F414449

General Info

Members Datasets Scaffolds Average Seq Length
340 237 680 157

Family's Representative Sequence

Representative Sequence 3300044712|Ga0453684_0410728|Ga0453684_0410728_181_711
Length 176
Sequence MTLQIASSLGKQSRIQLLNMDKHFIGVISDTHGLLRAEAVEALKGSNLIIHAGDVGKPEVLKALKQIAPVVAIRGNIDKGAWCQSMPLTETVEIGKIRFYVLHKLAGLDLDPAAAGFTCVIYGDSHQPSLETRNGVIFLNPGSAGPRRFKLPVSVAMIEVHGNTIKPKLIELTIES

Samples

Sample ID Description Type Environment
1 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
26 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
65 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
66 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
67 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
68 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
69 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
99 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
100 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
114 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
115 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
116 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
117 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
122 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
123 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
124 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
127 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
128 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
136 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
147 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
148 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
149 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
150 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
154 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
155 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
160 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
161 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
162 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
167 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
168 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
225 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
226 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
227 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
228 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
229 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
230 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
231 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
232 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
233 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
234 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
235 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
236 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
237 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.76
Metatranscriptomes 0
Isolates 3.24

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 4.12
Rhizoplane 13.53
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0453684_0410728 3300044712 Bacteria 1514
2 Ga0065714_10083581 3300005288 Bacteria 2242
3 Ga0065704_10043202 3300005289 Unclassified 1198
4 Ga0065715_10004267 3300005293 Bacteria 4674
5 Ga0065707_10123090 3300005295 Bacteria 2046
6 Ga0070670_100114112 3300005331 Bacteria 2329
7 Ga0068869_100223702 3300005334 Bacteria 1493
8 Ga0068869_100480154 3300005334 Bacteria 1035
9 Ga0070680_101544925 3300005336 Bacteria 575
10 Ga0070668_100918761 3300005347 Bacteria 783
