F414264

General Info

Members Datasets Scaffolds Average Seq Length
340 179 680 235

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100033530|Ga0068856_1000335306
Length 279
Sequence MPENKSDPEIPNSEITANAPSKSPPVGETLASLRVRSGIHSAIENKSEIENPKSEIKLYQHIFFDLDHTIWDFDRNAEETLYESKIGLPSAALFIETYTRNNHRLWAEYHTGKITKNELRETRFKTTFLELGVPPDRLPLAFEDHYVRLCPTKTNLFPHAHQTLQYLQNKYTLHLITNGFKETSEYKIGNTNIGSYFKHVIISEVVGANKPDKAIFEHALTLSGANKNESLMIGDSLEADVYGALNFGMDAIYFNPFNAPKPDDVPLQVTHLKELMDIL

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
11 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
14 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
15 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
16 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
21 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
22 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
23 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
62 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
63 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
69 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
70 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
71 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
74 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
75 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
101 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
116 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
117 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
124 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
125 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
126 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
127 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
128 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
129 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
130 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
136 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
141 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
142 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
143 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
144 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
145 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
146 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
147 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
148 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
149 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
150 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
151 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
152 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
153 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
154 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
155 2738541283 Pedobacter sp. OK701 Isolate Unclassified
156 2738541284 Pedobacter sp. YR016 Isolate Unclassified
157 2738541302 Pedobacter sp. CF074 Isolate Unclassified
158 2738543023 Pedobacter sp. OK628 Isolate Unclassified
159 2739367651 Pedobacter sp. OK291 Isolate Unclassified
160 2739367656 Pedobacter sp. CF523 Isolate Unclassified
161 2739367663 Pedobacter sp. YR510 Isolate Unclassified
162 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
163 2818991437 Pedobacter terrae 518 Isolate Unclassified
164 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
165 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
166 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
167 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
168 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
169 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
170 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
