F414508

General Info

Members Datasets Scaffolds Average Seq Length
340 166 340 226

Family's Representative Sequence

Representative Sequence 3300049584|Ga0501068_0098243|Ga0501068_0098243_573_1364
Length 263
Sequence LNPSYAQIRARIDKAAQAAGHAVRLLAVSKTQAASAIRELSVQGQLAFGENRVQEALTKQQALTDLNLEWHLIGPLQSNKCREAALQFDWLQSLDREKLLEPLNRFRPADAPPLNVLVQVNIDAEASKSGCTPAAVPMLARAIAQFPRLRLRGLMAIPEPHPDSARRRATFARMRDLFESLRPDHPDIDTLSMGMSDDFELAIAEGATLVRIGTALFGARPSPIRPCCGTPCIVRTNRVDSRTRLKQRARNHCLVNHLMRRVS

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
119 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
127 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
128 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
132 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
133 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
134 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
135 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
136 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
137 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
138 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
139 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
140 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
141 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
143 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
149 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
150 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
151 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
152 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
158 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
161 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
162 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
163 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
164 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
165 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.76
Nodule 0
Rhizoplane 0.88
Rhizosphere 94.41
Stem 0
Stem Tuber 0
Unclassified 2.94

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10047190 3300005327 Bacteria 3485
2 Ga0070658_10098624 3300005327 Bacteria 2413
3 Ga0070658_10235197 3300005327 Bacteria 1552
4 Ga0070676_10042819 3300005328 Bacteria 2631
5 Ga0070683_100066135 3300005329 Bacteria 3367
6 Ga0070690_100023709 3300005330 Bacteria 3767
7 Ga0070690_100080579 3300005330 Bacteria 2129
8 Ga0070670_100089092 3300005331 Bacteria 2652
9 Ga0068869_100015489 3300005334 Bacteria 5116
10 Ga0068869_100585895 3300005334 Unclassified 941
11 Ga0070666_10007605 3300005335 Bacteria 6684
12 Ga0070666_10044605 3300005335 Bacteria 2970
13 Ga0070666_10113058 3300005335 Bacteria 1878
14 Ga0070666_10119778 3300005335 Bacteria 1825
15 Ga0068868_100226556 3300005338 Bacteria 1567
16 Ga0070661_100050745 3300005344 Bacteria 3036
17 Ga0070668_100015331 3300005347 Bacteria 5727
18 Ga0070668_100285586 3300005347 Bacteria 1379
19 Ga0070669_100068716 3300005353 Bacteria 2616
20 Ga0070675_100255750 3300005354 Bacteria 1534
21 Ga0070675_100596321 3300005354 Bacteria 1002
22 Ga0070673_100193988 3300005364 Bacteria 1746
23 Ga0070673_100376407 3300005364 Bacteria 1265
24 Ga0070667_100000065 3300005367 Bacteria 135172
25 Ga0070667_100072738 3300005367 Bacteria 2930
26 Ga0070667_100154226 3300005367 Bacteria 2019
27 Ga0070667_100175881 3300005367 Bacteria 1892
28 Ga0070667_100198853 3300005367 Bacteria 1778
29 Ga0070709_10319158 3300005434 Bacteria 1139
30 Ga0070663_100000323 3300005455 Bacteria 24799
31 Ga0070663_100376781 3300005455 Bacteria 1155
32 Ga0070663_100625008 3300005455 Bacteria 908
33 Ga0070678_100002751 3300005456 Bacteria 9716
34 Ga0070678_100180517 3300005456 Bacteria 1727
35 Ga0070662_100339422 3300005457 Bacteria 1229
36 Ga0070681_10000006 3300005458 Bacteria 169066
37 Ga0070681_10160246 3300005458 Bacteria 2174
38 Ga0068867_100021286 3300005459 Bacteria 4627
39 Ga0068867_100150852 3300005459 Bacteria 1825
40 Ga0070679_100374287 3300005530 Bacteria 1371
41 Ga0070684_100292210 3300005535 Bacteria 1494
42 Ga0068853_100004932 3300005539 Bacteria 10391
43 Ga0068853_100016082 3300005539 Bacteria 6153
44 Ga0068853_100058712 3300005539 Bacteria 3321
45 Ga0068853_100104751 3300005539 Bacteria 2505
46 Ga0068853_100323763 3300005539 Bacteria 1429
47 Ga0070672_100012694 3300005543 Bacteria 5928
48 Ga0070672_100085389 3300005543 Bacteria 2537
49 Ga0070686_100339974 3300005544 Bacteria 1125
50 Ga0070696_100155448 3300005546 Bacteria 1682
51 Ga0070693_100224907 3300005547 Bacteria 1232
52 Ga0070665_100398712 3300005548 Bacteria 1383
53 Ga0070665_100469443 3300005548 Bacteria 1269
54 Ga0070665_101112013 3300005548 Bacteria 802
55 Ga0068855_100013929 3300005563 Bacteria 9698
56 Ga0068855_100148069 3300005563 Bacteria 2671
57 Ga0068855_100367222 3300005563 Bacteria 1583
58 Ga0068855_100408605 3300005563 Bacteria 1487
59 Ga0070664_100051863 3300005564 Bacteria 3474
60 Ga0068857_100224540 3300005577 Bacteria 1716
61 Ga0068857_100856096 3300005577 Bacteria 870
62 Ga0068856_100014180 3300005614 Bacteria 7704