11 Ga0070669_100416768 3300005353 Unclassified 1101
12 Ga0070675_100066145 3300005354 Bacteria 2989
13 Ga0070675_100942033 3300005354 Bacteria 792
14 Ga0070671_100087138 3300005355 Bacteria 2613
15 Ga0070674_100047933 3300005356 Bacteria 2930
16 Ga0070673_100425946 3300005364 Unclassified 1190
17 Ga0070667_101425538 3300005367 Bacteria 650
18 Ga0070703_10008485 3300005406 Unclassified 2890
19 Ga0070709_10047723 3300005434 Bacteria 2669
20 Ga0070714_100029184 3300005435 Bacteria 4584
21 Ga0070713_100078762 3300005436 Bacteria 2806
22 Ga0070713_101892538 3300005436 Bacteria 579
23 Ga0070710_10186939 3300005437 Bacteria 1300
24 Ga0070700_100263682 3300005441 Unclassified 1242
25 Ga0070694_100835994 3300005444 Unclassified 757
26 Ga0070708_100050380 3300005445 Bacteria 3687
27 Ga0070708_100380381 3300005445 Bacteria 1331
28 Ga0070708_100655379 3300005445 Unclassified 989
29 Ga0070681_10482439 3300005458 Bacteria 1152
30 Ga0070681_10497003 3300005458 Bacteria 1133
31 Ga0070706_100013561 3300005467 Bacteria 7535
32 Ga0070706_100170421 3300005467 Bacteria 2032
33 Ga0070707_100480822 3300005468 Bacteria 1203
34 Ga0070698_101299535 3300005471 Bacteria 677
35 Ga0070699_100133593 3300005518 Bacteria 2188
36 Ga0070699_100768786 3300005518 Bacteria 881
37 Ga0070699_101194341 3300005518 Bacteria 698
38 Ga0070679_100543895 3300005530 Unclassified 1105
39 Ga0070697_100020738 3300005536 Bacteria 5203
40 Ga0070695_100091235 3300005545 Unclassified 2034
41 Ga0070695_100422288 3300005545 Bacteria 1015
42 Ga0070695_100619725 3300005545 Bacteria 851
43 Ga0070696_100411094 3300005546 Bacteria 1060
44 Ga0070665_101029901 3300005548 Unclassified 835
45 Ga0070704_100002695 3300005549 Bacteria 10040
46 Ga0070704_100939849 3300005549 Bacteria 779
47 Ga0070664_100161936 3300005564 Bacteria 1980
48 Ga0068859_100280150 3300005617 Bacteria 1760
49 Ga0068864_100324492 3300005618 Unclassified 1447
50 Ga0068870_10106842 3300005840 Bacteria 1591
51 Ga0068860_100587890 3300005843 Bacteria 1118
52 Ga0068862_100219014 3300005844 Bacteria 1722
53 Ga0081455_10366804 3300005937 Bacteria 1011
54 Ga0081539_10075959 3300005985 Bacteria 1782
55 Ga0070717_10032628 3300006028 Bacteria 4198
56 Ga0070717_10961196 3300006028 Unclassified 778
57 Ga0075365_10048152 3300006038 Bacteria 2805
58 Ga0075365_10175501 3300006038 Bacteria 1497
59 Ga0070715_10029142 3300006163 Bacteria 2221
60 Ga0075431_100033085 3300006847 Bacteria 5328
61 Ga0075434_100005665 3300006871 Bacteria 11396
62 Ga0097620_100280152 3300006931 Bacteria 1760
63 Ga0097620_100494729 3300006931 Bacteria 1318
64 Ga0099824_1020287 3300006942 Bacteria 4938
65 Ga0075435_100101266 3300007076 Bacteria 2387
66 Ga0075435_100674385 3300007076 Bacteria 898
67 Ga0075435_101880917 3300007076 Bacteria 525
68 Ga0099794_10012609 3300007265 Bacteria 3653
69 Ga0105240_10002656 3300009093 Bacteria 28449
70 Ga0111539_10100652 3300009094 Unclassified 3393
71 Ga0111539_10178139 3300009094 Bacteria 2483
72 Ga0111539_10300985 3300009094 Bacteria 1866
73 Ga0105245_10852052 3300009098 Bacteria 951
74 Ga0105247_10033892 3300009101 Bacteria 3108
75 Ga0114129_10006769 3300009147 Bacteria 16269
76 Ga0114129_12410476 3300009147 Bacteria 630
77 Ga0105248_10666569 3300009177 Bacteria 1174
78 Ga0105237_10001323 3300009545 Bacteria 32852
79 Ga0157374_10694814 3300013296 Bacteria 1030
80 Ga0163162_10401917 3300013306 Bacteria 1502
81 Ga0157375_10031179 3300013308 Bacteria 5035
82 Ga0157375_11924354 3300013308 Bacteria 702
83 Ga0163163_10059897 3300014325 Bacteria 3768
84 Ga0163163_10061947 3300014325 Bacteria 3707
