10033036 Ga0268264_100330361 264
283 3300031548 Ga0307408_100140771 Ga0307408_1001407712 264
284 3300031731 Ga0307405_10024724 Ga0307405_100247242 264
285 3300031901 Ga0307406_10013538 Ga0307406_100135386 264
286 3300031901 Ga0307406_10120902 Ga0307406_101209022 264
287 3300031903 Ga0307407_10034822 Ga0307407_100348223 264
288 3300031911 Ga0307412_10083817 Ga0307412_100838171 264
289 3300031995 Ga0307409_100040682 Ga0307409_1000406825 264
290 3300031995 Ga0307409_100129182 Ga0307409_1001291821 264
291 3300032002 Ga0307416_100009461 Ga0307416_1000094612 264
292 3300032002 Ga0307416_100050621 Ga0307416_1000506214 264
293 3300034820 Ga0373959_0056103 Ga0373959_0056103_53_850 264
294 3300035691 Ga0373931_0034545 Ga0373931_0034545_785_1579 264
295 3300037418 Ga0395900_0033620 Ga0395900_0033620_2836_3636 264
296 3300037418 Ga0395900_0270340 Ga0395900_0270340_221_1021 264
297 3300037466 Ga0395898_0346580 Ga0395898_0346580_262_1062 264
298 3300037471 Ga0395905_0010392 Ga0395905_0010392_5934_6734 264
299 3300037471 Ga0395905_0082325 Ga0395905_0082325_957_1751 264
300 3300037471 Ga0395905_0153412 Ga0395905_0153412_934_1728 264
301 3300038443 Ga0395901_0015810 Ga0395901_0015810_6774_7574 264
302 3300042006 Ga0439432_020938 Ga0439432_020938_1029_1823 264
303 3300044684 Ga0466966_0017406 Ga0466966_0017406_1050_1850 264
304 3300045836 Ga0466958_0117727 Ga0466958_0117727_24_818 264
305 3300045976 Ga0466967_0038074 Ga0466967_0038074_2924_3724 264
306 3300045976 Ga0466967_0113250 Ga0466967_0113250_1348_2142 264
307 3300048911 Ga0496108_0519702 Ga0496108_0519702_166_960 264
308 3300048913 Ga0496110_0017288 Ga0496110_0017288_4806_5600 264
309 3300049667 Ga0501230_048482 Ga0501230_048482_34_828 264
310 3300049779 Ga0501283_005351 Ga0501283_005351_212_1006 264
311 3300059421 Ga0590071_009828 Ga0590071_009828_1122_1916 264
312 3300001979 JGI24740J21852_10000281 JGI24740J21852_1000028120 265
313 3300001990 JGI24737J22298_10000021 JGI24737J22298_1000002129 265
314 3300002067 JGI24735J21928_10020883 JGI24735J21928_100208833 265
315 3300002126 JGI24035J26624_1000892 JGI24035J26624_10008923 265
316 3300005328 Ga0070676_10014577 Ga0070676_100145774 265
317 3300005338 Ga0068868_100000637 Ga0068868_1000006373 265
318 3300005355 Ga0070671_100028945 Ga0070671_1000289454 265
319 3300005364 Ga0070673_100000209 Ga0070673_1000002096 265
320 3300005459 Ga0068867_100000507 Ga0068867_1000005074 265
321 3300005539 Ga0068853_100002778 Ga0068853_10000277812 265
322 3300005718 Ga0068866_10060546 Ga0068866_100605463 265
323 3300009098 Ga0105245_10000300 Ga0105245_1000030031 265
324 3300009174 Ga0105241_10032081 Ga0105241_100320814 265
325 3300009177 Ga0105248_10002741 Ga0105248_1000274118 265
326 3300009545 Ga0105237_10792731 Ga0105237_107927311 265
327 3300009551 Ga0105238_10043258 Ga0105238_100432584 265
328 3300010375 Ga0105239_10088411 Ga0105239_100884113 265
329 3300011119 Ga0105246_10007322 Ga0105246_100073225 265
330 3300013100 Ga0157373_10006164 Ga0157373_1000616410 265
331 3300013102 Ga0157371_10000677 Ga0157371_1000067734 265
332 3300013297 Ga0157378_10002011 Ga0157378_1000201119 265
333 3300013306 Ga0163162_10022590 Ga0163162_100225906 265
334 3300013308 Ga0157375_10044689 Ga0157375_100446895 265
335 3300014745 Ga0157377_10200890 Ga0157377_102008902 265
336 3300025290 Ga0207673_1002252 Ga0207673_10022522 265
337 3300031548 Ga0307408_100082578 Ga0307408_1000825784 265
338 3300031824 Ga0307413_10104651 Ga0307413_101046513 265
339 3300031852 Ga0307410_10309404 Ga0307410_103094042 265
340 3300031995 Ga0307409_100017331 Ga0307409_1000173312 265

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.6851 51 165
6w6x-assembly1.cif.gz_A crystal structure of able apo-protein 0.6294 51 165
6ek9-assembly1.cif.gz_A cytosolic copper storage protein csp from streptomyces lividans: cu loaded form 0.4853 127 223
6qyb-assembly1.cif.gz_A streptomyces lividans ccsp mutant - h111a 0.4789 127 223
6ek9-assembly1.cif.gz_A cytosolic copper storage protein csp from streptomyces lividans: cu loaded form 0.4059 127 223
ID Description Score Start End Superfamily
af_Q9H3V2_49_189_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5968 23 106 1.20.140.150
af_Q96PG2_59_193_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.587 16 99 1.20.140.150
af_A6NC51_4_206_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.5634 16 168 1.20.1070.10
af_A0A2R8RK24_6_216_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.558 16 161 1.20.1070.10
af_X1WFQ3_50_164_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5175 17 105 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A2A4IA10-F1-model_v4 Adenylate cyclase 0.9797 16 259 GO:0016020
AF-A0A0Q4KJR6-F1-model_v4 Uncharacterized protein 0.9778 15 256 GO:0016020
AF-A0A6N0X514-F1-model_v4 DUF2306 domain-containing protein 0.9767 28 256 GO:0016020
AF-A0A7Y4YWN1-F1-model_v4 DUF2306 domain-containing protein 0.9748 28 259 GO:0016020
AF-A0A1E3M072-F1-model_v4 Uncharacterized protein 0.9743 24 256 GO:0016020

Feature Viewer

pLDDT pTM Quality
85.96 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map