63 Ga0068856_100019846 3300005614 Bacteria 6526
64 Ga0068856_100154260 3300005614 Bacteria 2306
65 Ga0068856_100244281 3300005614 Bacteria 1810
66 Ga0068852_100002303 3300005616 Bacteria 13129
67 Ga0068852_100013899 3300005616 Bacteria 6174
68 Ga0068852_100100664 3300005616 Bacteria 2608
69 Ga0068859_100766594 3300005617 Bacteria 1053
70 Ga0068864_100033089 3300005618 Bacteria 4394
71 Ga0068866_10054141 3300005718 Bacteria 2055
72 Ga0068870_10072000 3300005840 Bacteria 1888
73 Ga0068863_100006433 3300005841 Bacteria 11520
74 Ga0068863_100007265 3300005841 Bacteria 10849
75 Ga0068863_100145522 3300005841 Bacteria 2266
76 Ga0068863_100179677 3300005841 Bacteria 2031
77 Ga0068863_100344235 3300005841 Bacteria 1451
78 Ga0068863_100359501 3300005841 Bacteria 1419
79 Ga0068858_100438555 3300005842 Bacteria 1258
80 Ga0068858_100560410 3300005842 Bacteria 1106
81 Ga0068862_100045337 3300005844 Bacteria 3752
82 Ga0068862_100163895 3300005844 Bacteria 1986
83 Ga0097621_100116512 3300006237 Bacteria 2262
84 Ga0097621_100158139 3300006237 Bacteria 1946
85 Ga0097621_100538672 3300006237 Bacteria 1061
86 Ga0068871_100024015 3300006358 Bacteria 4724
87 Ga0068871_100110064 3300006358 Bacteria 2316
88 Ga0068871_100235745 3300006358 Bacteria 1589
89 Ga0068865_100003484 3300006881 Bacteria 9432
90 Ga0068865_100034824 3300006881 Bacteria 3381
91 Ga0097620_100752770 3300006931 Bacteria 1063
92 Ga0097620_100766603 3300006931 Bacteria 1053
93 Ga0105240_10036912 3300009093 Bacteria 6283
94 Ga0105240_10183751 3300009093 Bacteria 2465
95 Ga0105240_10441285 3300009093 Bacteria 1458
96 Ga0105245_10112069 3300009098 Bacteria 2538
97 Ga0105245_10256967 3300009098 Bacteria 1699
98 Ga0105241_10007418 3300009174 Bacteria 8071
99 Ga0105241_10023728 3300009174 Bacteria 4550
100 Ga0105241_10477969 3300009174 Bacteria 1107
101 Ga0105242_10087290 3300009176 Bacteria 2619
102 Ga0105242_10648617 3300009176 Bacteria 1026
103 Ga0105248_10052542 3300009177 Bacteria 4572
104 Ga0105248_10373936 3300009177 Bacteria 1604
105 Ga0105237_10005392 3300009545 Bacteria 14452
106 Ga0105237_10046122 3300009545 Bacteria 4384
107 Ga0105238_10010067 3300009551 Bacteria 9484
108 Ga0105238_10045986 3300009551 Bacteria 4408
109 Ga0105238_10060412 3300009551 Bacteria 3794
110 Ga0105249_10000221 3300009553 Bacteria 64924
111 Ga0105249_10209333 3300009553 Bacteria 1913
112 Ga0105249_10424709 3300009553 Bacteria 1364
113 Ga0105249_10778288 3300009553 Bacteria 1020
114 Ga0105239_10010154 3300010375 Bacteria 10550
115 Ga0105239_10016417 3300010375 Bacteria 8187
116 Ga0105239_10023284 3300010375 Bacteria 6823
117 Ga0105239_10287131 3300010375 Bacteria 1852
118 Ga0105239_10899367 3300010375 Bacteria 1016
119 Ga0105246_10049640 3300011119 Bacteria 2874
120 Ga0157373_10038772 3300013100 Bacteria 3414
121 Ga0157373_10291236 3300013100 Bacteria 1158
122 Ga0157371_10286405 3300013102 Bacteria 1191
123 Ga0157370_10020832 3300013104 Bacteria 6542
124 Ga0157370_10096706 3300013104 Bacteria 2770
125 Ga0157370_10103241 3300013104 Bacteria 2669
126 Ga0157370_10331144 3300013104 Bacteria 1404
127 Ga0157369_10000114 3300013105 Bacteria 113453
128 Ga0157369_10014852 3300013105 Bacteria 8789
129 Ga0157369_10128079 3300013105 Bacteria 2690
130 Ga0157374_10249492 3300013296 Bacteria 1746
131 Ga0157374_10428663 3300013296 Bacteria 1322
132 Ga0157378_10000322 3300013297 Bacteria 47146
133 Ga0157378_10041842 3300013297 Bacteria 4065
134 Ga0157378_10108509 3300013297 Bacteria 2542
135 Ga0163162_10018746 3300013306 Bacteria 6782
136 Ga0163162_10048786 3300013306 Bacteria 4242
137 Ga0163162_10058299 3300013306 Bacteria 3890
138 Ga0163162_10093354 3300013306 Bacteria 3094
139 Ga0157372_10004055 3300013307 Bacteria 15698
140 Ga0157372_10055037 3300013307 Bacteria 4441
141 Ga0157372_10518556 3300013307 Bacteria 1389
142 Ga0157372_10671104 3300013307 Bacteria 1207
143 Ga0157375_10000459 3300013308 Bacteria 37058
144 Ga0157375_10130162 3300013308 Bacteria 2635
145 Ga0157375_10270868 3300013308 Bacteria 1860
146 Ga0157375_10567025 3300013308 Bacteria 1296
147 Ga0163163_10000404 3300014325 Bacteria 40714
148 Ga0163163_10080418 3300014325 Bacteria 3259
149 Ga0163163_10102868 3300014325 Bacteria 2881
150 Ga0182008_10054109 3300014497 Bacteria 1986
151 Ga0157379_10009947 3300014968 Bacteria 8284
152 Ga0157379_10044170 3300014968 Bacteria 3978
153 Ga0157379_10157803 3300014968 Bacteria 2047
154 Ga0157376_10005681 3300014969 Bacteria 8738
155 Ga0157376_10051310 3300014969 Bacteria 3426
156 Ga0157376_10163678 3300014969 Bacteria 2019
157 Ga0157376_10174697 3300014969 Bacteria 1959
158 Ga0157376_10723467 3300014969 Bacteria 1002
159 Ga0182007_10054351 3300015262 Bacteria 1317
160 Ga0163161_10117976 3300017792 Bacteria 1991
161 Ga0207656_10274146 3300025321 Bacteria 831
162 Ga0207680_10000218 3300025903 Bacteria 27690
163 Ga0207680_10033774 3300025903 Bacteria 2922
164 Ga0207680_10106237 3300025903 Bacteria 1812
165 Ga0207647_10007321 3300025904 Bacteria 7982
166 Ga0207699_10135696 3300025906 Bacteria 1611
167 Ga0207645_10025450 3300025907 Bacteria 3829