85 Ga0157380_10064766 3300014326 Bacteria 2935
86 Ga0157380_10320866 3300014326 Unclassified 1436
87 Ga0214544_1000004 3300021320 Bacteria 455869
88 Ga0214542_1000001 3300021321 Bacteria 1018696
89 Ga0214542_1047691 3300021321 Bacteria 886
90 Ga0214545_1000001 3300021324 Bacteria 1092817
91 Ga0214545_1048704 3300021324 Bacteria 886
92 Ga0214543_1000006 3300021327 Bacteria 443395
93 Ga0214543_1048555 3300021327 Bacteria 886
94 Ga0213874_10020931 3300021377 Bacteria 1798
95 Ga0213874_10234561 3300021377 Bacteria 671
96 Ga0207697_10091196 3300025315 Unclassified 1291
97 Ga0207653_10014959 3300025885 Unclassified 2435
98 Ga0207682_10026454 3300025893 Unclassified 2307
99 Ga0207692_10622498 3300025898 Bacteria 695
100 Ga0207688_10019569 3300025901 Bacteria 3690
101 Ga0207699_10056822 3300025906 Bacteria 2334
102 Ga0207643_10014573 3300025908 Bacteria 4273
103 Ga0207684_10023749 3300025910 Bacteria 5233
104 Ga0207684_10074011 3300025910 Bacteria 2893
105 Ga0207707_10158040 3300025912 Bacteria 1982
106 Ga0207707_10419201 3300025912 Bacteria 1148
107 Ga0207707_10480333 3300025912 Unclassified 1061
108 Ga0207695_10005488 3300025913 Bacteria 16786
109 Ga0207671_10026733 3300025914 Bacteria 4320
110 Ga0207652_10980638 3300025921 Unclassified 743
111 Ga0207646_10443730 3300025922 Bacteria 1171
112 Ga0207681_10908122 3300025923 Unclassified 738
113 Ga0207650_10007215 3300025925 Bacteria 7575
114 Ga0207659_10967021 3300025926 Bacteria 732
115 Ga0207700_11532916 3300025928 Bacteria 591
116 Ga0207664_10096537 3300025929 Bacteria 2433
117 Ga0207644_10432066 3300025931 Bacteria 1080
118 Ga0207690_10619173 3300025932 Bacteria 885
119 Ga0207670_10078485 3300025936 Bacteria 2303
120 Ga0207691_10011990 3300025940 Bacteria 8315
121 Ga0207679_10533881 3300025945 Bacteria 1051
122 Ga0207651_10036083 3300025960 Bacteria 3223
123 Ga0207651_11157300 3300025960 Bacteria 694
124 Ga0207668_11408787 3300025972 Bacteria 628
125 Ga0207703_11053132 3300026035 Bacteria 781
126 Ga0207708_10067947 3300026075 Unclassified 2727
127 Ga0207702_10388491 3300026078 Bacteria 1343
128 Ga0207676_10720066 3300026095 Unclassified 968
129 Ga0209389_1000010 3300027296 Bacteria 223892
130 Ga0209589_1000016 3300027357 Bacteria 223788
131 Ga0209489_100016 3300027361 Bacteria 223873
132 Ga0209588_1094950 3300027671 Unclassified 960
133 Ga0268266_10314545 3300028379 Bacteria 1464
134 Ga0268265_10356000 3300028380 Unclassified 1338
135 Ga0268265_10813433 3300028380 Bacteria 912
136 Ga0265325_10213156 3300031241 Bacteria 886
137 Ga0265329_10015354 3300031242 Bacteria 2676
138 Ga0265340_10002096 3300031247 Bacteria 11429
139 Ga0265339_10001221 3300031249 Bacteria 19322
140 Ga0265331_10039798 3300031250 Bacteria 2290
141 Ga0307408_100039522 3300031548 Bacteria 3336
142 Ga0316579_10220108 3300031691 Bacteria 918
143 Ga0265314_10057626 3300031711 Bacteria 2666
144 Ga0265342_10000035 3300031712 Bacteria 142886
145 Ga0307405_10626784 3300031731 Unclassified 881
146 Ga0307405_11034123 3300031731 Bacteria 703
147 Ga0307410_10083541 3300031852 Bacteria 2249
148 Ga0307412_10096377 3300031911 Bacteria 2082
149 Ga0307412_10564787 3300031911 Bacteria 958
150 Ga0307416_100343709 3300032002 Bacteria 1506
151 Ga0316580_10116899 3300032139 Unclassified 816
152 Ga0373944_0235206 3300035089 Bacteria 672
153 Ga0373923_0019568 3300035111 Bacteria 2622
154 Ga0373936_0002195 3300035113 Bacteria 7281
155 Ga0373953_0020857 3300035117 Bacteria 2452
156 Ga0373953_0056169 3300035117 Bacteria 1600
157 Ga0373954_0001214 3300035118 Bacteria 10354
