F414396

General Info

Members Datasets Scaffolds Average Seq Length
340 224 340 225

Family's Representative Sequence

Representative Sequence 3300031727|Ga0316576_10163533|Ga0316576_101635332
Length 244
Sequence MTRADTLAARLADLEQQIRGACQRAGRPPEQVTLVAVSKRKPASDILAARSVGQVDFGENYAQELRDKARALHEAPEAAGLRWHYIGPLQRNKVKYVVGTAALVHTVDHPKILAALEQRAVAQGVTQEVLVQVNLAEEPQKSGVHRDELPALLDAFADAPHAPCRGLMLMPPWDPNPEAARPLFRRLRQLRDELAQQPRDNVRLEHLSMGMSHDFAVAIEEGATLVRVGTAIFGERDTPPPADP

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
172 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
173 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
174 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
175 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
176 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
180 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
181 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
182 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
183 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
184 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
193 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
194 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
204 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
209 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
214 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
215 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.29
Rhizosphere 93.82
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_7619764 2162886012 Bacteria 2462
2 JGI24747J21853_1004693 3300001978 Bacteria 1236
3 JGI24749J21850_1001246 3300002076 Bacteria 3615
4 JGI24034J26672_10004618 3300002239 Bacteria 1957
5 JGI24751J29686_10020748 3300002459 Bacteria 1361
6 Ga0065715_10091424 3300005293 Bacteria 5802
7 Ga0065707_10190131 3300005295 Bacteria 1366
8 Ga0070658_10002215 3300005327 Bacteria 16312
9 Ga0070658_10553375 3300005327 Bacteria 996
10 Ga0070676_10000401 3300005328 Bacteria 20189
11 Ga0070683_100001928 3300005329 Bacteria 16243
12 Ga0070683_100008980 3300005329 Bacteria 8519
13 Ga0070683_100083582 3300005329 Bacteria 2990
14 Ga0070683_100354948 3300005329 Bacteria 1396
15 Ga0070690_100001344 3300005330 Bacteria 12780
16 Ga0070670_100040583 3300005331 Bacteria 4001
17 Ga0070670_100167176 3300005331 Bacteria 1907
18 Ga0070677_10000491 3300005333 Bacteria 13604
19 Ga0068869_100000498 3300005334 Bacteria 21856
20 Ga0070666_10131029 3300005335 Bacteria 1742
21 Ga0070680_100008207 3300005336 Bacteria 7982
22 Ga0070680_100027955 3300005336 Bacteria 4521
23 Ga0070680_100055149 3300005336 Bacteria 3247
24 Ga0070682_100033653 3300005337 Unclassified 3116
25 Ga0068868_100002561 3300005338 Bacteria 12625
26 Ga0070660_100000307 3300005339 Bacteria 32493
27 Ga0070689_100001635 3300005340 Bacteria 14329
28 Ga0070689_100007567 3300005340 Bacteria 7605
29 Ga0070689_100023049 3300005340 Bacteria 4657
30 Ga0070691_10138034 3300005341 Bacteria 1240
31 Ga0070687_100000021 3300005343 Bacteria 52715
32 Ga0070687_100055437 3300005343 Bacteria 2070
33 Ga0070661_100000275 3300005344 Bacteria 41665
34 Ga0070661_100041278 3300005344 Bacteria 3367
35 Ga0070668_100002913 3300005347 Bacteria 12648
36 Ga0070668_100220302 3300005347 Bacteria 1565
37 Ga0070669_100001819 3300005353 Bacteria 15356
38 Ga0070669_100014639 3300005353 Bacteria 5583
39 Ga0070671_100159895 3300005355 Bacteria 1904
40 Ga0070671_100447639 3300005355 Bacteria 1108
41 Ga0070674_100001490 3300005356 Bacteria 12483
42 Ga0070674_100002895 3300005356 Bacteria 9501
43 Ga0070673_100000260 3300005364 Bacteria 26954
44 Ga0070673_100001923 3300005364 Bacteria 12478
45 Ga0070673_100137376 3300005364 Bacteria 2059
46 Ga0070688_100000503 3300005365 Bacteria 19727
47 Ga0070659_100000146 3300005366 Bacteria 54086
48 Ga0070701_10003638 3300005438 Bacteria 6133
49 Ga0070701_10038068 3300005438 Bacteria 2432
50 Ga0070705_100000176 3300005440 Bacteria 37077
51 Ga0070700_100001901 3300005441 Bacteria 10554
52 Ga0070700_100031472 3300005441 Bacteria 3180
53 Ga0070694_100180716 3300005444 Bacteria 1560
54 Ga0070708_100004915 3300005445 Bacteria 10563
55 Ga0070663_100018468 3300005455 Bacteria 4574
56 Ga0070663_100651292 3300005455 Bacteria 891
57 Ga0070678_100096578 3300005456 Bacteria 2280
58 Ga0070678_100177083 3300005456 Bacteria 1742
59 Ga0070662_100001963 3300005457 Bacteria 12630
60 Ga0070681_10018492 3300005458 Bacteria 6965
61 Ga0070681_10027727 3300005458 Bacteria 5694
62 Ga0070681_10105096 3300005458 Bacteria 2766
63 Ga0070681_10134859 3300005458 Bacteria 2399
64 Ga0070681_10451798 3300005458 Bacteria 1197
65 Ga0068867_100001282 3300005459 Bacteria 17312
66 Ga0068867_100102046 3300005459 Bacteria 2192
67 Ga0068867_100248621 3300005459 Bacteria 1445
68 Ga0070685_10000218 3300005466 Bacteria 37941
69 Ga0070685_10179438 3300005466 Bacteria 1362
70 Ga0070706_100000014 3300005467 Bacteria 191079
71 Ga0070707_100003040 3300005468 Bacteria 15900
72 Ga0070698_100266153 3300005471 Bacteria 1646