168 Ga0207643_10048065 3300025908 Bacteria 2416
169 Ga0207654_10000266 3300025911 Bacteria 31883
170 Ga0207707_10001002 3300025912 Bacteria 27055
171 Ga0207707_10544811 3300025912 Bacteria 986
172 Ga0207695_10000359 3300025913 Bacteria 104462
173 Ga0207695_10033139 3300025913 Bacteria 5642
174 Ga0207695_10430273 3300025913 Bacteria 1204
175 Ga0207695_10759915 3300025913 Bacteria 849
176 Ga0207671_10000940 3300025914 Bacteria 36298
177 Ga0207671_10001203 3300025914 Bacteria 30754
178 Ga0207671_10002422 3300025914 Bacteria 19967
179 Ga0207663_10372299 3300025916 Bacteria 1086
180 Ga0207660_10055463 3300025917 Bacteria 2832
181 Ga0207657_10044918 3300025919 Bacteria 3881
182 Ga0207649_10207390 3300025920 Bacteria 1388
183 Ga0207649_10333761 3300025920 Bacteria 1118
184 Ga0207649_10624243 3300025920 Bacteria 831
185 Ga0207652_10093346 3300025921 Bacteria 2648
186 Ga0207652_10150068 3300025921 Bacteria 2087
187 Ga0207681_10165986 3300025923 Bacteria 1669
188 Ga0207694_10014315 3300025924 Bacteria 5980
189 Ga0207694_10035262 3300025924 Bacteria 3838
190 Ga0207694_10275793 3300025924 Bacteria 1380
191 Ga0207650_10315129 3300025925 Bacteria 1280
192 Ga0207690_10125346 3300025932 Bacteria 1872
193 Ga0207706_10390216 3300025933 Bacteria 1208
194 Ga0207686_10034560 3300025934 Bacteria 3026
195 Ga0207669_10806032 3300025937 Bacteria 779
196 Ga0207704_10002700 3300025938 Bacteria 8007
197 Ga0207691_10020532 3300025940 Bacteria 6246
198 Ga0207691_10025673 3300025940 Bacteria 5529
199 Ga0207711_10001306 3300025941 Bacteria 23569
200 Ga0207711_10094208 3300025941 Bacteria 2639
201 Ga0207689_10017009 3300025942 Bacteria 6153
202 Ga0207689_10085306 3300025942 Bacteria 2596
203 Ga0207689_10218444 3300025942 Bacteria 1575
204 Ga0207661_10085104 3300025944 Bacteria 2620
205 Ga0207667_10006234 3300025949 Bacteria 14473
206 Ga0207667_10077055 3300025949 Bacteria 3458
207 Ga0207667_10435278 3300025949 Bacteria 1334
208 Ga0207651_10131938 3300025960 Bacteria 1914
209 Ga0207712_10000107 3300025961 Bacteria 94254
210 Ga0207668_10058206 3300025972 Bacteria 2700
211 Ga0207658_10000114 3300025986 Bacteria 88818
212 Ga0207658_10143805 3300025986 Bacteria 1934
213 Ga0207658_10143921 3300025986 Bacteria 1933
214 Ga0207677_10096899 3300026023 Bacteria 2159
215 Ga0207677_10268582 3300026023 Bacteria 1394
216 Ga0207703_10052315 3300026035 Bacteria 3315
217 Ga0207703_10512262 3300026035 Bacteria 1127
218 Ga0207639_10000258 3300026041 Bacteria 38476
219 Ga0207639_10029293 3300026041 Bacteria 4029
220 Ga0207639_10036965 3300026041 Bacteria 3623
221 Ga0207639_10075076 3300026041 Bacteria 2657
222 Ga0207639_10208831 3300026041 Bacteria 1679
223 Ga0207639_10320966 3300026041 Bacteria 1375
224 Ga0207639_10645124 3300026041 Bacteria 979
225 Ga0207678_10001080 3300026067 Bacteria 24986
226 Ga0207678_10266259 3300026067 Bacteria 1469
227 Ga0207702_10001632 3300026078 Bacteria 22176
228 Ga0207702_10254954 3300026078 Bacteria 1649
229 Ga0207702_10903393 3300026078 Bacteria 875
230 Ga0207641_10047489 3300026088 Bacteria 3620
231 Ga0207641_10128000 3300026088 Bacteria 2276
232 Ga0207648_10015569 3300026089 Bacteria 6988
233 Ga0207648_10019820 3300026089 Bacteria 6070
234 Ga0207648_10353726 3300026089 Bacteria 1324
235 Ga0207676_10018568 3300026095 Bacteria 5058
236 Ga0207674_10006181 3300026116 Bacteria 14129
237 Ga0207674_10794659 3300026116 Bacteria 913
238 Ga0207675_100703301 3300026118 Unclassified 1020
239 Ga0207683_10004575 3300026121 Bacteria 11916
240 Ga0207683_10017684 3300026121 Bacteria 6079
241 Ga0207683_10066132 3300026121 Bacteria 3188
242 Ga0207698_10007442 3300026142 Bacteria 6856
243 Ga0207698_10018903 3300026142 Bacteria 4705
244 Ga0207698_10025546 3300026142 Bacteria 4163
245 Ga0207698_10067410 3300026142 Bacteria 2822
246 Ga0207698_10158265 3300026142 Bacteria 1977
247 Ga0207698_10422382 3300026142 Bacteria 1279
248 Ga0207698_11013999 3300026142 Bacteria 841
249 Ga0268266_10081688 3300028379 Bacteria 2819
250 Ga0268266_10216056 3300028379 Bacteria 1760
251 Ga0268266_10437314 3300028379 Bacteria 1242
252 Ga0268265_10031668 3300028380 Bacteria 3821
253 Ga0268265_10199788 3300028380 Bacteria 1734
254 Ga0268264_10041126 3300028381 Bacteria 3822
255 Ga0268264_10086790 3300028381 Bacteria 2689
256 Ga0268264_10261747 3300028381 Bacteria 1612
257 Ga0307509_10052848 3300031507 Bacteria 4336
258 Ga0307507_10050508 3300033179 Bacteria 4013
259 Ga0373957_0086999 3300035120 Bacteria 1238
260 Ga0373955_0461956 3300035172 Bacteria 774
261 Ga0395900_0001309 3300037418 Bacteria 30258
262 Ga0395900_0055165 3300037418 Bacteria 4092
263 Ga0395898_0578772 3300037466 Bacteria 1065
264 Ga0451807_0586572 3300041486 Bacteria 1348
265 Ga0451577_0094550 3300042876 Bacteria 2669
266 Ga0495603_0030195 3300046455 Bacteria 3266
267 Ga0495580_0018830 3300046472 Bacteria 5138
268 Ga0495639_0050962 3300046475 Bacteria 1881
269 Ga0495657_0036094 3300046675 Bacteria 3419
270 Ga0495658_0017152 3300046683 Bacteria 3736
271 Ga0495686_0010519 3300047472 Bacteria 6575
272 Ga0495593_0049364 3300047673 Bacteria 2233