171 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
172 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
173 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
174 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
175 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
176 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
177 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
178 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
179 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 0
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0
Rhizoplane 0.29
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100033530 3300005614 Bacteria 5028
2 SwRhRL2b_contig_2637238 2162886007 Bacteria 802
3 JGI24736J21556_1010516 3300001904 Bacteria 1511
4 JGI24739J22299_10011148 3300001989 Bacteria 3322
5 JGI24739J22299_10022622 3300001989 Bacteria 2229
6 JGI24737J22298_10000116 3300001990 Bacteria 24197
7 JGI24735J21928_10000015 3300002067 Bacteria 167231
8 JGI24744J21845_10004366 3300002077 Bacteria 2921
9 JGI25162J39368_1000016 3300002737 Bacteria 288734
10 JGI25162J39368_1000866 3300002737 Bacteria 19829
11 JGI25157J39369_1005975 3300002741 Bacteria 1909
12 JGI25164J39214_1001979 3300002772 Bacteria 3689
13 JGI25152J39213_1001261 3300002773 Bacteria 11491
14 JGI25150J39212_1000023 3300002774 Bacteria 130663
15 JGI25151J46595_10000082 3300003187 Bacteria 130832
16 JGI25165J46597_1001674 3300003214 Bacteria 10067
17 JGI25153J46596_10000060 3300003215 Bacteria 131744
18 rootH1_10034433 3300003316 Bacteria 16075
19 rootH1_10142970 3300003316 Bacteria 3249
20 rootH2_10010159 3300003320 Bacteria 33853
21 rootH2_10088336 3300003320 Bacteria 13237
22 rootL2_10103558 3300003322 Bacteria 1657
23 rootL2_10103559 3300003322 Bacteria 1802
24 rootH1_10003399 3300003323 Bacteria 54122
25 rootH1_10093161 3300003323 Bacteria 1873
26 Ga0055530_10005053 3300003791 Bacteria 6477
27 Ga0065714_10002204 3300005288 Bacteria 57902
28 Ga0065714_10004766 3300005288 Bacteria 5077
29 Ga0065714_10068860 3300005288 Bacteria 4506
30 Ga0065714_10115750 3300005288 Bacteria 1412
31 Ga0065704_10071596 3300005289 Bacteria 10546
32 Ga0070658_10000008 3300005327 Bacteria 319912
33 Ga0070658_10198972 3300005327 Bacteria 1690
34 Ga0070676_10001449 3300005328 Bacteria 12010
35 Ga0068868_100008265 3300005338 Bacteria 7452
36 Ga0068868_100125227 3300005338 Bacteria 2099
37 Ga0070660_100003427 3300005339 Bacteria 10909
38 Ga0070660_100052136 3300005339 Bacteria 3153
39 Ga0070660_100077249 3300005339 Bacteria 2609
40 Ga0070671_100011049 3300005355 Bacteria 7247
41 Ga0070674_100086120 3300005356 Bacteria 2256
42 Ga0070673_100003860 3300005364 Bacteria 9410
43 Ga0070659_100000262 3300005366 Bacteria 41533
44 Ga0070681_10048767 3300005458 Bacteria 4230
45 Ga0070679_100025582 3300005530 Bacteria 5794
46 Ga0070679_100161783 3300005530 Bacteria 2213
47 Ga0068853_100277951 3300005539 Bacteria 1543
48 Ga0068853_100557572 3300005539 Bacteria 1086
49 Ga0070665_100000061 3300005548 Bacteria 222138
50 Ga0068855_100000074 3300005563 Bacteria 119759
51 Ga0068855_100017943 3300005563 Bacteria 8503
52 Ga0068855_100023953 3300005563 Bacteria 7309
53 Ga0068855_100169238 3300005563 Bacteria 2475
54 Ga0068855_100218090 3300005563 Bacteria 2141
55 Ga0068855_100633528 3300005563 Bacteria 1150
56 Ga0068856_100000385 3300005614 Bacteria 48447
57 Ga0068856_100046164 3300005614 Bacteria 4291
58 Ga0068856_100411166 3300005614 Bacteria 1373
59 Ga0068856_100872425 3300005614 Bacteria 919
60 Ga0068852_100271388 3300005616 Bacteria 1632
61 Ga0068870_10425966 3300005840 Bacteria 869
62 Ga0068858_100126757 3300005842 Bacteria 2391
63 Ga0075366_10000170 3300006195 Bacteria 27881