73 Ga0070699_100031788 3300005518 Bacteria 4558
74 Ga0070679_100027888 3300005530 Bacteria 5563
75 Ga0070679_100028861 3300005530 Bacteria 5472
76 Ga0070679_100110312 3300005530 Bacteria 2737
77 Ga0070679_100347488 3300005530 Bacteria 1431
78 Ga0070684_100003546 3300005535 Bacteria 11728
79 Ga0070684_100007239 3300005535 Bacteria 8624
80 Ga0070684_100068916 3300005535 Unclassified 3110
81 Ga0070684_100250679 3300005535 Bacteria 1618
82 Ga0070697_100002117 3300005536 Bacteria 15211
83 Ga0068853_100000652 3300005539 Bacteria 23841
84 Ga0070672_100000190 3300005543 Bacteria 34062
85 Ga0070672_100042158 3300005543 Bacteria 3513
86 Ga0070672_100104224 3300005543 Bacteria 2304
87 Ga0070686_100001647 3300005544 Bacteria 12468
88 Ga0070686_100062022 3300005544 Bacteria 2417
89 Ga0070695_100016975 3300005545 Bacteria 4414
90 Ga0070696_100302522 3300005546 Bacteria 1225
91 Ga0070693_100011750 3300005547 Bacteria 4415
92 Ga0070665_100258567 3300005548 Bacteria 1742
93 Ga0070665_100351305 3300005548 Bacteria 1480
94 Ga0068855_100003791 3300005563 Bacteria 18493
95 Ga0068855_100328753 3300005563 Bacteria 1688
96 Ga0070664_100000611 3300005564 Bacteria 27321
97 Ga0070664_100001487 3300005564 Bacteria 18660
98 Ga0068857_100000171 3300005577 Bacteria 40881
99 Ga0068857_100013419 3300005577 Bacteria 7137
100 Ga0068854_100000555 3300005578 Bacteria 22486
101 Ga0068856_100000921 3300005614 Bacteria 31497
102 Ga0068856_100040027 3300005614 Bacteria 4603
103 Ga0068856_100109203 3300005614 Bacteria 2762
104 Ga0070702_100063975 3300005615 Bacteria 2150
105 Ga0070702_100099228 3300005615 Bacteria 1783
106 Ga0068852_100000149 3300005616 Bacteria 46878
107 Ga0068859_100009432 3300005617 Bacteria 9861
108 Ga0068864_100000267 3300005618 Bacteria 46395
109 Ga0068866_10000052 3300005718 Bacteria 45165
110 Ga0068861_100000219 3300005719 Bacteria 30886
111 Ga0068851_10003524 3300005834 Bacteria 6962
112 Ga0068870_10000014 3300005840 Bacteria 63363
113 Ga0068863_100497612 3300005841 Bacteria 1200
114 Ga0068863_101055875 3300005841 Bacteria 816
115 Ga0068858_100011723 3300005842 Bacteria 8267
116 Ga0068858_100501228 3300005842 Bacteria 1173
117 Ga0068860_100023992 3300005843 Bacteria 5896
118 Ga0068860_100025446 3300005843 Bacteria 5710
119 Ga0068862_100001474 3300005844 Bacteria 21578
120 Ga0081540_1000062 3300005983 Bacteria 119556
121 Ga0081540_1000291 3300005983 Bacteria 52600
122 Ga0081540_1001825 3300005983 Bacteria 17884
123 Ga0070717_10075033 3300006028 Bacteria 2828
124 Ga0097621_100000911 3300006237 Bacteria 20655
125 Ga0068871_100002486 3300006358 Bacteria 12571
126 Ga0075430_100237766 3300006846 Bacteria 1510
127 Ga0075431_100067678 3300006847 Bacteria 3687
128 Ga0075434_100332333 3300006871 Bacteria 1540
129 Ga0068865_100004424 3300006881 Bacteria 8471
130 Ga0068865_100016309 3300006881 Bacteria 4752
131 Ga0097620_100009432 3300006931 Bacteria 9861
132 Ga0099794_10000023 3300007265 Bacteria 65487
133 Ga0105240_10018808 3300009093 Bacteria 9255
134 Ga0111539_11122358 3300009094 Bacteria 914
135 Ga0105245_10000472 3300009098 Bacteria 36748
136 Ga0105247_10001806 3300009101 Bacteria 15009
137 Ga0105247_10327591 3300009101 Bacteria 1071
138 Ga0105243_10003352 3300009148 Bacteria 12994
139 Ga0105241_10002649 3300009174 Bacteria 13405
140 Ga0105242_10000236 3300009176 Bacteria 43526
141 Ga0105248_10023447 3300009177 Bacteria 6856
142 Ga0105237_10000920 3300009545 Bacteria 39577
143 Ga0105238_10000349 3300009551 Bacteria 49771
144 Ga0105249_10000378 3300009553 Bacteria 44184
145 Ga0105239_10000911 3300010375 Bacteria 41958
146 Ga0105239_10477246 3300010375 Bacteria 1417
147 Ga0105246_10004491 3300011119 Bacteria 8486
148 Ga0157373_10010635 3300013100 Bacteria 6771
149 Ga0157371_10000763 3300013102 Bacteria 37185
150 Ga0157369_10000611 3300013105 Bacteria 46408
151 Ga0157374_10001118 3300013296 Bacteria 23060
152 Ga0157374_10695971 3300013296 Bacteria 1029
153 Ga0157378_10000617 3300013297 Bacteria 33479
154 Ga0157378_10131061 3300013297 Bacteria 2321
155 Ga0163162_10028522 3300013306 Bacteria 5524
156 Ga0157372_10005954 3300013307 Bacteria 12962
157 Ga0157372_10236614 3300013307 Bacteria 2118
158 Ga0157375_10002005 3300013308 Bacteria 17567
159 Ga0157375_10400429 3300013308 Bacteria 1539
160 Ga0163163_10005330 3300014325 Bacteria 11110
161 Ga0157377_10000942 3300014745 Bacteria 12177
162 Ga0157379_10000914 3300014968 Bacteria 23823
163 Ga0157376_10000255 3300014969 Bacteria 36674
164 Ga0207697_10000289 3300025315 Bacteria 27991
165 Ga0207656_10000072 3300025321 Bacteria 37238
166 Ga0207682_10000070 3300025893 Bacteria 44852
167 Ga0207642_10000368 3300025899 Bacteria 13578
168 Ga0207710_10001078 3300025900 Bacteria 14072
169 Ga0207710_10257065 3300025900 Bacteria 874
170 Ga0207688_10000008 3300025901 Bacteria 62580
171 Ga0207680_10000580 3300025903 Bacteria 17275
172 Ga0207680_10179445 3300025903 Bacteria 1431
173 Ga0207647_10001135 3300025904 Bacteria 20531
174 Ga0207645_10000008 3300025907 Bacteria 158682