273 Ga0496104_0000041 3300048907 Bacteria 161394
274 Ga0496105_0000022 3300048908 Bacteria 161208
275 Ga0496117_0040092 3300048920 Bacteria 3450
276 Ga0496117_0137788 3300048920 Bacteria 1467
277 Ga0496117_0153422 3300048920 Bacteria 1360
278 Ga0496118_0000101 3300048921 Bacteria 159577
279 Ga0496118_0000264 3300048921 Bacteria 91882
280 Ga0496121_0136916 3300048924 Bacteria 1823
281 Ga0496122_0000212 3300048925 Bacteria 129245
282 Ga0496123_0003184 3300048926 Bacteria 18734
283 Ga0501032_0001459 3300049569 Bacteria 18794
284 Ga0501032_0204210 3300049569 Bacteria 1289
285 Ga0501033_0006045 3300049570 Bacteria 9488
286 Ga0501034_0007119 3300049571 Bacteria 11931
287 Ga0501034_0041200 3300049571 Bacteria 4672
288 Ga0501034_0149318 3300049571 Bacteria 2313
289 Ga0501034_0448931 3300049571 Bacteria 1207
290 Ga0501036_0012332 3300049572 Bacteria 7078
291 Ga0501036_0049398 3300049572 Bacteria 3562
292 Ga0501038_0008808 3300049574 Bacteria 9257
293 Ga0501038_0087248 3300049574 Bacteria 2620
294 Ga0501039_0006854 3300049575 Bacteria 8667
295 Ga0501043_0263323 3300049579 Bacteria 1325
296 Ga0501046_0001553 3300049580 Bacteria 21923
297 Ga0501046_0137642 3300049580 Bacteria 1849
298 Ga0501047_0003391 3300049581 Bacteria 15079
299 Ga0501047_0009312 3300049581 Bacteria 9275
300 Ga0501047_0046459 3300049581 Bacteria 4196
301 Ga0501067_0000679 3300049583 Bacteria 18323
302 Ga0501068_0023740 3300049584 Bacteria 3596
303 Ga0501068_0098243 3300049584 Bacteria 1812
304 Ga0501068_0336208 3300049584 Bacteria 969
305 Ga0501069_0112150 3300049585 Bacteria 1553
306 Ga0501069_0180197 3300049585 Bacteria 1221
307 Ga0501070_0024853 3300049586 Bacteria 5023
308 Ga0501070_0044784 3300049586 Bacteria 3680
309 Ga0501070_0050074 3300049586 Bacteria 3468
310 Ga0501070_0108597 3300049586 Bacteria 2292
311 Ga0501070_0188355 3300049586 Bacteria 1696
312 Ga0501072_0001569 3300049588 Bacteria 17055
313 Ga0501073_0002650 3300049589 Bacteria 13415
314 Ga0501073_0038750 3300049589 Bacteria 3379
315 Ga0501073_0457676 3300049589 Bacteria 882
316 Ga0501074_0055966 3300049590 Bacteria 2842
317 Ga0501074_0175010 3300049590 Bacteria 1531
318 Ga0501074_0362171 3300049590 Bacteria 1029
319 Ga0501079_0233983 3300049741 Bacteria 1435
320 Ga0501079_0263741 3300049741 Bacteria 1346
321 Ga0501080_0003901 3300049742 Bacteria 13206
322 Ga0501080_0034205 3300049742 Bacteria 4743
323 Ga0501080_0037581 3300049742 Bacteria 4523
324 Ga0501080_0111766 3300049742 Bacteria 2532
325 Ga0501080_0129960 3300049742 Bacteria 2331
326 Ga0501083_0003475 3300049744 Bacteria 11017
327 Ga0501035_0019699 3300049822 Bacteria 6199
328 Ga0501035_0390706 3300049822 Bacteria 1159
329 Ga0501044_0006152 3300049823 Bacteria 13257
330 Ga0500610_0000097 3300053079 Bacteria 25957
331 Ga0500643_014585 3300053087 Bacteria 2725
332 Ga0500651_0016256 3300053093 Bacteria 4576
333 Ga0500651_0132709 3300053093 Bacteria 1505
334 Ga0500597_000037 3300053120 Bacteria 26711
335 Ga0501084_0031037 3300054114 Bacteria 4469
336 Ga0501084_0319291 3300054114 Bacteria 1312
337 Ga0500661_002907 3300055283 Bacteria 3224
338 Ga0501082_0028450 3300060353 Bacteria 4815
339 Ga0501082_0112153 3300060353 Bacteria 2361
340 Ga0501082_0233031 3300060353 Bacteria 1602

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009174 Ga0105241_10477969 Ga0105241_104779692 208
2 3300009098 Ga0105245_10112069 Ga0105245_101120692 211
3 3300013297 Ga0157378_10108509 Ga0157378_101085094 211
4 3300009176 Ga0105242_10648617 Ga0105242_106486171 212
5 3300053093 Ga0500651_0132709 Ga0500651_0132709_494_1162 213
6 3300049574 Ga0501038_0008808 Ga0501038_0008808_8076_8765 215
7 3300049584 Ga0501068_0336208 Ga0501068_0336208_202_891 215
8 3300049823 Ga0501044_0006152 Ga0501044_0006152_796_1485 215
9 3300005458 Ga0070681_10000006 Ga0070681_1000000694 216
10 3300025912 Ga0207707_10001002 Ga0207707_1000100215 216
11 3300042876 Ga0451577_0094550 Ga0451577_0094550_1894_2565 216
12 3300055283 Ga0500661_002907 Ga0500661_002907_1520_2188 216
13 3300005367 Ga0070667_100198853 Ga0070667_1001988531 217
14 3300005539 Ga0068853_100058712 Ga0068853_1000587122 217
15 3300005577 Ga0068857_100856096 Ga0068857_1008560962 217
16 3300005614 Ga0068856_100014180 Ga0068856_1000141806 217
17 3300005616 Ga0068852_100100664 Ga0068852_1001006642 217
18 3300005617 Ga0068859_100766594 Ga0068859_1007665942 217
19 3300005841 Ga0068863_100007265 Ga0068863_10000726512 217
20 3300005844 Ga0068862_100045337 Ga0068862_1000453371 217
21 3300006237 Ga0097621_100538672 Ga0097621_1005386722 217
22 3300006358 Ga0068871_100110064 Ga0068871_1001100642 217
23 3300006931 Ga0097620_100766603 Ga0097620_1007666032 217
24 3300009551 Ga0105238_10045986 Ga0105238_100459862 217
25 3300013104 Ga0157370_10020832 Ga0157370_100208323 217
26 3300013297 Ga0157378_10000322 Ga0157378_1000032237 217
27 3300013297 Ga0157378_10041842 Ga0157378_100418424 217
28 3300013307 Ga0157372_10671104 Ga0157372_106711042 217
29 3300013308 Ga0157375_10270868 Ga0157375_102708682 217
30 3300025924 Ga0207694_10035262 Ga0207694_100352623 217