64 Ga0075366_10005159 3300006195 Bacteria 7067
65 Ga0075366_10171574 3300006195 Bacteria 1316
66 Ga0097621_100000016 3300006237 Bacteria 91785
67 Ga0068865_100000214 3300006881 Bacteria 32364
68 Ga0068865_100414713 3300006881 Bacteria 1106
69 Ga0105244_10002729 3300009036 Bacteria 13178
70 Ga0105240_10000082 3300009093 Bacteria 195184
71 Ga0105240_10001333 3300009093 Bacteria 42441
72 Ga0105240_10039625 3300009093 Bacteria 6031
73 Ga0105240_10125146 3300009093 Bacteria 3090
74 Ga0105240_10158107 3300009093 Bacteria 2694
75 Ga0105240_10310430 3300009093 Bacteria 1801
76 Ga0105240_10312294 3300009093 Bacteria 1794
77 Ga0105240_10565856 3300009093 Bacteria 1256
78 Ga0105245_10270770 3300009098 Bacteria 1656
79 Ga0105241_10000116 3300009174 Bacteria 57591
80 Ga0105241_10056412 3300009174 Bacteria 3011
81 Ga0105241_10090257 3300009174 Bacteria 2416
82 Ga0105241_10291119 3300009174 Bacteria 1398
83 Ga0105242_10080767 3300009176 Bacteria 2718
84 Ga0105237_10000310 3300009545 Bacteria 67887
85 Ga0105237_10002729 3300009545 Bacteria 21530
86 Ga0105237_10003285 3300009545 Bacteria 19310
87 Ga0105237_10003434 3300009545 Bacteria 18811
88 Ga0105237_10009371 3300009545 Bacteria 10489
89 Ga0105237_10029215 3300009545 Bacteria 5608
90 Ga0105237_10225948 3300009545 Bacteria 1872
91 Ga0105237_10544806 3300009545 Bacteria 1167
92 Ga0105238_10158642 3300009551 Bacteria 2238
93 Ga0105238_10173035 3300009551 Bacteria 2136
94 Ga0105238_10446545 3300009551 Bacteria 1290
95 Ga0105239_10000009 3300010375 Bacteria 361182
96 Ga0105239_10000049 3300010375 Bacteria 177578
97 Ga0105239_10003303 3300010375 Bacteria 19863
98 Ga0105239_10008608 3300010375 Bacteria 11568
99 Ga0105239_10008871 3300010375 Bacteria 11379
100 Ga0105239_10028319 3300010375 Bacteria 6163
101 Ga0105246_10009914 3300011119 Bacteria 5877
102 Ga0157373_10000089 3300013100 Bacteria 78449
103 Ga0157373_10019892 3300013100 Bacteria 4884
104 Ga0157373_10025928 3300013100 Bacteria 4236
105 Ga0157373_10035857 3300013100 Bacteria 3560
106 Ga0157373_10064145 3300013100 Bacteria 2600
107 Ga0157371_10000025 3300013102 Bacteria 279746
108 Ga0157371_10003959 3300013102 Bacteria 13144
109 Ga0157371_10005219 3300013102 Bacteria 11043
110 Ga0157371_10010298 3300013102 Bacteria 7295
111 Ga0157371_10013702 3300013102 Bacteria 6149
112 Ga0157371_10101392 3300013102 Bacteria 2042
113 Ga0157371_10113390 3300013102 Bacteria 1925
114 Ga0157370_10004723 3300013104 Bacteria 15530
115 Ga0157370_10041161 3300013104 Bacteria 4460
116 Ga0157370_10043930 3300013104 Bacteria 4298
117 Ga0157370_10056152 3300013104 Bacteria 3748
118 Ga0157370_10076327 3300013104 Bacteria 3157
119 Ga0157370_10234196 3300013104 Bacteria 1699
120 Ga0157369_10000038 3300013105 Bacteria 189078
121 Ga0157369_10004248 3300013105 Bacteria 16965
122 Ga0157369_10044949 3300013105 Bacteria 4805
123 Ga0157369_10182414 3300013105 Bacteria 2208
124 Ga0157369_10254865 3300013105 Bacteria 1831
125 Ga0157374_10522425 3300013296 Bacteria 1193
126 Ga0157378_10006650 3300013297 Bacteria 10102
127 Ga0157378_10082618 3300013297 Bacteria 2905
128 Ga0157378_10636334 3300013297 Bacteria 1081
129 Ga0163162_10000012 3300013306 Bacteria 292674
130 Ga0163162_10000050 3300013306 Bacteria 120151
131 Ga0163162_10002529 3300013306 Bacteria 17304
132 Ga0163162_10010449 3300013306 Bacteria 9025
133 Ga0163162_10273134 3300013306 Bacteria 1822
134 Ga0157372_10000039 3300013307 Bacteria 165839
135 Ga0157372_10001390 3300013307 Bacteria 26087
136 Ga0157375_10014406 3300013308 Bacteria 7053
137 Ga0157375_10015032 3300013308 Bacteria 6923
138 Ga0157375_10087403 3300013308 Bacteria 3170
139 Ga0157375_10152227 3300013308 Bacteria 2449