158 Ga0373954_0100520 3300035118 Bacteria 1395
159 Ga0373956_0070970 3300035119 Bacteria 1589
160 Ga0373957_0079887 3300035120 Bacteria 1290
161 Ga0373943_0014210 3300035170 Bacteria 3601
162 Ga0373943_0437976 3300035170 Bacteria 758
163 Ga0373946_0009915 3300035171 Bacteria 3521
164 Ga0373955_0004180 3300035172 Bacteria 6371
165 Ga0373955_0272991 3300035172 Bacteria 1016
166 Ga0373924_0006406 3300035410 Bacteria 4216
167 Ga0373924_0040718 3300035410 Bacteria 1903
168 Ga0373931_0119596 3300035691 Bacteria 1504
169 Ga0373935_0000980 3300035692 Bacteria 15499
170 Ga0373927_0008272 3300035695 Bacteria 7004
171 Ga0373933_0004767 3300035724 Bacteria 7411
172 Ga0373933_0245441 3300035724 Bacteria 1152
173 Ga0373947_0000492 3300035725 Bacteria 22784
174 Ga0373947_0116856 3300035725 Bacteria 1692
175 Ga0373947_0182582 3300035725 Bacteria 1366
176 Ga0373937_0003427 3300036401 Bacteria 13305
177 Ga0373937_0015179 3300036401 Bacteria 6806
178 Ga0373937_0657215 3300036401 Bacteria 994
179 Ga0316582_0132123 3300036647 Unclassified 1678
180 Ga0316584_0049591 3300036712 Bacteria 3138
181 Ga0316584_0103041 3300036712 Bacteria 2137
182 Ga0373925_0000018 3300037068 Bacteria 174213
183 Ga0395900_0001701 3300037418 Bacteria 25525
184 Ga0395900_0040641 3300037418 Bacteria 4793
185 Ga0395898_0007735 3300037466 Bacteria 11412
186 Ga0395898_0794349 3300037466 Bacteria 887
187 Ga0436364_0305538 3300037853 Bacteria 1785
188 Ga0395901_0014195 3300038443 Bacteria 8109
189 Ga0395901_0075186 3300038443 Bacteria 3524
190 Ga0436365_0693216 3300039437 Bacteria 924
191 Ga0436360_0669886 3300039438 Bacteria 23196
192 Ga0436361_0616781 3300039447 Bacteria 3394
193 Ga0436361_0827636 3300039447 Bacteria 6635
194 Ga0436363_0302347 3300039450 Bacteria 3373
195 Ga0436363_1185356 3300039450 Bacteria 2017
196 Ga0439431_0240712 3300041997 Unclassified 535
197 Ga0439449_0000980 3300042007 Bacteria 11230
198 Ga0439452_080847 3300042010 Bacteria 708
199 Ga0439457_016014 3300042014 Bacteria 1674
200 Ga0439462_0009597 3300042015 Bacteria 2447
201 Ga0466972_0013926 3300044658 Bacteria 4034
202 Ga0466967_0535320 3300045976 Bacteria 1152
203 Ga0466967_0839715 3300045976 Bacteria 913
204 Ga0495592_0000001 3300046454 Bacteria 305819
205 Ga0495603_0224786 3300046455 Bacteria 1083
206 Ga0495629_0017298 3300046459 Bacteria 5170
207 Ga0495629_0058402 3300046459 Bacteria 2697
208 Ga0495651_0003294 3300046462 Bacteria 12396
209 Ga0495653_0000092 3300046463 Bacteria 74868
210 Ga0495582_0019402 3300046473 Bacteria 3717
211 Ga0495582_0571941 3300046473 Bacteria 654
212 Ga0495662_0087733 3300046476 Bacteria 1515
213 Ga0495662_0101030 3300046476 Bacteria 1411
214 Ga0495664_0000001 3300046477 Bacteria 757730
215 Ga0495594_0167248 3300046499 Bacteria 1251
216 Ga0495606_0038206 3300046507 Bacteria 3250
217 Ga0495608_0000050 3300046511 Bacteria 96603
218 Ga0495618_0000064 3300046514 Bacteria 77194
219 Ga0495618_0063985 3300046514 Bacteria 2337
220 Ga0495628_0000003 3300046516 Bacteria 470339
221 Ga0495630_0010199 3300046517 Bacteria 6776
222 Ga0495630_0338431 3300046517 Bacteria 1151
223 Ga0495652_0000001 3300046529 Bacteria 1045081
224 Ga0495640_0000006 3300046533 Bacteria 285419
225 Ga0495640_0220587 3300046533 Bacteria 1196
226 Ga0495640_0763327 3300046533 Bacteria 578
227 Ga0495587_0000028 3300046536 Bacteria 138663
228 Ga0495645_0000004 3300046543 Bacteria 532661
229 Ga0495667_0000001 3300046559 Bacteria 834831
230 Ga0495634_0002741 3300046642 Bacteria 14488
231 Ga0495635_0000015 3300046663 Bacteria 215468
232 Ga0495635_0351711 3300046663 Bacteria 983