31 3300026041 Ga0207639_10208831 Ga0207639_102088312 217
32 3300026078 Ga0207702_10001632 Ga0207702_1000163224 217
33 3300026088 Ga0207641_10128000 Ga0207641_101280003 217
34 3300026116 Ga0207674_10794659 Ga0207674_107946592 217
35 3300026142 Ga0207698_10025546 Ga0207698_100255465 217
36 3300028380 Ga0268265_10031668 Ga0268265_100316681 217
37 3300049571 Ga0501034_0448931 Ga0501034_0448931_76_741 217
38 3300049579 Ga0501043_0263323 Ga0501043_0263323_522_1187 217
39 3300049581 Ga0501047_0009312 Ga0501047_0009312_693_1358 217
40 3300049586 Ga0501070_0050074 Ga0501070_0050074_2507_3172 217
41 3300049590 Ga0501074_0055966 Ga0501074_0055966_2112_2777 217
42 3300049742 Ga0501080_0034205 Ga0501080_0034205_3365_4030 217
43 3300060353 Ga0501082_0028450 Ga0501082_0028450_3735_4400 217
44 3300005327 Ga0070658_10098624 Ga0070658_100986242 218
45 3300005329 Ga0070683_100066135 Ga0070683_1000661353 218
46 3300005335 Ga0070666_10044605 Ga0070666_100446052 218
47 3300005344 Ga0070661_100050745 Ga0070661_1000507452 218
48 3300005367 Ga0070667_100154226 Ga0070667_1001542262 218
49 3300005455 Ga0070663_100376781 Ga0070663_1003767812 218
50 3300005458 Ga0070681_10160246 Ga0070681_101602462 218
51 3300005530 Ga0070679_100374287 Ga0070679_1003742872 218
52 3300005535 Ga0070684_100292210 Ga0070684_1002922101 218
53 3300005564 Ga0070664_100051863 Ga0070664_1000518633 218
54 3300005577 Ga0068857_100224540 Ga0068857_1002245402 218
55 3300006358 Ga0068871_100235745 Ga0068871_1002357452 218
56 3300009093 Ga0105240_10183751 Ga0105240_101837512 218
57 3300009551 Ga0105238_10060412 Ga0105238_100604124 218
58 3300013100 Ga0157373_10038772 Ga0157373_100387722 218
59 3300013102 Ga0157371_10286405 Ga0157371_102864052 218
60 3300013104 Ga0157370_10331144 Ga0157370_103311442 218
61 3300013105 Ga0157369_10128079 Ga0157369_101280792 218
62 3300013296 Ga0157374_10428663 Ga0157374_104286631 218
63 3300014497 Ga0182008_10054109 Ga0182008_100541092 218
64 3300014969 Ga0157376_10051310 Ga0157376_100513102 218
65 3300025904 Ga0207647_10007321 Ga0207647_100073216 218
66 3300025911 Ga0207654_10000266 Ga0207654_1000026624 218
67 3300025913 Ga0207695_10430273 Ga0207695_104302732 218
68 3300025913 Ga0207695_10759915 Ga0207695_107599151 218
69 3300025919 Ga0207657_10044918 Ga0207657_100449182 218
70 3300025920 Ga0207649_10207390 Ga0207649_102073902 218
71 3300025921 Ga0207652_10093346 Ga0207652_100933464 218
72 3300025924 Ga0207694_10275793 Ga0207694_102757932 218
73 3300025932 Ga0207690_10125346 Ga0207690_101253462 218
74 3300025942 Ga0207689_10218444 Ga0207689_102184442 218
75 3300025944 Ga0207661_10085104 Ga0207661_100851042 218
76 3300025986 Ga0207658_10143805 Ga0207658_101438052 218
77 3300026023 Ga0207677_10268582 Ga0207677_102685822 218
78 3300026041 Ga0207639_10029293 Ga0207639_100292932 218
79 3300026078 Ga0207702_10903393 Ga0207702_109033931 218
80 3300026116 Ga0207674_10006181 Ga0207674_100061812 218
81 3300026142 Ga0207698_10067410 Ga0207698_100674102 218
82 3300028381 Ga0268264_10041126 Ga0268264_100411263 218
83 3300049590 Ga0501074_0362171 Ga0501074_0362171_28_741 218
84 3300005330 Ga0070690_100023709 Ga0070690_1000237094 219
85 3300005335 Ga0070666_10113058 Ga0070666_101130582 219
86 3300005841 Ga0068863_100145522 Ga0068863_1001455222 219
87 3300009177 Ga0105248_10052542 Ga0105248_100525426 219
88 3300009553 Ga0105249_10778288 Ga0105249_107782882 219
89 3300013306 Ga0163162_10058299 Ga0163162_100582995 219
90 3300013308 Ga0157375_10567025 Ga0157375_105670252 219
91 3300014325 Ga0163163_10080418 Ga0163163_100804182 219
92 3300014968 Ga0157379_10044170 Ga0157379_100441706 219
93 3300025941 Ga0207711_10094208 Ga0207711_100942082 219
94 3300005328 Ga0070676_10042819 Ga0070676_100428192 220
95 3300005330 Ga0070690_100080579 Ga0070690_1000805793 220
96 3300005331 Ga0070670_100089092 Ga0070670_1000890922 220
97 3300005334 Ga0068869_100015489 Ga0068869_1000154892 220
98 3300005334 Ga0068869_100585895 Ga0068869_1005858951 220
99 3300005335 Ga0070666_10007605 Ga0070666_100076052 220
100 3300005338 Ga0068868_100226556 Ga0068868_1002265562 220
101 3300005347 Ga0070668_100015331 Ga0070668_1000153313 220
102 3300005347 Ga0070668_100285586 Ga0070668_1002855862 220
103 3300005353 Ga0070669_100068716 Ga0070669_1000687163 220
104 3300005354 Ga0070675_100255750 Ga0070675_1002557502 220
105 3300005354 Ga0070675_100596321 Ga0070675_1005963211 220
106 3300005364 Ga0070673_100193988 Ga0070673_1001939882 220
107 3300005364 Ga0070673_100376407 Ga0070673_1003764071 220
108 3300005456 Ga0070678_100002751 Ga0070678_1000027516 220
109 3300005457 Ga0070662_100339422 Ga0070662_1003394222 220
110 3300005459 Ga0068867_100021286 Ga0068867_1000212866 220
111 3300005539 Ga0068853_100016082 Ga0068853_1000160826 220
112 3300005539 Ga0068853_100104751 Ga0068853_1001047512 220
113 3300005543 Ga0070672_100012694 Ga0070672_1000126943 220
114 3300005543 Ga0070672_100085389 Ga0070672_1000853892 220
115 3300005544 Ga0070686_100339974 Ga0070686_1003399741 220
116 3300005547 Ga0070693_100224907 Ga0070693_1002249071 220