175 Ga0207645_10007843 3300025907 Bacteria 7509
176 Ga0207643_10000008 3300025908 Bacteria 163521
177 Ga0207705_10002885 3300025909 Bacteria 13157
178 Ga0207684_10000067 3300025910 Bacteria 191345
179 Ga0207654_10004399 3300025911 Bacteria 7101
180 Ga0207707_10043974 3300025912 Bacteria 3894
181 Ga0207707_10067421 3300025912 Bacteria 3117
182 Ga0207707_10118757 3300025912 Bacteria 2311
183 Ga0207707_10159399 3300025912 Bacteria 1973
184 Ga0207707_10176775 3300025912 Bacteria 1865
185 Ga0207695_10018214 3300025913 Bacteria 8127
186 Ga0207671_10002690 3300025914 Bacteria 18638
187 Ga0207660_10026537 3300025917 Bacteria 3946
188 Ga0207660_10075725 3300025917 Bacteria 2459
189 Ga0207660_10270844 3300025917 Bacteria 1345
190 Ga0207662_10000012 3300025918 Bacteria 90502
191 Ga0207662_10179576 3300025918 Bacteria 1361
192 Ga0207657_10000094 3300025919 Bacteria 85112
193 Ga0207649_10001035 3300025920 Bacteria 17094
194 Ga0207649_10039106 3300025920 Bacteria 2874
195 Ga0207652_10102067 3300025921 Bacteria 2534
196 Ga0207652_10156969 3300025921 Bacteria 2039
197 Ga0207652_10413911 3300025921 Bacteria 1216
198 Ga0207652_10720354 3300025921 Bacteria 889
199 Ga0207646_10022464 3300025922 Bacteria 5811
200 Ga0207681_10000567 3300025923 Bacteria 25268
201 Ga0207681_10001884 3300025923 Bacteria 13418
202 Ga0207694_10007457 3300025924 Bacteria 8291
203 Ga0207650_10000222 3300025925 Bacteria 64400
204 Ga0207650_10048056 3300025925 Bacteria 3145
205 Ga0207659_10000194 3300025926 Bacteria 36228
206 Ga0207687_10011746 3300025927 Bacteria 5730
207 Ga0207644_10000890 3300025931 Bacteria 18867
208 Ga0207690_10000612 3300025932 Bacteria 23054
209 Ga0207706_10000118 3300025933 Bacteria 84834
210 Ga0207686_10001040 3300025934 Bacteria 16424
211 Ga0207709_10003765 3300025935 Bacteria 8918
212 Ga0207670_10000192 3300025936 Bacteria 40572
213 Ga0207670_10005373 3300025936 Bacteria 7026
214 Ga0207670_10022514 3300025936 Bacteria 3907
215 Ga0207670_10566452 3300025936 Bacteria 930
216 Ga0207669_10000516 3300025937 Bacteria 16910
217 Ga0207704_10000228 3300025938 Bacteria 27910
218 Ga0207704_10031588 3300025938 Bacteria 2986
219 Ga0207691_10000074 3300025940 Bacteria 83272
220 Ga0207691_10009161 3300025940 Bacteria 9499
221 Ga0207691_10029430 3300025940 Bacteria 5138
222 Ga0207711_10000820 3300025941 Bacteria 30354
223 Ga0207689_10000093 3300025942 Bacteria 72709
224 Ga0207689_10402112 3300025942 Bacteria 1142
225 Ga0207661_10013755 3300025944 Bacteria 5910
226 Ga0207661_10017788 3300025944 Bacteria 5268
227 Ga0207661_10040530 3300025944 Bacteria 3661
228 Ga0207661_10336780 3300025944 Bacteria 1359
229 Ga0207679_10000134 3300025945 Bacteria 60399
230 Ga0207679_10000197 3300025945 Bacteria 48351
231 Ga0207667_10002415 3300025949 Bacteria 23402
232 Ga0207667_10455102 3300025949 Bacteria 1300
233 Ga0207651_10000037 3300025960 Bacteria 63878
234 Ga0207651_10000844 3300025960 Bacteria 13317
235 Ga0207712_10000820 3300025961 Bacteria 22874
236 Ga0207668_10001413 3300025972 Bacteria 14119
237 Ga0207668_10007838 3300025972 Bacteria 6353
238 Ga0207640_10000487 3300025981 Bacteria 24113
239 Ga0207658_10000162 3300025986 Bacteria 71223
240 Ga0207658_10037030 3300025986 Bacteria 3502
241 Ga0207677_10000149 3300026023 Bacteria 56199
242 Ga0207703_10000748 3300026035 Bacteria 32050
243 Ga0207703_10700824 3300026035 Bacteria 963
244 Ga0207639_10005889 3300026041 Bacteria 8307
245 Ga0207678_10001754 3300026067 Bacteria 19865
246 Ga0207678_10595254 3300026067 Bacteria 969
247 Ga0207708_10000861 3300026075 Bacteria 22880
248 Ga0207708_10011189 3300026075 Bacteria 6677
249 Ga0207702_10008872 3300026078 Bacteria 8477
250 Ga0207702_10176574 3300026078 Bacteria 1963
251 Ga0207702_10783623 3300026078 Bacteria 942
252 Ga0207641_10020924 3300026088 Bacteria 5377
253 Ga0207648_10000183 3300026089 Bacteria 66175
254 Ga0207648_10043045 3300026089 Bacteria 3965
255 Ga0207648_10543843 3300026089 Bacteria 1066
256 Ga0207676_10002608 3300026095 Bacteria 12852
257 Ga0207674_10002325 3300026116 Bacteria 24070
258 Ga0207674_10020883 3300026116 Bacteria 7066
259 Ga0207674_10086322 3300026116 Bacteria 3133
260 Ga0207675_100000008 3300026118 Bacteria 182355
261 Ga0207683_10000407 3300026121 Bacteria 39639
262 Ga0207683_10159474 3300026121 Bacteria 2038
263 Ga0207698_10000380 3300026142 Bacteria 25719
264 Ga0209588_1000007 3300027671 Bacteria 183924
265 Ga0268266_10000447 3300028379 Bacteria 61156
266 Ga0268266_10225353 3300028379 Bacteria 1725
267 Ga0268265_10000207 3300028380 Bacteria 68399
268 Ga0268265_10063881 3300028380 Bacteria 2834
269 Ga0268264_10000444 3300028381 Bacteria 56918
270 Ga0268264_10016400 3300028381 Bacteria 6064
271 Ga0268264_10249226 3300028381 Bacteria 1649
272 Ga0265337_1058521 3300028556 Bacteria 1071
273 Ga0265319_1080038 3300028563 Bacteria 1038
274 Ga0265323_10096983 3300028653 Bacteria 979
275 Ga0265338_10006912 3300028800 Bacteria 14279
276 Ga0265330_10054077 3300031235 Bacteria 1756