233 Ga0495657_0000155 3300046675 Bacteria 62116
234 Ga0495599_0000029 3300046678 Bacteria 113803
235 Ga0495623_0002458 3300046679 Bacteria 12295
236 Ga0495646_0000006 3300046680 Bacteria 258496
237 Ga0495658_0071959 3300046683 Bacteria 2010
238 Ga0495658_0432780 3300046683 Bacteria 840
239 Ga0495613_0079093 3300046689 Bacteria 2391
240 Ga0495613_0929796 3300046689 Bacteria 561
241 Ga0495624_0120326 3300046690 Bacteria 1612
242 Ga0495624_0311550 3300046690 Bacteria 948
243 Ga0495600_0000286 3300046809 Bacteria 27213
244 Ga0495581_0063516 3300047315 Bacteria 2134
245 Ga0495581_0763769 3300047315 Bacteria 556
246 Ga0495604_0000091 3300047317 Bacteria 77216
247 Ga0495674_0000001 3300047319 Bacteria 778665
248 Ga0495676_0656813 3300047321 Bacteria 680
249 Ga0495680_0021652 3300047322 Bacteria 5377
250 Ga0495680_0369237 3300047322 Bacteria 996
251 Ga0495683_0164951 3300047323 Bacteria 1022
252 Ga0495675_0000839 3300047444 Bacteria 18796
253 Ga0495684_0000055 3300047471 Bacteria 79796
254 Ga0495684_0065427 3300047471 Bacteria 2764
255 Ga0495593_0004124 3300047673 Bacteria 8643
256 Ga0495593_0056083 3300047673 Bacteria 2072
257 Ga0495602_0000002 3300048088 Bacteria 422216
258 Ga0495614_0057462 3300048089 Bacteria 1671
259 Ga0496100_0421571 3300048903 Bacteria 1019
260 Ga0496101_0045847 3300048904 Bacteria 3133
261 Ga0496101_0287762 3300048904 Bacteria 1285
262 Ga0496102_0171619 3300048905 Bacteria 2041
263 Ga0496102_0221457 3300048905 Bacteria 1784
264 Ga0496102_0763511 3300048905 Bacteria 890
265 Ga0496103_0079194 3300048906 Bacteria 2064
266 Ga0496104_0000383 3300048907 Bacteria 38697
267 Ga0496104_0012302 3300048907 Bacteria 7693
268 Ga0496104_0012711 3300048907 Bacteria 7582
269 Ga0496104_0033664 3300048907 Bacteria 4776
270 Ga0496104_0260229 3300048907 Bacteria 1648
271 Ga0496104_1090362 3300048907 Bacteria 702
272 Ga0496105_0019451 3300048908 Bacteria 5477
273 Ga0496105_0046211 3300048908 Bacteria 3594
274 Ga0496105_0050612 3300048908 Bacteria 3432
275 Ga0496105_0054161 3300048908 Bacteria 3313
276 Ga0496106_0044785 3300048909 Bacteria 3322
277 Ga0496106_0217139 3300048909 Bacteria 1524
278 Ga0496106_0309982 3300048909 Bacteria 1266
279 Ga0496107_0015334 3300048910 Bacteria 5370
280 Ga0496108_0015685 3300048911 Bacteria 6180
281 Ga0496108_0085371 3300048911 Bacteria 2679
282 Ga0496108_0664816 3300048911 Bacteria 905
283 Ga0496109_0018139 3300048912 Bacteria 6180
284 Ga0496109_0218896 3300048912 Bacteria 1791
285 Ga0496109_1326501 3300048912 Bacteria 655
286 Ga0496110_0024669 3300048913 Bacteria 5128
287 Ga0496110_0086116 3300048913 Bacteria 2805
288 Ga0496110_0133743 3300048913 Bacteria 2240
289 Ga0496110_0637504 3300048913 Bacteria 965
290 Ga0496110_0882669 3300048913 Bacteria 800
291 Ga0496111_0015683 3300048914 Bacteria 5208
292 Ga0496111_0113511 3300048914 Bacteria 1996
293 Ga0496112_0002917 3300048915 Bacteria 13926
294 Ga0496113_0016349 3300048916 Bacteria 5123
295 Ga0496113_0149330 3300048916 Bacteria 1843
296 Ga0496113_0329777 3300048916 Bacteria 1224
297 Ga0496113_0507498 3300048916 Bacteria 968
298 Ga0496114_0234444 3300048917 Bacteria 1613
299 Ga0496114_1200272 3300048917 Bacteria 645
300 Ga0496115_0003259 3300048918 Bacteria 11644
301 Ga0496115_0047011 3300048918 Bacteria 3450
302 Ga0496115_0068028 3300048918 Bacteria 2883
303 Ga0496115_0355575 3300048918 Bacteria 1194
304 Ga0496115_0548493 3300048918 Unclassified 924
305 Ga0501033_0615607 3300049570 Bacteria 744
306 Ga0501209_077048 3300049656 Unclassified 957
307 Ga0501080_0864778 3300049742 Bacteria 790