117 3300005548 Ga0070665_100469443 Ga0070665_1004694432 220
118 3300005614 Ga0068856_100154260 Ga0068856_1001542603 220
119 3300005718 Ga0068866_10054141 Ga0068866_100541411 220
120 3300005840 Ga0068870_10072000 Ga0068870_100720002 220
121 3300005841 Ga0068863_100179677 Ga0068863_1001796773 220
122 3300005841 Ga0068863_100344235 Ga0068863_1003442352 220
123 3300005842 Ga0068858_100560410 Ga0068858_1005604102 220
124 3300005844 Ga0068862_100163895 Ga0068862_1001638951 220
125 3300006237 Ga0097621_100158139 Ga0097621_1001581392 220
126 3300006358 Ga0068871_100024015 Ga0068871_1000240153 220
127 3300006881 Ga0068865_100034824 Ga0068865_1000348244 220
128 3300009176 Ga0105242_10087290 Ga0105242_100872901 220
129 3300009553 Ga0105249_10424709 Ga0105249_104247092 220
130 3300013296 Ga0157374_10249492 Ga0157374_102494922 220
131 3300013306 Ga0163162_10048786 Ga0163162_100487862 220
132 3300013306 Ga0163162_10093354 Ga0163162_100933542 220
133 3300013307 Ga0157372_10518556 Ga0157372_105185562 220
134 3300013308 Ga0157375_10130162 Ga0157375_101301623 220
135 3300014969 Ga0157376_10163678 Ga0157376_101636782 220
136 3300014969 Ga0157376_10174697 Ga0157376_101746972 220
137 3300014969 Ga0157376_10723467 Ga0157376_107234671 220
138 3300017792 Ga0163161_10117976 Ga0163161_101179762 220
139 3300025903 Ga0207680_10000218 Ga0207680_100002184 220
140 3300025907 Ga0207645_10025450 Ga0207645_100254503 220
141 3300025908 Ga0207643_10048065 Ga0207643_100480652 220
142 3300025916 Ga0207663_10372299 Ga0207663_103722992 220
143 3300025920 Ga0207649_10624243 Ga0207649_106242431 220
144 3300025921 Ga0207652_10150068 Ga0207652_101500682 220
145 3300025923 Ga0207681_10165986 Ga0207681_101659862 220
146 3300025925 Ga0207650_10315129 Ga0207650_103151292 220
147 3300025933 Ga0207706_10390216 Ga0207706_103902162 220
148 3300025937 Ga0207669_10806032 Ga0207669_108060321 220
149 3300025940 Ga0207691_10020532 Ga0207691_100205323 220
150 3300025940 Ga0207691_10025673 Ga0207691_100256736 220
151 3300025942 Ga0207689_10017009 Ga0207689_100170093 220
152 3300025942 Ga0207689_10085306 Ga0207689_100853063 220
153 3300025960 Ga0207651_10131938 Ga0207651_101319382 220
154 3300025972 Ga0207668_10058206 Ga0207668_100582062 220
155 3300026023 Ga0207677_10096899 Ga0207677_100968992 220
156 3300026035 Ga0207703_10052315 Ga0207703_100523151 220
157 3300026041 Ga0207639_10075076 Ga0207639_100750761 220
158 3300026041 Ga0207639_10320966 Ga0207639_103209662 220
159 3300026078 Ga0207702_10254954 Ga0207702_102549542 220
160 3300026089 Ga0207648_10019820 Ga0207648_100198203 220
161 3300026089 Ga0207648_10353726 Ga0207648_103537261 220
162 3300026118 Ga0207675_100703301 Ga0207675_1007033012 220
163 3300026121 Ga0207683_10004575 Ga0207683_100045757 220
164 3300026121 Ga0207683_10017684 Ga0207683_100176843 220
165 3300026121 Ga0207683_10066132 Ga0207683_100661324 220
166 3300026142 Ga0207698_10158265 Ga0207698_101582652 220
167 3300026142 Ga0207698_10422382 Ga0207698_104223822 220
168 3300026142 Ga0207698_11013999 Ga0207698_110139991 220
169 3300028379 Ga0268266_10081688 Ga0268266_100816884 220
170 3300028380 Ga0268265_10199788 Ga0268265_101997881 220
171 3300028381 Ga0268264_10261747 Ga0268264_102617471 220
172 3300035172 Ga0373955_0461956 Ga0373955_0461956_20_694 220
173 3300046675 Ga0495657_0036094 Ga0495657_0036094_503_1177 220
174 3300049569 Ga0501032_0001459 Ga0501032_0001459_6463_7152 220
175 3300049569 Ga0501032_0204210 Ga0501032_0204210_171_845 220
176 3300049570 Ga0501033_0006045 Ga0501033_0006045_4262_4951 220
177 3300049571 Ga0501034_0007119 Ga0501034_0007119_1619_2293 220
178 3300049571 Ga0501034_0041200 Ga0501034_0041200_1485_2174 220
179 3300049571 Ga0501034_0149318 Ga0501034_0149318_931_1605 220
180 3300049572 Ga0501036_0012332 Ga0501036_0012332_3194_3883 220
181 3300049572 Ga0501036_0049398 Ga0501036_0049398_717_1391 220
182 3300049574 Ga0501038_0087248 Ga0501038_0087248_1000_1674 220
183 3300049575 Ga0501039_0006854 Ga0501039_0006854_5487_6176 220
184 3300049580 Ga0501046_0001553 Ga0501046_0001553_8300_8989 220
185 3300049580 Ga0501046_0137642 Ga0501046_0137642_780_1454 220
186 3300049581 Ga0501047_0003391 Ga0501047_0003391_11318_11992 220
187 3300049581 Ga0501047_0046459 Ga0501047_0046459_1361_2035 220
188 3300049583 Ga0501067_0000679 Ga0501067_0000679_3818_4492 220
189 3300049584 Ga0501068_0023740 Ga0501068_0023740_2710_3384 220
190 3300049584 Ga0501068_0098243 Ga0501068_0098243_573_1364 220
191 3300049585 Ga0501069_0112150 Ga0501069_0112150_772_1446 220
192 3300049585 Ga0501069_0180197 Ga0501069_0180197_55_726 220
193 3300049586 Ga0501070_0024853 Ga0501070_0024853_3788_4459 220
194 3300049586 Ga0501070_0044784 Ga0501070_0044784_129_803 220
195 3300049586 Ga0501070_0108597 Ga0501070_0108597_991_1665 220
196 3300049586 Ga0501070_0188355 Ga0501070_0188355_264_938 220
197 3300049588 Ga0501072_0001569 Ga0501072_0001569_3847_4521 220
198 3300049589 Ga0501073_0002650 Ga0501073_0002650_2699_3373 220
199 3300049589 Ga0501073_0038750 Ga0501073_0038750_1945_2634 220
200 3300049589 Ga0501073_0457676 Ga0501073_0457676_22_696 220