277 Ga0265325_10032241 3300031241 Bacteria 2798
278 Ga0307509_10019397 3300031507 Bacteria 7756
279 Ga0265313_10134432 3300031595 Bacteria 1068
280 Ga0316576_10004302 3300031727 Bacteria 8518
281 Ga0316576_10005919 3300031727 Bacteria 7549
282 Ga0316576_10163533 3300031727 Bacteria 1679
283 Ga0316578_10007495 3300031728 Bacteria 5478
284 Ga0316578_10028740 3300031728 Bacteria 3151
285 Ga0307405_10453135 3300031731 Bacteria 1018
286 Ga0307407_10402617 3300031903 Bacteria 982
287 Ga0307510_10323000 3300033180 Bacteria 1000
288 Ga0373934_0163989 3300035086 Bacteria 912
289 Ga0373939_0158551 3300035114 Bacteria 829
290 Ga0373943_0004416 3300035170 Bacteria 6368
291 Ga0373935_0051225 3300035692 Bacteria 2622
292 Ga0373933_0221618 3300035724 Bacteria 1214
293 Ga0373937_0070296 3300036401 Bacteria 3229
294 Ga0373937_0370508 3300036401 Bacteria 1358
295 Ga0316584_0000303 3300036712 Bacteria 25230
296 Ga0316584_0196616 3300036712 Unclassified 1489
297 Ga0395905_0109568 3300037471 Bacteria 2593
298 Ga0436360_0958712 3300039438 Bacteria 1014
299 Ga0436361_1069224 3300039447 Bacteria 1674
300 Ga0451853_3001745 3300041512 Bacteria 813
301 Ga0451577_0375711 3300042876 Bacteria 1289
302 Ga0466959_0077264 3300045049 Bacteria 2403
303 Ga0451576_0017020 3300045051 Bacteria 8003
304 Ga0451576_0036273 3300045051 Bacteria 5228
305 Ga0495651_0364189 3300046462 Bacteria 952
306 Ga0495580_0055358 3300046472 Bacteria 2796
307 Ga0495594_0369814 3300046499 Bacteria 816
308 Ga0495598_0054245 3300046537 Bacteria 1217
309 Ga0495656_0089658 3300046615 Bacteria 1404
310 Ga0495623_0170399 3300046679 Bacteria 1272
311 Ga0495646_0166556 3300046680 Bacteria 1217
312 Ga0495658_0354725 3300046683 Bacteria 932
313 Ga0495613_0048494 3300046689 Bacteria 3136
314 Ga0495636_0016728 3300047318 Bacteria 2932
315 Ga0495602_0113809 3300048088 Bacteria 2192
316 Ga0495615_0002626 3300048090 Bacteria 2905
317 Ga0496100_0065279 3300048903 Bacteria 2411
318 Ga0496100_0195866 3300048903 Bacteria 1470
319 Ga0496102_0003630 3300048905 Bacteria 13053
320 Ga0496106_0001748 3300048909 Bacteria 16234
321 Ga0496106_0393219 3300048909 Bacteria 1114
322 Ga0496107_0030516 3300048910 Bacteria 3843
323 Ga0496107_0325626 3300048910 Bacteria 1143
324 Ga0496108_0108264 3300048911 Bacteria 2374
325 Ga0496109_0002878 3300048912 Bacteria 14402
326 Ga0496109_0141895 3300048912 Bacteria 2246
327 Ga0496109_0406626 3300048912 Bacteria 1286
328 Ga0496112_0007894 3300048915 Bacteria 9482
329 Ga0496112_0036757 3300048915 Bacteria 4778
330 Ga0496112_0076167 3300048915 Bacteria 3318
331 Ga0496113_0067018 3300048916 Bacteria 2720
332 Ga0496114_0000037 3300048917 Bacteria 142233
333 Ga0496115_0003323 3300048918 Bacteria 11546
334 Ga0496115_0267826 3300048918 Bacteria 1404
335 Ga0501034_0013728 3300049571 Bacteria 8333
336 Ga0501034_0111834 3300049571 Unclassified 2722
337 Ga0501067_0012359 3300049583 Bacteria 4734
338 Ga0501035_0000041 3300049822 Bacteria 155712
339 nmdc:mga06r32_11285_c1 3300050510 Bacteria 8047
340 nmdc:mga0n895_159253_c1 3300050512 Bacteria 2288

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048903 Ga0496100_0195866 Ga0496100_0195866_37_621 192
2 3300025918 Ga0207662_10179576 Ga0207662_101795761 193
3 3300026078 Ga0207702_10783623 Ga0207702_107836232 202
4 3300035086 Ga0373934_0163989 Ga0373934_0163989_57_680 204
5 3300025942 Ga0207689_10402112 Ga0207689_104021122 205
6 3300005340 Ga0070689_100023049 Ga0070689_1000230492 206
7 3300005459 Ga0068867_100248621 Ga0068867_1002486211 206
8 3300005466 Ga0070685_10179438 Ga0070685_101794382 206
9 3300005543 Ga0070672_100104224 Ga0070672_1001042242 206
10 3300025936 Ga0207670_10005373 Ga0207670_100053733 206
11 3300025940 Ga0207691_10029430 Ga0207691_100294303 206
12 3300048915 Ga0496112_0036757 Ga0496112_0036757_1357_2055 207
13 3300048918 Ga0496115_0267826 Ga0496115_0267826_615_1262 207
14 3300031903 Ga0307407_10402617 Ga0307407_104026172 208
15 3300035170 Ga0373943_0004416 Ga0373943_0004416_702_1340 209
16 3300035692 Ga0373935_0051225 Ga0373935_0051225_682_1320 209
17 3300036401 Ga0373937_0070296 Ga0373937_0070296_2299_2937 209
18 3300010375 Ga0105239_10477246 Ga0105239_104772462 213
19 3300035724 Ga0373933_0221618 Ga0373933_0221618_398_1048 213
20 3300013297 Ga0157378_10131061 Ga0157378_101310612 214
21 3300025921 Ga0207652_10413911 Ga0207652_104139112 214
22 3300005327 Ga0070658_10553375 Ga0070658_105533752 215
23 3300005329 Ga0070683_100083582 Ga0070683_1000835823 215
24 3300005336 Ga0070680_100027955 Ga0070680_1000279554 215
25 3300005456 Ga0070678_100096578 Ga0070678_1000965783 215
26 3300005458 Ga0070681_10027727 Ga0070681_100277275 215
27 3300005458 Ga0070681_10134859 Ga0070681_101348592 215
28 3300005530 Ga0070679_100110312 Ga0070679_1001103122 215
29 3300005548 Ga0070665_100351305 Ga0070665_1003513052 215
30 3300005563 Ga0068855_100328753 Ga0068855_1003287532 215
31 3300005614 Ga0068856_100040027 Ga0068856_1000400273 215
32 3300005614 Ga0068856_100109203 Ga0068856_1001092033 215