140 Ga0157375_10632293 3300013308 Bacteria 1228
141 Ga0157375_10977899 3300013308 Bacteria 987
142 Ga0182008_10000020 3300014497 Bacteria 228333
143 Ga0182008_10000052 3300014497 Bacteria 103193
144 Ga0182008_10000053 3300014497 Bacteria 102934
145 Ga0182008_10033524 3300014497 Bacteria 2576
146 Ga0182008_10041675 3300014497 Bacteria 2290
147 Ga0182006_1000276 3300015261 Bacteria 45977
148 Ga0182006_1000555 3300015261 Bacteria 28085
149 Ga0182007_10000024 3300015262 Bacteria 181761
150 Ga0182007_10027559 3300015262 Bacteria 1957
151 Ga0182007_10050065 3300015262 Bacteria 1379
152 Ga0183373_1002 3300015682 Bacteria 990153
153 Ga0163161_10000093 3300017792 Bacteria 90618
154 Ga0163161_10000145 3300017792 Bacteria 64643
155 Ga0163161_10010007 3300017792 Bacteria 6567
156 Ga0163161_10030141 3300017792 Bacteria 3859
157 Ga0163161_10044855 3300017792 Bacteria 3186
158 Ga0207427_100122 3300025231 Bacteria 99064
159 Ga0209437_100048 3300025233 Bacteria 405107
160 Ga0209437_100119 3300025233 Bacteria 206549
161 Ga0207425_1000051 3300025245 Bacteria 166795
162 Ga0209026_1000304 3300025250 Bacteria 53704
163 Ga0209129_1000121 3300025258 Bacteria 135404
164 Ga0209233_1000029 3300025261 Bacteria 641642
165 Ga0209455_1004796 3300025272 Bacteria 4328
166 Ga0209676_1000022 3300025292 Bacteria 605659
167 Ga0209025_1000160 3300025294 Bacteria 166795
168 Ga0209758_1000147 3300025297 Bacteria 166795
169 Ga0209050_1000020 3300025298 Bacteria 605671
170 Ga0207655_1037965 3300025728 Bacteria 2112
171 Ga0207647_10000018 3300025904 Bacteria 124816
172 Ga0207645_10000172 3300025907 Bacteria 51794
173 Ga0207643_10039963 3300025908 Bacteria 2639
174 Ga0207705_10000026 3300025909 Bacteria 256051
175 Ga0207705_10072897 3300025909 Bacteria 2491
176 Ga0207654_10004989 3300025911 Bacteria 6710
177 Ga0207654_10025928 3300025911 Bacteria 3169
178 Ga0207654_10316168 3300025911 Bacteria 1066
179 Ga0207707_10216583 3300025912 Bacteria 1667
180 Ga0207695_10000053 3300025913 Bacteria 396740
181 Ga0207695_10006832 3300025913 Bacteria 14694
182 Ga0207695_10085426 3300025913 Bacteria 3184
183 Ga0207695_10133422 3300025913 Bacteria 2438
184 Ga0207695_10156606 3300025913 Bacteria 2213
185 Ga0207695_10225457 3300025913 Bacteria 1780
186 Ga0207671_10000366 3300025914 Bacteria 64454
187 Ga0207671_10000925 3300025914 Bacteria 36841
188 Ga0207671_10001993 3300025914 Bacteria 22502
189 Ga0207671_10007835 3300025914 Bacteria 9180
190 Ga0207671_10012842 3300025914 Bacteria 6709
191 Ga0207671_10062514 3300025914 Bacteria 2765
192 Ga0207671_10361695 3300025914 Bacteria 1152
193 Ga0207657_10037592 3300025919 Bacteria 4320
194 Ga0207657_10058404 3300025919 Bacteria 3320
195 Ga0207652_10044645 3300025921 Bacteria 3776
196 Ga0207652_10059778 3300025921 Bacteria 3286
197 Ga0207694_10018140 3300025924 Bacteria 5320
198 Ga0207694_10105659 3300025924 Bacteria 2236
199 Ga0207644_10007855 3300025931 Bacteria 6970
200 Ga0207690_10001178 3300025932 Bacteria 16550
201 Ga0207669_10366387 3300025937 Bacteria 1118
202 Ga0207704_10000354 3300025938 Bacteria 21443
203 Ga0207704_10281182 3300025938 Bacteria 1265
204 Ga0207667_10000014 3300025949 Bacteria 421261
205 Ga0207667_10000274 3300025949 Bacteria 71328
206 Ga0207667_10008386 3300025949 Bacteria 12280
207 Ga0207667_10081323 3300025949 Bacteria 3356
208 Ga0207667_10151939 3300025949 Bacteria 2383
209 Ga0207640_10283815 3300025981 Bacteria 1302
210 Ga0207677_10095852 3300026023 Bacteria 2169
211 Ga0207677_10103870 3300026023 Bacteria 2099
212 Ga0207702_10000586 3300026078 Bacteria 40370
213 Ga0207702_10036427 3300026078 Bacteria 4115
214 Ga0207702_10037437 3300026078 Bacteria 4061
215 Ga0207702_10192155 3300026078 Bacteria 1887