201 3300049590 Ga0501074_0175010 Ga0501074_0175010_195_869 220
202 3300049741 Ga0501079_0233983 Ga0501079_0233983_128_802 220
203 3300049741 Ga0501079_0263741 Ga0501079_0263741_363_1037 220
204 3300049742 Ga0501080_0003901 Ga0501080_0003901_9445_10119 220
205 3300049742 Ga0501080_0037581 Ga0501080_0037581_2865_3536 220
206 3300049742 Ga0501080_0111766 Ga0501080_0111766_240_914 220
207 3300049742 Ga0501080_0129960 Ga0501080_0129960_297_971 220
208 3300049744 Ga0501083_0003475 Ga0501083_0003475_4128_4802 220
209 3300049822 Ga0501035_0019699 Ga0501035_0019699_3651_4340 220
210 3300049822 Ga0501035_0390706 Ga0501035_0390706_134_808 220
211 3300053079 Ga0500610_0000097 Ga0500610_0000097_23655_24347 220
212 3300053093 Ga0500651_0016256 Ga0500651_0016256_3693_4373 220
213 3300054114 Ga0501084_0031037 Ga0501084_0031037_80_754 220
214 3300054114 Ga0501084_0319291 Ga0501084_0319291_322_996 220
215 3300060353 Ga0501082_0112153 Ga0501082_0112153_1352_2026 220
216 3300060353 Ga0501082_0233031 Ga0501082_0233031_82_756 220
217 3300005367 Ga0070667_100175881 Ga0070667_1001758812 221
218 3300005548 Ga0070665_101112013 Ga0070665_1011120131 221
219 3300005563 Ga0068855_100408605 Ga0068855_1004086051 221
220 3300005841 Ga0068863_100359501 Ga0068863_1003595012 221
221 3300006237 Ga0097621_100116512 Ga0097621_1001165122 221
222 3300009098 Ga0105245_10256967 Ga0105245_102569672 221
223 3300010375 Ga0105239_10016417 Ga0105239_100164176 221
224 3300025920 Ga0207649_10333761 Ga0207649_103337612 221
225 3300028379 Ga0268266_10437314 Ga0268266_104373142 221
226 3300041486 Ga0451807_0586572 Ga0451807_0586572_357_1052 221
227 3300046455 Ga0495603_0030195 Ga0495603_0030195_2196_2873 221
228 3300046475 Ga0495639_0050962 Ga0495639_0050962_204_881 221
229 3300046683 Ga0495658_0017152 Ga0495658_0017152_858_1535 221
230 3300005335 Ga0070666_10119778 Ga0070666_101197782 222
231 3300005367 Ga0070667_100072738 Ga0070667_1000727384 222
232 3300005455 Ga0070663_100625008 Ga0070663_1006250081 222
233 3300005456 Ga0070678_100180517 Ga0070678_1001805171 222
234 3300005539 Ga0068853_100323763 Ga0068853_1003237632 222
235 3300005548 Ga0070665_100398712 Ga0070665_1003987122 222
236 3300014325 Ga0163163_10000404 Ga0163163_1000040442 222
237 3300025321 Ga0207656_10274146 Ga0207656_102741461 222
238 3300025903 Ga0207680_10106237 Ga0207680_101062371 222
239 3300025986 Ga0207658_10143921 Ga0207658_101439211 222
240 3300026041 Ga0207639_10645124 Ga0207639_106451242 222
241 3300028379 Ga0268266_10216056 Ga0268266_102160562 222
242 3300031507 Ga0307509_10052848 Ga0307509_100528484 222
243 3300033179 Ga0307507_10050508 Ga0307507_100505083 222
244 3300048920 Ga0496117_0137788 Ga0496117_0137788_191_892 222
245 3300048921 Ga0496118_0000101 Ga0496118_0000101_48590_49291 222
246 3300048924 Ga0496121_0136916 Ga0496121_0136916_758_1459 222
247 3300005327 Ga0070658_10047190 Ga0070658_100471903 223
248 3300005327 Ga0070658_10235197 Ga0070658_102351972 223
249 3300005367 Ga0070667_100000065 Ga0070667_10000006558 223
250 3300005434 Ga0070709_10319158 Ga0070709_103191581 223
251 3300005455 Ga0070663_100000323 Ga0070663_10000032315 223
252 3300005459 Ga0068867_100150852 Ga0068867_1001508522 223
253 3300005539 Ga0068853_100004932 Ga0068853_1000049321 223
254 3300005546 Ga0070696_100155448 Ga0070696_1001554482 223
255 3300005563 Ga0068855_100013929 Ga0068855_1000139292 223
256 3300005563 Ga0068855_100148069 Ga0068855_1001480692 223
257 3300005563 Ga0068855_100367222 Ga0068855_1003672222 223
258 3300005614 Ga0068856_100019846 Ga0068856_1000198462 223
259 3300005614 Ga0068856_100244281 Ga0068856_1002442812 223
260 3300005616 Ga0068852_100002303 Ga0068852_1000023039 223
261 3300005616 Ga0068852_100013899 Ga0068852_1000138993 223
262 3300005618 Ga0068864_100033089 Ga0068864_1000330893 223
263 3300005841 Ga0068863_100006433 Ga0068863_1000064332 223
264 3300005842 Ga0068858_100438555 Ga0068858_1004385552 223
265 3300006881 Ga0068865_100003484 Ga0068865_1000034848 223
266 3300006931 Ga0097620_100752770 Ga0097620_1007527702 223
267 3300009093 Ga0105240_10036912 Ga0105240_100369122 223
268 3300009093 Ga0105240_10441285 Ga0105240_104412852 223
269 3300009174 Ga0105241_10007418 Ga0105241_100074189 223
270 3300009174 Ga0105241_10023728 Ga0105241_100237286 223
271 3300009177 Ga0105248_10373936 Ga0105248_103739362 223
272 3300009545 Ga0105237_10005392 Ga0105237_100053923 223
273 3300009545 Ga0105237_10046122 Ga0105237_100461226 223
274 3300009551 Ga0105238_10010067 Ga0105238_1001006711 223
275 3300009553 Ga0105249_10000221 Ga0105249_100002213 223
276 3300009553 Ga0105249_10209333 Ga0105249_102093332 223
277 3300010375 Ga0105239_10010154 Ga0105239_1001015411 223
278 3300010375 Ga0105239_10023284 Ga0105239_100232845 223
279 3300010375 Ga0105239_10287131 Ga0105239_102871312 223
280 3300010375 Ga0105239_10899367 Ga0105239_108993671 223
281 3300011119 Ga0105246_10049640 Ga0105246_100496403 223
282 3300013100 Ga0157373_10291236 Ga0157373_102912362 223
283 3300013104 Ga0157370_10096706 Ga0157370_100967062 223