33 3300013296 Ga0157374_10695971 Ga0157374_106959711 215
34 3300013307 Ga0157372_10236614 Ga0157372_102366143 215
35 3300025912 Ga0207707_10067421 Ga0207707_100674212 215
36 3300025912 Ga0207707_10118757 Ga0207707_101187573 215
37 3300025917 Ga0207660_10270844 Ga0207660_102708442 215
38 3300025925 Ga0207650_10048056 Ga0207650_100480563 215
39 3300025944 Ga0207661_10017788 Ga0207661_100177883 215
40 3300025949 Ga0207667_10455102 Ga0207667_104551022 215
41 3300026078 Ga0207702_10176574 Ga0207702_101765742 215
42 3300026116 Ga0207674_10086322 Ga0207674_100863223 215
43 3300026121 Ga0207683_10159474 Ga0207683_101594742 215
44 3300028379 Ga0268266_10225353 Ga0268266_102253532 215
45 3300039438 Ga0436360_0958712 Ga0436360_0958712_186_842 215
46 3300039447 Ga0436361_1069224 Ga0436361_1069224_91_747 215
47 3300045049 Ga0466959_0077264 Ga0466959_0077264_1200_1856 215
48 3300046462 Ga0495651_0364189 Ga0495651_0364189_51_707 215
49 3300048915 Ga0496112_0076167 Ga0496112_0076167_840_1496 215
50 3300005329 Ga0070683_100354948 Ga0070683_1003549482 216
51 3300005331 Ga0070670_100040583 Ga0070670_1000405833 216
52 3300005336 Ga0070680_100055149 Ga0070680_1000551493 216
53 3300005340 Ga0070689_100007567 Ga0070689_1000075675 216
54 3300005343 Ga0070687_100055437 Ga0070687_1000554372 216
55 3300005347 Ga0070668_100220302 Ga0070668_1002203022 216
56 3300005353 Ga0070669_100014639 Ga0070669_1000146395 216
57 3300005356 Ga0070674_100002895 Ga0070674_1000028953 216
58 3300005364 Ga0070673_100137376 Ga0070673_1001373762 216
59 3300005438 Ga0070701_10038068 Ga0070701_100380682 216
60 3300005441 Ga0070700_100001901 Ga0070700_1000019016 216
61 3300005458 Ga0070681_10018492 Ga0070681_100184926 216
62 3300005458 Ga0070681_10105096 Ga0070681_101050963 216
63 3300005459 Ga0068867_100102046 Ga0068867_1001020462 216
64 3300005530 Ga0070679_100027888 Ga0070679_1000278887 216
65 3300005530 Ga0070679_100028861 Ga0070679_1000288614 216
66 3300005535 Ga0070684_100250679 Ga0070684_1002506792 216
67 3300005543 Ga0070672_100042158 Ga0070672_1000421582 216
68 3300005544 Ga0070686_100062022 Ga0070686_1000620222 216
69 3300005615 Ga0070702_100063975 Ga0070702_1000639752 216
70 3300006881 Ga0068865_100016309 Ga0068865_1000163094 216
71 3300013308 Ga0157375_10400429 Ga0157375_104004292 216
72 3300025903 Ga0207680_10179445 Ga0207680_101794452 216
73 3300025907 Ga0207645_10007843 Ga0207645_100078435 216
74 3300025912 Ga0207707_10043974 Ga0207707_100439742 216
75 3300025912 Ga0207707_10176775 Ga0207707_101767752 216
76 3300025917 Ga0207660_10075725 Ga0207660_100757252 216
77 3300025921 Ga0207652_10102067 Ga0207652_101020672 216
78 3300025921 Ga0207652_10156969 Ga0207652_101569692 216
79 3300025923 Ga0207681_10001884 Ga0207681_1000188410 216
80 3300025936 Ga0207670_10022514 Ga0207670_100225144 216
81 3300025936 Ga0207670_10566452 Ga0207670_105664521 216
82 3300025938 Ga0207704_10031588 Ga0207704_100315882 216
83 3300025940 Ga0207691_10009161 Ga0207691_100091612 216
84 3300025944 Ga0207661_10336780 Ga0207661_103367802 216
85 3300025972 Ga0207668_10007838 Ga0207668_100078385 216
86 3300025986 Ga0207658_10037030 Ga0207658_100370302 216
87 3300026075 Ga0207708_10000861 Ga0207708_1000086112 216
88 3300026089 Ga0207648_10043045 Ga0207648_100430455 216
89 3300028380 Ga0268265_10063881 Ga0268265_100638812 216
90 3300028381 Ga0268264_10249226 Ga0268264_102492263 216
91 3300041512 Ga0451853_3001745 Ga0451853_3001745_48_707 216
92 3300046679 Ga0495623_0170399 Ga0495623_0170399_161_820 216
93 3300046680 Ga0495646_0166556 Ga0495646_0166556_531_1190 216
94 3300046689 Ga0495613_0048494 Ga0495613_0048494_1395_2054 216
95 3300048088 Ga0495602_0113809 Ga0495602_0113809_1183_1842 216
96 3300005364 Ga0070673_100001923 Ga0070673_1000019234 217
97 3300005842 Ga0068858_100501228 Ga0068858_1005012282 217
98 3300009094 Ga0111539_11122358 Ga0111539_111223582 217
99 3300025960 Ga0207651_10000844 Ga0207651_100008442 217
100 3300026035 Ga0207703_10700824 Ga0207703_107008242 217
101 3300026089 Ga0207648_10543843 Ga0207648_105438432 217
102 3300048909 Ga0496106_0393219 Ga0496106_0393219_376_1065 217
103 3300048910 Ga0496107_0030516 Ga0496107_0030516_2192_2881 217
104 3300048912 Ga0496109_0141895 Ga0496109_0141895_72_770 217
105 3300048917 Ga0496114_0000037 Ga0496114_0000037_115826_116515 217
106 3300048918 Ga0496115_0003323 Ga0496115_0003323_97_786 217
107 3300049571 Ga0501034_0013728 Ga0501034_0013728_3697_4395 217
108 3300005329 Ga0070683_100008980 Ga0070683_1000089803 218
109 3300005535 Ga0070684_100007239 Ga0070684_1000072393 218
110 3300025900 Ga0207710_10257065 Ga0207710_102570651 218
111 3300025944 Ga0207661_10040530 Ga0207661_100405302 218
112 3300028556 Ga0265337_1058521 Ga0265337_10585212 218
113 3300028563 Ga0265319_1080038 Ga0265319_10800382 218
114 3300028800 Ga0265338_10006912 Ga0265338_100069127 218
115 3300031241 Ga0265325_10032241 Ga0265325_100322413 218
116 3300031507 Ga0307509_10019397 Ga0307509_100193974 218