216 Ga0207702_10355158 3300026078 Bacteria 1403
217 Ga0207648_10000658 3300026089 Bacteria 38677
218 Ga0207698_10139536 3300026142 Bacteria 2086
219 Ga0207698_10463217 3300026142 Unclassified 1226
220 Ga0268266_10000053 3300028379 Bacteria 295181
221 Ga0307515_10000316 3300028794 Bacteria 119243
222 Ga0307515_10001308 3300028794 Bacteria 56577
223 Ga0307515_10164591 3300028794 Bacteria 2243
224 Ga0316181_1276095 3300030744 Bacteria 1786
225 Ga0307405_10000011 3300031731 Bacteria 241071
226 Ga0307407_10000018 3300031903 Bacteria 135979
227 Ga0307412_10000001 3300031911 Bacteria 822691
228 Ga0307409_100229006 3300031995 Bacteria 1683
229 Ga0307416_100000050 3300032002 Bacteria 116313
230 Ga0307414_10000980 3300032004 Bacteria 14558
231 Ga0307414_10002018 3300032004 Bacteria 10550
232 Ga0307414_10002147 3300032004 Bacteria 10297
233 Ga0307414_10091685 3300032004 Bacteria 2259
234 Ga0307411_10404091 3300032005 Bacteria 1130
235 Ga0395899_0000027 3300037312 Bacteria 337387
236 Ga0395899_0000282 3300037312 Bacteria 66053
237 Ga0395899_0001270 3300037312 Bacteria 21938
238 Ga0395900_0002423 3300037418 Bacteria 20558
239 Ga0395900_0009107 3300037418 Bacteria 10169
240 Ga0395898_0014682 3300037466 Bacteria 8043
241 Ga0395905_0000993 3300037471 Bacteria 36305
242 Ga0395905_0001272 3300037471 Bacteria 31128
243 Ga0395901_0000644 3300038443 Bacteria 40364
244 Ga0395901_0005293 3300038443 Bacteria 13041
245 Ga0439448_0083966 3300042005 Bacteria 1071
246 Ga0466966_0199733 3300044684 Bacteria 1210
247 Ga0466959_0186441 3300045049 Bacteria 1449
248 Ga0495650_0000144 3300046471 Bacteria 165957
249 Ga0495650_0064590 3300046471 Bacteria 1455
250 Ga0495605_0219450 3300046474 Bacteria 822
251 Ga0495585_0000091 3300046492 Bacteria 95620
252 Ga0495585_0000658 3300046492 Bacteria 31746
253 Ga0495583_0227772 3300046506 Bacteria 752
254 Ga0495606_0000919 3300046507 Bacteria 43453
255 Ga0495606_0013016 3300046507 Bacteria 6614
256 Ga0495606_0021189 3300046507 Bacteria 4764
257 Ga0495606_0021269 3300046507 Bacteria 4755
258 Ga0495606_0060821 3300046507 Bacteria 2418
259 Ga0495610_0000037 3300046512 Bacteria 186354
260 Ga0495610_0000574 3300046512 Bacteria 36619
261 Ga0495610_0008174 3300046512 Bacteria 6824
262 Ga0495616_0011104 3300046513 Bacteria 5175
263 Ga0495616_0011972 3300046513 Bacteria 4939
264 Ga0495628_0346181 3300046516 Bacteria 1093
265 Ga0495631_0120043 3300046518 Bacteria 1131
266 Ga0495632_0038573 3300046519 Bacteria 2418
267 Ga0495648_0018526 3300046524 Bacteria 4925
268 Ga0495648_0048395 3300046524 Bacteria 2617
269 Ga0495652_0398694 3300046529 Bacteria 975
270 Ga0495654_0050503 3300046530 Bacteria 2032
271 Ga0495609_0014382 3300046538 Bacteria 3721
272 Ga0495609_0082021 3300046538 Bacteria 1409
273 Ga0495633_0000026 3300046558 Bacteria 204722
274 Ga0495633_0007299 3300046558 Bacteria 6381
275 Ga0495633_0088382 3300046558 Bacteria 1441
276 Ga0495668_0000054 3300046616 Bacteria 203960
277 Ga0495668_0081772 3300046616 Bacteria 1772
278 Ga0495625_0000059 3300046660 Bacteria 180330
279 Ga0495625_0001227 3300046660 Bacteria 32490
280 Ga0495625_0003592 3300046660 Bacteria 15260
281 Ga0495625_0032221 3300046660 Bacteria 3890
282 Ga0495625_0116599 3300046660 Bacteria 1821
283 Ga0495625_0140575 3300046660 Bacteria 1629
284 Ga0495661_0003215 3300046665 Bacteria 12199
285 Ga0495661_0041449 3300046665 Bacteria 2848
286 Ga0495661_0052128 3300046665 Bacteria 2466
287 Ga0495661_0076061 3300046665 Bacteria 1949
288 Ga0495658_0228031 3300046683 Bacteria 1167
289 Ga0495671_0102572 3300046692 Bacteria 1398
290 Ga0495687_001100 3300047443 Bacteria 26388
291 Ga0495687_042827 3300047443 Bacteria 1975
292 Ga0495686_0002591 3300047472 Bacteria 16802