308 nmdc:mga0yw44_239377_c1 3300050492 Bacteria 1206
309 nmdc:mga0yw44_282814_c1 3300050492 Bacteria 1109
310 nmdc:mga05p37_16172_c1 3300050507 Bacteria 8983
311 nmdc:mga09592_1841_c1 3300050508 Bacteria 17052
312 nmdc:mga06r32_11791_c1 3300050510 Bacteria 7873
313 nmdc:mga06r32_163084_c1 3300050510 Bacteria 2211
314 nmdc:mga08y16_530345_c1 3300050511 Bacteria 1193
315 nmdc:mga0n895_8568_c1 3300050512 Bacteria 8865
316 nmdc:mga0rr50_1306865_c1 3300050513 Bacteria 615
317 nmdc:mga0rr50_1849882_c1 3300050513 Bacteria 508
318 nmdc:mga0a205_486749_c1 3300050515 Bacteria 1091
319 Ga0495601_0000006 3300053077 Bacteria 373770
320 Ga0495601_0301288 3300053077 Bacteria 1044
321 Ga0495612_0000004 3300053078 Bacteria 286946
322 Ga0495595_0004715 3300053084 Bacteria 5485
323 Ga0495595_0332620 3300053084 Bacteria 766
324 Ga0495619_0000027 3300053085 Bacteria 165001
325 Ga0495619_0062725 3300053085 Bacteria 2474
326 Ga0495619_0616797 3300053085 Bacteria 741
327 Ga0500555_102961 3300053103 Bacteria 723
328 Ga0500556_0001942 3300053104 Bacteria 7313
329 Ga0501082_0000434 3300060353 Bacteria 37104
330 2513622666 2513237092 Bacteria 8341956
331 2617378486 2617270741 Bacteria 8201522
332 2824680378 2824679649 Bacteria 8248951
333 2824740708 2824732956 Bacteria 7810675
334 2824748440 2824746037 Bacteria 7911610
335 2881368219 2881364244 Bacteria 7710352
336 2881667709 2881665667 Bacteria 8175609
337 2908780729 2908775508 Bacteria 8092255
338 2922397506 2922393267 Bacteria 8285685
339 3005485138 3005483717 Bacteria 7877331
340 3005587464 3005587118 Bacteria 7794411
341 Ga0453684_0410728
342 Ga0065714_10083581
343 Ga0065704_10043202
344 Ga0065715_10004267
345 Ga0065707_10123090
346 Ga0070670_100114112
347 Ga0068869_100223702
348 Ga0068869_100480154
349 Ga0070680_101544925
350 Ga0070668_100918761
351 Ga0070669_100416768
352 Ga0070675_100066145
353 Ga0070675_100942033
354 Ga0070671_100087138
355 Ga0070674_100047933
356 Ga0070673_100425946
357 Ga0070667_101425538
358 Ga0070703_10008485
359 Ga0070709_10047723
360 Ga0070714_100029184
361 Ga0070713_100078762
362 Ga0070713_101892538
363 Ga0070710_10186939
364 Ga0070700_100263682
365 Ga0070694_100835994
366 Ga0070708_100050380
367 Ga0070708_100380381
368 Ga0070708_100655379
369 Ga0070681_10482439
370 Ga0070681_10497003
371 Ga0070706_100013561
372 Ga0070706_100170421
373 Ga0070707_100480822
374 Ga0070698_101299535
375 Ga0070699_100133593
376 Ga0070699_100768786
377 Ga0070699_101194341
378 Ga0070679_100543895
379 Ga0070697_100020738
380 Ga0070695_100091235
381 Ga0070695_100422288
382 Ga0070695_100619725
383 Ga0070696_100411094
384 Ga0070665_101029901
385 Ga0070704_100002695
386 Ga0070704_100939849
387 Ga0070664_100161936
388 Ga0068859_100280150
389 Ga0068864_100324492
390 Ga0068870_10106842
391 Ga0068860_100587890
392 Ga0068862_100219014
393 Ga0081455_10366804
394 Ga0081539_10075959
395 Ga0070717_10032628
396 Ga0070717_10961196
397 Ga0075365_10048152
398 Ga0075365_10175501
399 Ga0070715_10029142
400 Ga0075431_100033085
401 Ga0075434_100005665
402 Ga0097620_100280152
403 Ga0097620_100494729
404 Ga0099824_1020287
405 Ga0075435_100101266
406 Ga0075435_100674385
407 Ga0075435_101880917
408 Ga0099794_10012609
409 Ga0105240_10002656
410 Ga0111539_10100652
411 Ga0111539_10178139
412 Ga0111539_10300985
413 Ga0105245_10852052
414 Ga0105247_10033892
415 Ga0114129_10006769
416 Ga0114129_12410476
417 Ga0105248_10666569
418 Ga0105237_10001323
419 Ga0157374_10694814
420 Ga0163162_10401917
421 Ga0157375_10031179
422 Ga0157375_11924354
423 Ga0163163_10059897
424 Ga0163163_10061947
425 Ga0157380_10064766
