F414534

General Info

Members Datasets Scaffolds Average Seq Length
340 229 680 393

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_000918|Ga0500643_000918_10160_11515
Length 451
Sequence MIRVMLCNPSLGPTSLIKTSIRDIPALIQFVLSIYQLNRDCRDQGSGLLQEHTENLPLEGLRVVEFSHMVMGPSTGAILADLGADVIKVEPIGGDQTRRLLGSGSGYFPMFNRNKRSICIDLKSEAGLEAAVRLVNGADVLIENFRPGALVKLGLGPERFSDSNPALVYYSAKGFLAGPYEDRAALDEVAQMMGGLAYMTGPSGRPLRAGASVIDITGGMFGVIGILAALSRRTRDGKGATVRSSLFETTAYMVGQHMAQMAVTGLAARPMPERISAWAIYDVFETANPGEQLFVGVVSDSQWQSFTRAFDLGPIGSDPAYAKNNDRVLARDIIVPVVWEIMSSHTRADLLERLDAAGVAFAPINRPEDLFDDPHLNAGGGLVDLTLGDGRRVRLPALPIELDGVLPGVRHDLPRPGEDSEQILKDFGFGDAEISALVQANAVASEQVAAG

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
98 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
99 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
100 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
101 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
102 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
103 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
104 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
105 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
106 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
107 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
108 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
109 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
110 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
111 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
112 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
113 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
125 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
126 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
127 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
139 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
142 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
143 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
147 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
148 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
153 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
154 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
159 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
160 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
161 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
162 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
163 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
164 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
165 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
171 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
172 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
175 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
183 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
187 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
196 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
201 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
205 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
206 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
209 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
214 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
215 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
216 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
217 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
218 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
219 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
220 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
221 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
222 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
223 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
224 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
225 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
226 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
227 2941485952 Brevundimonas faecalis 2814 Isolate Rhizosphere
228 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
229 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.47
Metatranscriptomes 0.59
Isolates 2.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.65
Nodule 0
Rhizoplane 1.76
Rhizosphere 76.47
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_000918 3300053087 Bacteria 18535
2 SwRhRL2b_contig_646846 2162886007 Bacteria 2597
3 JGI25151J46595_10019123 3300003187 Bacteria 2919
4 JGI25165J46597_1000012 3300003214 Bacteria 421074
5 JGI25407J50210_10031091 3300003373 Bacteria 1383
6 Ga0055530_10010590 3300003791 Bacteria 3390
7 Ga0058859_11776420 3300004798 Bacteria 1759
8 Ga0058860_12156746 3300004801 Bacteria 1678
9 Ga0065165_1007602 3300005262 Bacteria 5279
10 Ga0065704_10003064 3300005289 Bacteria 9589
11 Ga0065715_10173477 3300005293 Bacteria 1517
12 Ga0065707_10082494 3300005295 Bacteria 14559
13 Ga0070658_10025907 3300005327 Bacteria 4704