293 Ga0495686_0048542 3300047472 Bacteria 2676
294 Ga0495686_0214089 3300047472 Bacteria 1099
295 Ga0495686_0382361 3300047472 Bacteria 759
296 Ga0496122_0000876 3300048925 Bacteria 56653
297 Ga0496123_0000777 3300048926 Bacteria 51679
298 Ga0495678_008057 3300049459 Bacteria 5372
299 Ga0495678_068679 3300049459 Bacteria 1306
300 Ga0495682_0030456 3300049460 Bacteria 1996
301 Ga0501249_004504 3300049679 Bacteria 2830
302 Ga0501241_007237 3300049758 Bacteria 2033
303 nmdc:mga0k408_1202_c1 3300050493 Bacteria 14176
304 nmdc:mga0k408_138116_c1 3300050493 Bacteria 1449
305 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
306 Ga0500651_0000058 3300053093 Bacteria 72493
307 Ga0500608_001755 3300053122 Bacteria 7747
308 Ga0500618_000018 3300053125 Bacteria 163272
309 Ga0500642_0127809 3300053130 Bacteria 1190
310 Ga0500616_0148437 3300053153 Bacteria 1088
311 Ga0500619_152739 3300053154 Bacteria 785
312 Ga0500624_000264 3300053157 Bacteria 18308
313 Ga0500634_0107602 3300053161 Bacteria 1383
314 2586210189 2585427687 Bacteria 5544917
315 2599481993 2599185184 Bacteria 6430550
316 2738756078 2738541283 Bacteria 7222293
317 2738763298 2738541284 Bacteria 5199923
318 2738852458 2738541302 Bacteria 5944758
319 2739304160 2738543023 Bacteria 6767879
320 2739591433 2739367651 Bacteria 6359826
321 2739615251 2739367656 Bacteria 5152243
322 2739645622 2739367663 Bacteria 5040914
323 2776616095 2775506987 Bacteria 5373360
324 2819549585 2818991437 Bacteria 5805520
325 2842727339 2842722452 Bacteria 6263924
326 2842913736 2842909656 Bacteria 6185908
327 2849285429 2849281842 Bacteria 6065644
328 2852625521 2852623160 Bacteria 4376875
329 2857628246 2857627736 Bacteria 5625397
330 2884934524 2884933994 Bacteria 4535041
331 2904447282 2904445276 Bacteria 5310396
332 2919190622 2919186247 Bacteria 6244071
333 2919440532 2919437846 Bacteria 6199444
334 2928082101 2928078545 Bacteria 6534839
335 2928149321 2928147474 Bacteria 6512076
336 2932087943 2932082852 Bacteria 6563563
337 2939669168 2939664404 Bacteria 6364494
338 2945998340 2945997725 Bacteria 6404843
339 2954020805 2954016120 Bacteria 6446024
340 2977234204 2977232053 Bacteria 5485925
341 Ga0068856_100033530
342 SwRhRL2b_contig_2637238
343 JGI24736J21556_1010516
344 JGI24739J22299_10011148
345 JGI24739J22299_10022622
346 JGI24737J22298_10000116
347 JGI24735J21928_10000015
348 JGI24744J21845_10004366
349 JGI25162J39368_1000016
350 JGI25162J39368_1000866
351 JGI25157J39369_1005975
352 JGI25164J39214_1001979
353 JGI25152J39213_1001261
354 JGI25150J39212_1000023
355 JGI25151J46595_10000082
356 JGI25165J46597_1001674
357 JGI25153J46596_10000060
358 rootH1_10034433
359 rootH1_10142970
360 rootH2_10010159
361 rootH2_10088336
362 rootL2_10103558
363 rootL2_10103559
364 rootH1_10003399
365 rootH1_10093161
366 Ga0055530_10005053
367 Ga0065714_10002204
368 Ga0065714_10004766
369 Ga0065714_10068860
370 Ga0065714_10115750
371 Ga0065704_10071596
372 Ga0070658_10000008
373 Ga0070658_10198972
374 Ga0070676_10001449
375 Ga0068868_100008265
376 Ga0068868_100125227
377 Ga0070660_100003427
378 Ga0070660_100052136
379 Ga0070660_100077249
380 Ga0070671_100011049
381 Ga0070674_100086120
382 Ga0070673_100003860
383 Ga0070659_100000262
384 Ga0070681_10048767
385 Ga0070679_100025582
386 Ga0070679_100161783
387 Ga0068853_100277951
388 Ga0068853_100557572
389 Ga0070665_100000061
390 Ga0068855_100000074
391 Ga0068855_100017943
392 Ga0068855_100023953
393 Ga0068855_100169238
394 Ga0068855_100218090
395 Ga0068855_100633528
396 Ga0068856_100000385
397 Ga0068856_100046164
398 Ga0068856_100411166
399 Ga0068856_100872425
400 Ga0068852_100271388
401 Ga0068870_10425966
402 Ga0068858_100126757
403 Ga0075366_10000170
404 Ga0075366_10005159