426 Ga0157380_10320866
427 Ga0214544_1000004
428 Ga0214542_1000001
429 Ga0214542_1047691
430 Ga0214545_1000001
431 Ga0214545_1048704
432 Ga0214543_1000006
433 Ga0214543_1048555
434 Ga0213874_10020931
435 Ga0213874_10234561
436 Ga0207697_10091196
437 Ga0207653_10014959
438 Ga0207682_10026454
439 Ga0207692_10622498
440 Ga0207688_10019569
441 Ga0207699_10056822
442 Ga0207643_10014573
443 Ga0207684_10023749
444 Ga0207684_10074011
445 Ga0207707_10158040
446 Ga0207707_10419201
447 Ga0207707_10480333
448 Ga0207695_10005488
449 Ga0207671_10026733
450 Ga0207652_10980638
451 Ga0207646_10443730
452 Ga0207681_10908122
453 Ga0207650_10007215
454 Ga0207659_10967021
455 Ga0207700_11532916
456 Ga0207664_10096537
457 Ga0207644_10432066
458 Ga0207690_10619173
459 Ga0207670_10078485
460 Ga0207691_10011990
461 Ga0207679_10533881
462 Ga0207651_10036083
463 Ga0207651_11157300
464 Ga0207668_11408787
465 Ga0207703_11053132
466 Ga0207708_10067947
467 Ga0207702_10388491
468 Ga0207676_10720066
469 Ga0209389_1000010
470 Ga0209589_1000016
471 Ga0209489_100016
472 Ga0209588_1094950
473 Ga0268266_10314545
474 Ga0268265_10356000
475 Ga0268265_10813433
476 Ga0265325_10213156
477 Ga0265329_10015354
478 Ga0265340_10002096
479 Ga0265339_10001221
480 Ga0265331_10039798
481 Ga0307408_100039522
482 Ga0316579_10220108
483 Ga0265314_10057626
484 Ga0265342_10000035
485 Ga0307405_10626784
486 Ga0307405_11034123
487 Ga0307410_10083541
488 Ga0307412_10096377
489 Ga0307412_10564787
490 Ga0307416_100343709
491 Ga0316580_10116899
492 Ga0373944_0235206
493 Ga0373923_0019568
494 Ga0373936_0002195
495 Ga0373953_0020857
496 Ga0373953_0056169
497 Ga0373954_0001214
498 Ga0373954_0100520
499 Ga0373956_0070970
500 Ga0373957_0079887
501 Ga0373943_0014210
502 Ga0373943_0437976
503 Ga0373946_0009915
504 Ga0373955_0004180
505 Ga0373955_0272991
506 Ga0373924_0006406
507 Ga0373924_0040718
508 Ga0373931_0119596
509 Ga0373935_0000980
510 Ga0373927_0008272
511 Ga0373933_0004767
512 Ga0373933_0245441
513 Ga0373947_0000492
514 Ga0373947_0116856
515 Ga0373947_0182582
516 Ga0373937_0003427
517 Ga0373937_0015179
518 Ga0373937_0657215
519 Ga0316582_0132123
520 Ga0316584_0049591
521 Ga0316584_0103041
522 Ga0373925_0000018
523 Ga0395900_0001701
524 Ga0395900_0040641
525 Ga0395898_0007735
526 Ga0395898_0794349
527 Ga0436364_0305538
528 Ga0395901_0014195
529 Ga0395901_0075186
530 Ga0436365_0693216
531 Ga0436360_0669886
532 Ga0436361_0616781
533 Ga0436361_0827636
534 Ga0436363_0302347
535 Ga0436363_1185356
536 Ga0439431_0240712
537 Ga0439449_0000980
538 Ga0439452_080847
539 Ga0439457_016014
540 Ga0439462_0009597
541 Ga0466972_0013926
542 Ga0466967_0535320
543 Ga0466967_0839715
544 Ga0495592_0000001
545 Ga0495603_0224786
546 Ga0495629_0017298
547 Ga0495629_0058402
548 Ga0495651_0003294
549 Ga0495653_0000092
550 Ga0495582_0019402
551 Ga0495582_0571941
552 Ga0495662_0087733
553 Ga0495662_0101030
554 Ga0495664_0000001
555 Ga0495594_0167248
556 Ga0495606_0038206
557 Ga0495608_0000050
558 Ga0495618_0000064
559 Ga0495618_0063985
560 Ga0495628_0000003
561 Ga0495630_0010199
562 Ga0495630_0338431
563 Ga0495652_0000001
564 Ga0495640_0000006
565 Ga0495640_0220587
566 Ga0495640_0763327
567 Ga0495587_0000028
568 Ga0495645_0000004
569 Ga0495667_0000001
570 Ga0495634_0002741
571 Ga0495635_0000015
572 Ga0495635_0351711
573 Ga0495657_0000155
574 Ga0495599_0000029
575 Ga0495623_0002458
576 Ga0495646_0000006
577 Ga0495658_0071959
578 Ga0495658_0432780
579 Ga0495613_0079093
580 Ga0495613_0929796
581 Ga0495624_0120326
582 Ga0495624_0311550
583 Ga0495600_0000286