117 3300031595 Ga0265313_10134432 Ga0265313_101344321 218
118 3300033180 Ga0307510_10323000 Ga0307510_103230001 218
119 3300049571 Ga0501034_0111834 Ga0501034_0111834_1202_1894 218
120 3300005841 Ga0068863_101055875 Ga0068863_1010558752 219
121 3300005843 Ga0068860_100023992 Ga0068860_1000239922 219
122 3300006028 Ga0070717_10075033 Ga0070717_100750333 219
123 3300009101 Ga0105247_10327591 Ga0105247_103275912 219
124 3300028381 Ga0268264_10016400 Ga0268264_100164007 219
125 3300037471 Ga0395905_0109568 Ga0395905_0109568_1722_2405 219
126 3300046499 Ga0495594_0369814 Ga0495594_0369814_13_675 219
127 3300006846 Ga0075430_100237766 Ga0075430_1002377662 220
128 3300006847 Ga0075431_100067678 Ga0075431_1000676784 220
129 3300026067 Ga0207678_10595254 Ga0207678_105952542 220
130 3300028653 Ga0265323_10096983 Ga0265323_100969831 220
131 3300031727 Ga0316576_10004302 Ga0316576_100043027 220
132 3300031727 Ga0316576_10005919 Ga0316576_100059196 220
133 3300031728 Ga0316578_10007495 Ga0316578_100074953 220
134 3300031728 Ga0316578_10028740 Ga0316578_100287402 220
135 3300036712 Ga0316584_0000303 Ga0316584_0000303_1770_2483 220
136 3300036712 Ga0316584_0196616 Ga0316584_0196616_248_949 220
137 3300046537 Ga0495598_0054245 Ga0495598_0054245_70_735 220
138 3300046615 Ga0495656_0089658 Ga0495656_0089658_181_846 220
139 3300047318 Ga0495636_0016728 Ga0495636_0016728_664_1329 220
140 3300048090 Ga0495615_0002626 Ga0495615_0002626_1108_1773 220
141 3300048912 Ga0496109_0406626 Ga0496109_0406626_41_712 220
142 3300049822 Ga0501035_0000041 Ga0501035_0000041_3546_4217 220
143 3300050510 nmdc:mga06r32_11285_c1 nmdc:mga06r32_11285_c1_394_1062 220
144 3300007265 Ga0099794_10000023 Ga0099794_1000002339 221
145 3300027671 Ga0209588_1000007 Ga0209588_100000793 221
146 3300045051 Ga0451576_0036273 Ga0451576_0036273_4213_4887 221
147 3300005445 Ga0070708_100004915 Ga0070708_1000049153 222
148 3300005467 Ga0070706_100000014 Ga0070706_100000014144 222
149 3300005468 Ga0070707_100003040 Ga0070707_1000030408 222
150 3300005471 Ga0070698_100266153 Ga0070698_1002661532 222
151 3300005518 Ga0070699_100031788 Ga0070699_1000317884 222
152 3300005536 Ga0070697_100002117 Ga0070697_1000021178 222
153 3300025910 Ga0207684_10000067 Ga0207684_1000006731 222
154 3300025922 Ga0207646_10022464 Ga0207646_100224643 222
155 3300031731 Ga0307405_10453135 Ga0307405_104531352 222
156 3300036401 Ga0373937_0370508 Ga0373937_0370508_369_1037 222
157 3300046472 Ga0495580_0055358 Ga0495580_0055358_1684_2352 222
158 3300046683 Ga0495658_0354725 Ga0495658_0354725_11_679 222
159 3300049583 Ga0501067_0012359 Ga0501067_0012359_1945_2652 222
160 3300006871 Ga0075434_100332333 Ga0075434_1003323332 223
161 3300031235 Ga0265330_10054077 Ga0265330_100540771 223
162 3300050512 nmdc:mga0n895_159253_c1 nmdc:mga0n895_159253_c1_317_988 223
163 3300005295 Ga0065707_10190131 Ga0065707_101901312 224
164 3300005355 Ga0070671_100447639 Ga0070671_1004476392 224
165 3300005455 Ga0070663_100651292 Ga0070663_1006512922 224
166 3300005841 Ga0068863_100497612 Ga0068863_1004976122 224
167 3300005983 Ga0081540_1000062 Ga0081540_100006291 224
168 3300005983 Ga0081540_1000291 Ga0081540_100029142 224
169 2162886012 MBSR1b_contig_7619764 MBSR1b_0391.00005410 227
170 3300001978 JGI24747J21853_1004693 JGI24747J21853_10046932 227
171 3300002076 JGI24749J21850_1001246 JGI24749J21850_10012462 227
172 3300002239 JGI24034J26672_10004618 JGI24034J26672_100046182 227
173 3300002459 JGI24751J29686_10020748 JGI24751J29686_100207482 227
174 3300005293 Ga0065715_10091424 Ga0065715_100914245 227
175 3300005327 Ga0070658_10002215 Ga0070658_100022155 227
176 3300005328 Ga0070676_10000401 Ga0070676_1000040118 227
177 3300005329 Ga0070683_100001928 Ga0070683_10000192816 227
178 3300005330 Ga0070690_100001344 Ga0070690_10000134412 227
179 3300005331 Ga0070670_100167176 Ga0070670_1001671762 227
180 3300005333 Ga0070677_10000491 Ga0070677_100004914 227
181 3300005334 Ga0068869_100000498 Ga0068869_10000049817 227
182 3300005335 Ga0070666_10131029 Ga0070666_101310292 227
183 3300005336 Ga0070680_100008207 Ga0070680_1000082077 227
184 3300005337 Ga0070682_100033653 Ga0070682_1000336533 227
185 3300005338 Ga0068868_100002561 Ga0068868_1000025618 227
186 3300005339 Ga0070660_100000307 Ga0070660_1000003074 227
187 3300005340 Ga0070689_100001635 Ga0070689_1000016353 227
188 3300005341 Ga0070691_10138034 Ga0070691_101380343 227
189 3300005343 Ga0070687_100000021 Ga0070687_10000002111 227
190 3300005344 Ga0070661_100000275 Ga0070661_10000027536 227
191 3300005344 Ga0070661_100041278 Ga0070661_1000412783 227
192 3300005347 Ga0070668_100002913 Ga0070668_1000029133 227
193 3300005353 Ga0070669_100001819 Ga0070669_1000018198 227
194 3300005355 Ga0070671_100159895 Ga0070671_1001598953 227
195 3300005356 Ga0070674_100001490 Ga0070674_1000014903 227
196 3300005364 Ga0070673_100000260 Ga0070673_1000002609 227
197 3300005365 Ga0070688_100000503 Ga0070688_1000005039 227
198 3300005366 Ga0070659_100000146 Ga0070659_10000014612 227