405 Ga0075366_10171574
406 Ga0097621_100000016
407 Ga0068865_100000214
408 Ga0068865_100414713
409 Ga0105244_10002729
410 Ga0105240_10000082
411 Ga0105240_10001333
412 Ga0105240_10039625
413 Ga0105240_10125146
414 Ga0105240_10158107
415 Ga0105240_10310430
416 Ga0105240_10312294
417 Ga0105240_10565856
418 Ga0105245_10270770
419 Ga0105241_10000116
420 Ga0105241_10056412
421 Ga0105241_10090257
422 Ga0105241_10291119
423 Ga0105242_10080767
424 Ga0105237_10000310
425 Ga0105237_10002729
426 Ga0105237_10003285
427 Ga0105237_10003434
428 Ga0105237_10009371
429 Ga0105237_10029215
430 Ga0105237_10225948
431 Ga0105237_10544806
432 Ga0105238_10158642
433 Ga0105238_10173035
434 Ga0105238_10446545
435 Ga0105239_10000009
436 Ga0105239_10000049
437 Ga0105239_10003303
438 Ga0105239_10008608
439 Ga0105239_10008871
440 Ga0105239_10028319
441 Ga0105246_10009914
442 Ga0157373_10000089
443 Ga0157373_10019892
444 Ga0157373_10025928
445 Ga0157373_10035857
446 Ga0157373_10064145
447 Ga0157371_10000025
448 Ga0157371_10003959
449 Ga0157371_10005219
450 Ga0157371_10010298
451 Ga0157371_10013702
452 Ga0157371_10101392
453 Ga0157371_10113390
454 Ga0157370_10004723
455 Ga0157370_10041161
456 Ga0157370_10043930
457 Ga0157370_10056152
458 Ga0157370_10076327
459 Ga0157370_10234196
460 Ga0157369_10000038
461 Ga0157369_10004248
462 Ga0157369_10044949
463 Ga0157369_10182414
464 Ga0157369_10254865
465 Ga0157374_10522425
466 Ga0157378_10006650
467 Ga0157378_10082618
468 Ga0157378_10636334
469 Ga0163162_10000012
470 Ga0163162_10000050
471 Ga0163162_10002529
472 Ga0163162_10010449
473 Ga0163162_10273134
474 Ga0157372_10000039
475 Ga0157372_10001390
476 Ga0157375_10014406
477 Ga0157375_10015032
478 Ga0157375_10087403
479 Ga0157375_10152227
480 Ga0157375_10632293
481 Ga0157375_10977899
482 Ga0182008_10000020
483 Ga0182008_10000052
484 Ga0182008_10000053
485 Ga0182008_10033524
486 Ga0182008_10041675
487 Ga0182006_1000276
488 Ga0182006_1000555
489 Ga0182007_10000024
490 Ga0182007_10027559
491 Ga0182007_10050065
492 Ga0183373_1002
493 Ga0163161_10000093
494 Ga0163161_10000145
495 Ga0163161_10010007
496 Ga0163161_10030141
497 Ga0163161_10044855
498 Ga0207427_100122
499 Ga0209437_100048
500 Ga0209437_100119
501 Ga0207425_1000051
502 Ga0209026_1000304
503 Ga0209129_1000121
504 Ga0209233_1000029
505 Ga0209455_1004796
506 Ga0209676_1000022
507 Ga0209025_1000160
508 Ga0209758_1000147
509 Ga0209050_1000020
510 Ga0207655_1037965
511 Ga0207647_10000018
512 Ga0207645_10000172
513 Ga0207643_10039963
514 Ga0207705_10000026
515 Ga0207705_10072897
516 Ga0207654_10004989
517 Ga0207654_10025928
518 Ga0207654_10316168
519 Ga0207707_10216583
520 Ga0207695_10000053
521 Ga0207695_10006832
522 Ga0207695_10085426
523 Ga0207695_10133422
524 Ga0207695_10156606
525 Ga0207695_10225457
526 Ga0207671_10000366
527 Ga0207671_10000925
528 Ga0207671_10001993
529 Ga0207671_10007835
530 Ga0207671_10012842
531 Ga0207671_10062514
532 Ga0207671_10361695
533 Ga0207657_10037592
534 Ga0207657_10058404
535 Ga0207652_10044645
536 Ga0207652_10059778
537 Ga0207694_10018140
538 Ga0207694_10105659
539 Ga0207644_10007855
540 Ga0207690_10001178
541 Ga0207669_10366387
542 Ga0207704_10000354
543 Ga0207704_10281182
544 Ga0207667_10000014
545 Ga0207667_10000274
546 Ga0207667_10008386
547 Ga0207667_10081323
548 Ga0207667_10151939
549 Ga0207640_10283815
550 Ga0207677_10095852
551 Ga0207677_10103870
552 Ga0207702_10000586
553 Ga0207702_10036427
554 Ga0207702_10037437
555 Ga0207702_10192155
556 Ga0207702_10355158
557 Ga0207648_10000658
558 Ga0207698_10139536
559 Ga0207698_10463217
560 Ga0268266_10000053
561 Ga0307515_10000316
562 Ga0307515_10001308
563 Ga0307515_10164591
564 Ga0316181_1276095
565 Ga0307405_10000011