584 Ga0495581_0063516
585 Ga0495581_0763769
586 Ga0495604_0000091
587 Ga0495674_0000001
588 Ga0495676_0656813
589 Ga0495680_0021652
590 Ga0495680_0369237
591 Ga0495683_0164951
592 Ga0495675_0000839
593 Ga0495684_0000055
594 Ga0495684_0065427
595 Ga0495593_0004124
596 Ga0495593_0056083
597 Ga0495602_0000002
598 Ga0495614_0057462
599 Ga0496100_0421571
600 Ga0496101_0045847
601 Ga0496101_0287762
602 Ga0496102_0171619
603 Ga0496102_0221457
604 Ga0496102_0763511
605 Ga0496103_0079194
606 Ga0496104_0000383
607 Ga0496104_0012302
608 Ga0496104_0012711
609 Ga0496104_0033664
610 Ga0496104_0260229
611 Ga0496104_1090362
612 Ga0496105_0019451
613 Ga0496105_0046211
614 Ga0496105_0050612
615 Ga0496105_0054161
616 Ga0496106_0044785
617 Ga0496106_0217139
618 Ga0496106_0309982
619 Ga0496107_0015334
620 Ga0496108_0015685
621 Ga0496108_0085371
622 Ga0496108_0664816
623 Ga0496109_0018139
624 Ga0496109_0218896
625 Ga0496109_1326501
626 Ga0496110_0024669
627 Ga0496110_0086116
628 Ga0496110_0133743
629 Ga0496110_0637504
630 Ga0496110_0882669
631 Ga0496111_0015683
632 Ga0496111_0113511
633 Ga0496112_0002917
634 Ga0496113_0016349
635 Ga0496113_0149330
636 Ga0496113_0329777
637 Ga0496113_0507498
638 Ga0496114_0234444
639 Ga0496114_1200272
640 Ga0496115_0003259
641 Ga0496115_0047011
642 Ga0496115_0068028
643 Ga0496115_0355575
644 Ga0496115_0548493
645 Ga0501033_0615607
646 Ga0501209_077048
647 Ga0501080_0864778
648 nmdc:mga0yw44_239377_c1
649 nmdc:mga0yw44_282814_c1
650 nmdc:mga05p37_16172_c1
651 nmdc:mga09592_1841_c1
652 nmdc:mga06r32_11791_c1
653 nmdc:mga06r32_163084_c1
654 nmdc:mga08y16_530345_c1
655 nmdc:mga0n895_8568_c1
656 nmdc:mga0rr50_1306865_c1
657 nmdc:mga0rr50_1849882_c1
658 nmdc:mga0a205_486749_c1
659 Ga0495601_0000006
660 Ga0495601_0301288
661 Ga0495612_0000004
662 Ga0495595_0004715
663 Ga0495595_0332620
664 Ga0495619_0000027
665 Ga0495619_0062725
666 Ga0495619_0616797
667 Ga0500555_102961
668 Ga0500556_0001942
669 Ga0501082_0000434
670 2513622666
671 2617378486
672 2824680378
673 2824740708
674 2824748440
675 2881368219
676 2881667709
677 2908780729
678 2922397506
679 3005485138
680 3005587464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

24

163

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
5w8m-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8267 6 156
1s3l-assembly1.cif.gz_A structural and functional characterization of a novel archaeal phosphodiesterase 0.8122 6 155
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.7987 1 154
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7986 6 157
3qfn-assembly1.cif.gz_B crystal structure of streptococcal asymmetric ap4a hydrolase and phosphodiesterase spr1479/saph in complex with inorganic phosphate 0.7962 6 156
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8519 6 153 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.838 6 157 3.60.21.10
1s3lA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8122 6 155 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8085 6 157 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8055 6 153 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A7V8NNJ3-F1-model_v4 Metallophosphoesterase family protein 1.003 8 70
AF-A0A2V9ZU70-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9978 6 115 GO:0016787
GO:0046872
AF-W4L4G6-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9978 6 70
AF-A0A2V7E4R1-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9977 4 155 GO:0016787
GO:0046872
AF-A0A530HE49-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9977 6 123 GO:0016787
GO:0046872

Map