199 3300005438 Ga0070701_10003638 Ga0070701_100036384 227
200 3300005440 Ga0070705_100000176 Ga0070705_10000017622 227
201 3300005441 Ga0070700_100031472 Ga0070700_1000314725 227
202 3300005444 Ga0070694_100180716 Ga0070694_1001807162 227
203 3300005455 Ga0070663_100018468 Ga0070663_1000184684 227
204 3300005456 Ga0070678_100177083 Ga0070678_1001770832 227
205 3300005457 Ga0070662_100001963 Ga0070662_1000019636 227
206 3300005458 Ga0070681_10451798 Ga0070681_104517982 227
207 3300005459 Ga0068867_100001282 Ga0068867_1000012827 227
208 3300005466 Ga0070685_10000218 Ga0070685_1000021819 227
209 3300005530 Ga0070679_100347488 Ga0070679_1003474882 227
210 3300005535 Ga0070684_100003546 Ga0070684_1000035469 227
211 3300005535 Ga0070684_100068916 Ga0070684_1000689163 227
212 3300005539 Ga0068853_100000652 Ga0068853_10000065214 227
213 3300005543 Ga0070672_100000190 Ga0070672_10000019021 227
214 3300005544 Ga0070686_100001647 Ga0070686_1000016477 227
215 3300005545 Ga0070695_100016975 Ga0070695_1000169754 227
216 3300005546 Ga0070696_100302522 Ga0070696_1003025221 227
217 3300005547 Ga0070693_100011750 Ga0070693_1000117504 227
218 3300005548 Ga0070665_100258567 Ga0070665_1002585672 227
219 3300005563 Ga0068855_100003791 Ga0068855_10000379112 227
220 3300005564 Ga0070664_100000611 Ga0070664_10000061118 227
221 3300005564 Ga0070664_100001487 Ga0070664_1000014877 227
222 3300005577 Ga0068857_100000171 Ga0068857_10000017124 227
223 3300005577 Ga0068857_100013419 Ga0068857_1000134194 227
224 3300005578 Ga0068854_100000555 Ga0068854_1000005555 227
225 3300005614 Ga0068856_100000921 Ga0068856_1000009214 227
226 3300005615 Ga0070702_100099228 Ga0070702_1000992283 227
227 3300005616 Ga0068852_100000149 Ga0068852_10000014931 227
228 3300005617 Ga0068859_100009432 Ga0068859_1000094327 227
229 3300005618 Ga0068864_100000267 Ga0068864_10000026710 227
230 3300005718 Ga0068866_10000052 Ga0068866_1000005229 227
231 3300005719 Ga0068861_100000219 Ga0068861_10000021916 227
232 3300005834 Ga0068851_10003524 Ga0068851_100035247 227
233 3300005840 Ga0068870_10000014 Ga0068870_1000001430 227
234 3300005842 Ga0068858_100011723 Ga0068858_1000117238 227
235 3300005843 Ga0068860_100025446 Ga0068860_1000254466 227
236 3300005844 Ga0068862_100001474 Ga0068862_1000014749 227
237 3300005983 Ga0081540_1001825 Ga0081540_100182512 227
238 3300006237 Ga0097621_100000911 Ga0097621_10000091114 227
239 3300006358 Ga0068871_100002486 Ga0068871_1000024863 227
240 3300006881 Ga0068865_100004424 Ga0068865_1000044249 227
241 3300006931 Ga0097620_100009432 Ga0097620_1000094327 227
242 3300009093 Ga0105240_10018808 Ga0105240_100188087 227
243 3300009098 Ga0105245_10000472 Ga0105245_1000047224 227
244 3300009101 Ga0105247_10001806 Ga0105247_100018065 227
245 3300009148 Ga0105243_10003352 Ga0105243_100033523 227
246 3300009174 Ga0105241_10002649 Ga0105241_100026492 227
247 3300009176 Ga0105242_10000236 Ga0105242_1000023615 227
248 3300009177 Ga0105248_10023447 Ga0105248_100234476 227
249 3300009545 Ga0105237_10000920 Ga0105237_100009209 227
250 3300009551 Ga0105238_10000349 Ga0105238_1000034948 227
251 3300009553 Ga0105249_10000378 Ga0105249_1000037837 227
252 3300010375 Ga0105239_10000911 Ga0105239_100009117 227
253 3300011119 Ga0105246_10004491 Ga0105246_100044917 227
254 3300013100 Ga0157373_10010635 Ga0157373_100106354 227
255 3300013102 Ga0157371_10000763 Ga0157371_1000076312 227
256 3300013105 Ga0157369_10000611 Ga0157369_100006119 227
257 3300013296 Ga0157374_10001118 Ga0157374_100011185 227
258 3300013297 Ga0157378_10000617 Ga0157378_1000061719 227
259 3300013306 Ga0163162_10028522 Ga0163162_100285225 227
260 3300013307 Ga0157372_10005954 Ga0157372_100059542 227
261 3300013308 Ga0157375_10002005 Ga0157375_1000200514 227
262 3300014325 Ga0163163_10005330 Ga0163163_100053303 227
263 3300014745 Ga0157377_10000942 Ga0157377_100009425 227
264 3300014968 Ga0157379_10000914 Ga0157379_1000091418 227
265 3300014969 Ga0157376_10000255 Ga0157376_1000025518 227
266 3300025315 Ga0207697_10000289 Ga0207697_1000028915 227
267 3300025321 Ga0207656_10000072 Ga0207656_100000727 227
268 3300025893 Ga0207682_10000070 Ga0207682_1000007027 227
269 3300025899 Ga0207642_10000368 Ga0207642_100003687 227
270 3300025900 Ga0207710_10001078 Ga0207710_100010784 227
271 3300025901 Ga0207688_10000008 Ga0207688_1000000861 227
272 3300025903 Ga0207680_10000580 Ga0207680_100005806 227
273 3300025904 Ga0207647_10001135 Ga0207647_100011355 227
274 3300025907 Ga0207645_10000008 Ga0207645_1000000837 227
275 3300025908 Ga0207643_10000008 Ga0207643_10000008114 227
276 3300025909 Ga0207705_10002885 Ga0207705_100028859 227
277 3300025911 Ga0207654_10004399 Ga0207654_100043996 227
278 3300025912 Ga0207707_10159399 Ga0207707_101593992 227
279 3300025913 Ga0207695_10018214 Ga0207695_100182142 227
280 3300025914 Ga0207671_10002690 Ga0207671_1000269010 227
281 3300025917 Ga0207660_10026537 Ga0207660_100265374 227
282 3300025918 Ga0207662_10000012 Ga0207662_1000001239 227