566 Ga0307407_10000018
567 Ga0307412_10000001
568 Ga0307409_100229006
569 Ga0307416_100000050
570 Ga0307414_10000980
571 Ga0307414_10002018
572 Ga0307414_10002147
573 Ga0307414_10091685
574 Ga0307411_10404091
575 Ga0395899_0000027
576 Ga0395899_0000282
577 Ga0395899_0001270
578 Ga0395900_0002423
579 Ga0395900_0009107
580 Ga0395898_0014682
581 Ga0395905_0000993
582 Ga0395905_0001272
583 Ga0395901_0000644
584 Ga0395901_0005293
585 Ga0439448_0083966
586 Ga0466966_0199733
587 Ga0466959_0186441
588 Ga0495650_0000144
589 Ga0495650_0064590
590 Ga0495605_0219450
591 Ga0495585_0000091
592 Ga0495585_0000658
593 Ga0495583_0227772
594 Ga0495606_0000919
595 Ga0495606_0013016
596 Ga0495606_0021189
597 Ga0495606_0021269
598 Ga0495606_0060821
599 Ga0495610_0000037
600 Ga0495610_0000574
601 Ga0495610_0008174
602 Ga0495616_0011104
603 Ga0495616_0011972
604 Ga0495628_0346181
605 Ga0495631_0120043
606 Ga0495632_0038573
607 Ga0495648_0018526
608 Ga0495648_0048395
609 Ga0495652_0398694
610 Ga0495654_0050503
611 Ga0495609_0014382
612 Ga0495609_0082021
613 Ga0495633_0000026
614 Ga0495633_0007299
615 Ga0495633_0088382
616 Ga0495668_0000054
617 Ga0495668_0081772
618 Ga0495625_0000059
619 Ga0495625_0001227
620 Ga0495625_0003592
621 Ga0495625_0032221
622 Ga0495625_0116599
623 Ga0495625_0140575
624 Ga0495661_0003215
625 Ga0495661_0041449
626 Ga0495661_0052128
627 Ga0495661_0076061
628 Ga0495658_0228031
629 Ga0495671_0102572
630 Ga0495687_001100
631 Ga0495687_042827
632 Ga0495686_0002591
633 Ga0495686_0048542
634 Ga0495686_0214089
635 Ga0495686_0382361
636 Ga0496122_0000876
637 Ga0496123_0000777
638 Ga0495678_008057
639 Ga0495678_068679
640 Ga0495682_0030456
641 Ga0501249_004504
642 Ga0501241_007237
643 nmdc:mga0k408_1202_c1
644 nmdc:mga0k408_138116_c1
645 nmdc:mga0k408_82_c1
646 Ga0500651_0000058
647 Ga0500608_001755
648 Ga0500618_000018
649 Ga0500642_0127809
650 Ga0500616_0148437
651 Ga0500619_152739
652 Ga0500624_000264
653 Ga0500634_0107602
654 2586210189
655 2599481993
656 2738756078
657 2738763298
658 2738852458
659 2739304160
660 2739591433
661 2739615251
662 2739645622
663 2776616095
664 2819549585
665 2842727339
666 2842913736
667 2849285429
668 2852625521
669 2857628246
670 2884934524
671 2904447282
672 2919190622
673 2919440532
674 2928082101
675 2928149321
676 2932087943
677 2939669168
678 2945998340
679 2954020805
680 2977234204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

207

255

0.96

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

59

248

0.75

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

62

254

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.9265 2 228
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.915 2 228
3i76-assembly1.cif.gz_A the crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement 0.9096 2 228
8i8b-assembly1.cif.gz_J outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) 0.8972 107 152
3i76-assembly1.cif.gz_A the crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement 0.8865 2 228
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.933 105 205 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9306 110 203 3.40.50.1000
3i76A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9299 107 228 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9292 105 225 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.922 106 225 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A4V2MRF0-F1-model_v4 Noncanonical pyrimidine nucleotidase, YjjG family 0.9975 1 229 GO:0008253
AF-A0A6M1Q7G1-F1-model_v4 deleted 0.9961 94 229
AF-A0A7X6BSP4-F1-model_v4 deleted 0.9849 2 229
AF-A0A7T9NJJ7-F1-model_v4 deleted 0.9836 2 229
AF-A0A6M1Q7G1-F1-model_v4 deleted 0.9817 94 229

Map