284 3300013104 Ga0157370_10103241 Ga0157370_101032412 223
285 3300013105 Ga0157369_10000114 Ga0157369_1000011451 223
286 3300013105 Ga0157369_10014852 Ga0157369_1001485210 223
287 3300013306 Ga0163162_10018746 Ga0163162_100187467 223
288 3300013307 Ga0157372_10004055 Ga0157372_100040559 223
289 3300013307 Ga0157372_10055037 Ga0157372_100550373 223
290 3300013308 Ga0157375_10000459 Ga0157375_1000045927 223
291 3300014325 Ga0163163_10102868 Ga0163163_101028682 223
292 3300014968 Ga0157379_10009947 Ga0157379_100099479 223
293 3300014968 Ga0157379_10157803 Ga0157379_101578033 223
294 3300014969 Ga0157376_10005681 Ga0157376_100056813 223
295 3300015262 Ga0182007_10054351 Ga0182007_100543511 223
296 3300025903 Ga0207680_10033774 Ga0207680_100337742 223
297 3300025906 Ga0207699_10135696 Ga0207699_101356962 223
298 3300025912 Ga0207707_10544811 Ga0207707_105448111 223
299 3300025913 Ga0207695_10000359 Ga0207695_1000035910 223
300 3300025913 Ga0207695_10033139 Ga0207695_100331394 223
301 3300025914 Ga0207671_10000940 Ga0207671_100009408 223
302 3300025914 Ga0207671_10001203 Ga0207671_100012038 223
303 3300025914 Ga0207671_10002422 Ga0207671_1000242216 223
304 3300025917 Ga0207660_10055463 Ga0207660_100554632 223
305 3300025924 Ga0207694_10014315 Ga0207694_100143154 223
306 3300025934 Ga0207686_10034560 Ga0207686_100345602 223
307 3300025938 Ga0207704_10002700 Ga0207704_100027008 223
308 3300025941 Ga0207711_10001306 Ga0207711_100013065 223
309 3300025949 Ga0207667_10006234 Ga0207667_1000623410 223
310 3300025949 Ga0207667_10077055 Ga0207667_100770552 223
311 3300025949 Ga0207667_10435278 Ga0207667_104352781 223
312 3300025961 Ga0207712_10000107 Ga0207712_1000010745 223
313 3300025986 Ga0207658_10000114 Ga0207658_1000011416 223
314 3300026035 Ga0207703_10512262 Ga0207703_105122622 223
315 3300026041 Ga0207639_10000258 Ga0207639_1000025810 223
316 3300026041 Ga0207639_10036965 Ga0207639_100369654 223
317 3300026067 Ga0207678_10001080 Ga0207678_1000108015 223
318 3300026067 Ga0207678_10266259 Ga0207678_102662592 223
319 3300026088 Ga0207641_10047489 Ga0207641_100474893 223
320 3300026089 Ga0207648_10015569 Ga0207648_100155699 223
321 3300026095 Ga0207676_10018568 Ga0207676_100185685 223
322 3300026142 Ga0207698_10007442 Ga0207698_100074425 223
323 3300026142 Ga0207698_10018903 Ga0207698_100189037 223
324 3300028381 Ga0268264_10086790 Ga0268264_100867903 223
325 3300035120 Ga0373957_0086999 Ga0373957_0086999_460_1164 223
326 3300037418 Ga0395900_0001309 Ga0395900_0001309_27803_28489 223
327 3300037418 Ga0395900_0055165 Ga0395900_0055165_1661_2332 223
328 3300037466 Ga0395898_0578772 Ga0395898_0578772_27_713 223
329 3300046472 Ga0495580_0018830 Ga0495580_0018830_4186_4890 223
330 3300047472 Ga0495686_0010519 Ga0495686_0010519_1267_1977 223
331 3300047673 Ga0495593_0049364 Ga0495593_0049364_1489_2193 223
332 3300048907 Ga0496104_0000041 Ga0496104_0000041_58148_58852 223
333 3300048908 Ga0496105_0000022 Ga0496105_0000022_58008_58712 223
334 3300048920 Ga0496117_0040092 Ga0496117_0040092_898_1611 223
335 3300048920 Ga0496117_0153422 Ga0496117_0153422_49_759 223
336 3300048921 Ga0496118_0000264 Ga0496118_0000264_66879_67592 223
337 3300048925 Ga0496122_0000212 Ga0496122_0000212_123436_124146 223
338 3300048926 Ga0496123_0003184 Ga0496123_0003184_5064_5774 223
339 3300053087 Ga0500643_014585 Ga0500643_014585_1579_2289 223
340 3300053120 Ga0500597_000037 Ga0500597_000037_3241_3951 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

4

221

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3sy1-assembly1.cif.gz_A crystal structure of engineered protein. northeast structural genomics consortium target or70 0.9653 1 218
7ub8-assembly2.cif.gz_B the crystal structure of the k38a/k137a/k233a/k234a quadruple mutant of e. coli yggs in complex with plp 0.9647 4 217
7uau-assembly1.cif.gz_A the crystal structure of the k137a mutant of e. coli yggs in complex with plp 0.9645 4 218
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9624 4 218
7ubp-assembly1.cif.gz_A the crystal structure of the k36a/k137a double mutant of e. coli yggs in complex with plp 0.9619 3 218
ID Description Score Start End Superfamily
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9614 3 218 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9317 1 223 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9278 3 218 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9277 1 223 3.20.20.10
af_P9WFQ7_2_257_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9209 2 220 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A351SF88-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9934 22 163 GO:0030170
AF-A0A5C8KRI1-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9924 3 223 GO:0030170
AF-T1BA90-F1-model_v4 Pyridoxal phosphate enzyme, YggS family 0.992 37 182 GO:0030170
AF-M5CUJ6-F1-model_v4 deleted 0.9892 53 223
AF-A0A5C4RXC4-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9888 3 220 GO:0030170

Feature Viewer

pLDDT pTM Quality
93.37 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map