283 3300025919 Ga0207657_10000094 Ga0207657_1000009425 227
284 3300025920 Ga0207649_10001035 Ga0207649_100010359 227
285 3300025920 Ga0207649_10039106 Ga0207649_100391063 227
286 3300025921 Ga0207652_10720354 Ga0207652_107203542 227
287 3300025923 Ga0207681_10000567 Ga0207681_100005679 227
288 3300025924 Ga0207694_10007457 Ga0207694_100074573 227
289 3300025925 Ga0207650_10000222 Ga0207650_1000022243 227
290 3300025926 Ga0207659_10000194 Ga0207659_1000019433 227
291 3300025927 Ga0207687_10011746 Ga0207687_100117464 227
292 3300025931 Ga0207644_10000890 Ga0207644_100008908 227
293 3300025932 Ga0207690_10000612 Ga0207690_1000061217 227
294 3300025933 Ga0207706_10000118 Ga0207706_1000011825 227
295 3300025934 Ga0207686_10001040 Ga0207686_1000104014 227
296 3300025935 Ga0207709_10003765 Ga0207709_100037653 227
297 3300025936 Ga0207670_10000192 Ga0207670_1000019210 227
298 3300025937 Ga0207669_10000516 Ga0207669_100005169 227
299 3300025938 Ga0207704_10000228 Ga0207704_1000022817 227
300 3300025940 Ga0207691_10000074 Ga0207691_1000007457 227
301 3300025941 Ga0207711_10000820 Ga0207711_1000082019 227
302 3300025942 Ga0207689_10000093 Ga0207689_1000009325 227
303 3300025944 Ga0207661_10013755 Ga0207661_100137556 227
304 3300025945 Ga0207679_10000134 Ga0207679_1000013416 227
305 3300025945 Ga0207679_10000197 Ga0207679_1000019728 227
306 3300025949 Ga0207667_10002415 Ga0207667_1000241518 227
307 3300025960 Ga0207651_10000037 Ga0207651_1000003724 227
308 3300025961 Ga0207712_10000820 Ga0207712_100008209 227
309 3300025972 Ga0207668_10001413 Ga0207668_1000141311 227
310 3300025981 Ga0207640_10000487 Ga0207640_1000048717 227
311 3300025986 Ga0207658_10000162 Ga0207658_1000016229 227
312 3300026023 Ga0207677_10000149 Ga0207677_1000014924 227
313 3300026035 Ga0207703_10000748 Ga0207703_100007488 227
314 3300026041 Ga0207639_10005889 Ga0207639_100058899 227
315 3300026067 Ga0207678_10001754 Ga0207678_1000175415 227
316 3300026075 Ga0207708_10011189 Ga0207708_100111895 227
317 3300026078 Ga0207702_10008872 Ga0207702_100088722 227
318 3300026088 Ga0207641_10020924 Ga0207641_100209246 227
319 3300026089 Ga0207648_10000183 Ga0207648_1000018339 227
320 3300026095 Ga0207676_10002608 Ga0207676_100026089 227
321 3300026116 Ga0207674_10002325 Ga0207674_1000232518 227
322 3300026116 Ga0207674_10020883 Ga0207674_100208834 227
323 3300026118 Ga0207675_100000008 Ga0207675_10000000860 227
324 3300026121 Ga0207683_10000407 Ga0207683_1000040725 227
325 3300026142 Ga0207698_10000380 Ga0207698_1000038018 227
326 3300028379 Ga0268266_10000447 Ga0268266_1000044724 227
327 3300028380 Ga0268265_10000207 Ga0268265_1000020725 227
328 3300028381 Ga0268264_10000444 Ga0268264_1000044419 227
329 3300031727 Ga0316576_10163533 Ga0316576_101635332 227
330 3300035114 Ga0373939_0158551 Ga0373939_0158551_12_698 227
331 3300042876 Ga0451577_0375711 Ga0451577_0375711_508_1191 227
332 3300045051 Ga0451576_0017020 Ga0451576_0017020_4072_4755 227
333 3300048903 Ga0496100_0065279 Ga0496100_0065279_711_1394 227
334 3300048905 Ga0496102_0003630 Ga0496102_0003630_3456_4139 227
335 3300048909 Ga0496106_0001748 Ga0496106_0001748_13772_14455 227
336 3300048910 Ga0496107_0325626 Ga0496107_0325626_189_872 227
337 3300048911 Ga0496108_0108264 Ga0496108_0108264_1481_2164 227
338 3300048912 Ga0496109_0002878 Ga0496109_0002878_7000_7683 227
339 3300048915 Ga0496112_0007894 Ga0496112_0007894_4739_5422 227
340 3300048916 Ga0496113_0067018 Ga0496113_0067018_1200_1883 227

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

9

237

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w8g-assembly1.cif.gz_A crystal structure of e. coli k-12 yggs 0.9669 3 218
7uax-assembly1.cif.gz_A the crystal structure of the k36a/k38a double mutant of e. coli yggs in complex with plp 0.9648 3 217
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9635 3 218
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9628 3 217
3sy1-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or70 0.9611 1 218
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9669 3 218 3.20.20.10
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9331 4 218 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9211 3 218 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9153 5 220 3.20.20.10
af_Q9Z2Y8_11_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9134 4 227 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A4V2B0W7-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9858 4 220 GO:0030170
AF-A0A3S5GY77-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9829 3 220 GO:0030170
AF-A0A6N7PWJ7-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9819 5 219 GO:0030170
AF-A0A4P2QBL0-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9817 12 219 GO:0030170
AF-A0A150RJB2-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9793 1 220 GO:0030170

Feature Viewer

pLDDT pTM Quality
93.78 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map