14 Ga0070670_100057080 3300005331 Bacteria 3351
15 Ga0070680_100000532 3300005336 Bacteria 25987
16 Ga0068868_100046229 3300005338 Bacteria 3408
17 Ga0070689_100219865 3300005340 Bacteria 1558
18 Ga0070691_10002110 3300005341 Bacteria 8800
19 Ga0070668_100006948 3300005347 Bacteria 8381
20 Ga0070668_100009176 3300005347 Bacteria 7336
21 Ga0070668_100012711 3300005347 Bacteria 6266
22 Ga0070668_100237756 3300005347 Bacteria 1508
23 Ga0070669_100003022 3300005353 Bacteria 12103
24 Ga0070669_100040628 3300005353 Bacteria 3381
25 Ga0070669_100079733 3300005353 Bacteria 2435
26 Ga0070671_100000550 3300005355 Bacteria 26544
27 Ga0070671_100016346 3300005355 Bacteria 6000
28 Ga0070671_100044086 3300005355 Bacteria 3706
29 Ga0070667_100026301 3300005367 Bacteria 4839
30 Ga0070678_100070538 3300005456 Bacteria 2613
31 Ga0070706_100207240 3300005467 Bacteria 1831
32 Ga0070707_100144606 3300005468 Bacteria 2314
33 Ga0070698_100004957 3300005471 Bacteria 14587
34 Ga0070698_100071668 3300005471 Bacteria 3474
35 Ga0070699_100121959 3300005518 Bacteria 2293
36 Ga0070679_100060758 3300005530 Bacteria 3766
37 Ga0070665_100001419 3300005548 Bacteria 28085
38 Ga0070665_100001647 3300005548 Bacteria 25743
39 Ga0070665_100068872 3300005548 Bacteria 3547
40 Ga0070665_100158794 3300005548 Bacteria 2263
41 Ga0068855_100007598 3300005563 Bacteria 13117
42 Ga0068855_100031168 3300005563 Bacteria 6369
43 Ga0068855_100488106 3300005563 Bacteria 1340
44 Ga0070664_100095442 3300005564 Bacteria 2579
45 Ga0068857_100019709 3300005577 Bacteria 5926
46 Ga0068852_100033097 3300005616 Bacteria 4288
47 Ga0068859_100011175 3300005617 Bacteria 9028
48 Ga0068864_100000483 3300005618 Bacteria 34541
49 Ga0068861_100143988 3300005719 Bacteria 1948
50 Ga0068863_100010699 3300005841 Bacteria 8911
51 Ga0068858_100003343 3300005842 Bacteria 15972
52 Ga0068858_100042247 3300005842 Bacteria 4227
53 Ga0068858_100053483 3300005842 Bacteria 3735
54 Ga0068860_100000075 3300005843 Bacteria 172873
55 Ga0068860_100007199 3300005843 Bacteria 11124
56 Ga0068862_100005290 3300005844 Bacteria 10814
57 Ga0081455_10002134 3300005937 Bacteria 23564
58 Ga0081455_10007020 3300005937 Bacteria 11962
59 Ga0081455_10029148 3300005937 Bacteria 5034
60 Ga0081455_10054489 3300005937 Bacteria 3408
61 Ga0081455_10058456 3300005937 Bacteria 3262
62 Ga0081455_10129713 3300005937 Bacteria 1973
63 Ga0081538_10021348 3300005981 Bacteria 4730
64 Ga0081540_1075803 3300005983 Bacteria 1536
65 Ga0081539_10004368 3300005985 Bacteria 15741
66 Ga0081539_10033785 3300005985 Bacteria 3107
67 Ga0075365_10034206 3300006038 Bacteria 3281
68 Ga0075364_10063523 3300006051 Bacteria 2424
69 Ga0075362_10008936 3300006177 Bacteria 3853
70 Ga0075369_10002494 3300006186 Bacteria 6573
71 Ga0075366_10024016 3300006195 Bacteria 3554
72 Ga0075430_100226028 3300006846 Bacteria 1552
73 Ga0097620_100011175 3300006931 Bacteria 9028
74 Ga0105251_10001057 3300009011 Bacteria 24123
75 Ga0105251_10001957 3300009011 Bacteria 16840
76 Ga0105244_10055041 3300009036 Bacteria 2017
77 Ga0105250_10015485 3300009092 Bacteria 3122
78 Ga0105240_10137494 3300009093 Bacteria 2925
79 Ga0111539_10021420 3300009094 Bacteria 7956
80 Ga0111539_10064526 3300009094 Bacteria 4331
81 Ga0114129_10053540 3300009147 Bacteria 5660
82 Ga0105248_10092657 3300009177 Bacteria 3403
83 Ga0105248_10113397 3300009177 Bacteria 3057
84 Ga0157373_10193775 3300013100 Bacteria 1432
85 Ga0157373_10203803 3300013100 Bacteria 1395
86 Ga0157369_10154069 3300013105 Bacteria 2428
87 Ga0163162_10199415 3300013306 Bacteria 2130
88 Ga0157372_10684244 3300013307 Bacteria 1194
89 Ga0157375_10017149 3300013308 Bacteria 6529
90 Ga0157375_10025866 3300013308 Bacteria 5461
91 Ga0163163_10033111 3300014325 Bacteria 4997
92 Ga0157379_10001716 3300014968 Bacteria 18143
93 Ga0163161_10000418 3300017792 Bacteria 35697
94 Ga0163161_10000635 3300017792 Bacteria 27964
95 Ga0163161_10014873 3300017792 Bacteria 5422
96 Ga0209233_1000058 3300025261 Bacteria 421872
97 Ga0209050_1000140 3300025298 Bacteria 173241
98 Ga0207696_1000018 3300025711 Bacteria 478605
99 Ga0207713_1001100 3300025735 Bacteria 23129
100 Ga0207713_1001366 3300025735 Bacteria 19848
101 Ga0207680_10054030 3300025903 Bacteria 2414
102 Ga0207705_10209258 3300025909 Bacteria 1479
103 Ga0207646_10174760 3300025922 Bacteria 1940
104 Ga0207646_10222128 3300025922 Bacteria 1707
105 Ga0207681_10000328 3300025923 Bacteria 34223
106 Ga0207650_10056493 3300025925 Bacteria 2916
107 Ga0207700_10339924 3300025928 Bacteria 1305
108 Ga0207644_10000238 3300025931 Bacteria 37789
109 Ga0207644_10196022 3300025931 Bacteria 1591
110 Ga0207670_10203783 3300025936 Bacteria 1504
111 Ga0207711_10004651 3300025941 Bacteria 11661
112 Ga0207711_10176452 3300025941 Bacteria 1941
113 Ga0207689_10250567 3300025942 Bacteria 1464
114 Ga0207667_10013237 3300025949 Bacteria 9459
115 Ga0207712_10042962 3300025961 Bacteria 3115
116 Ga0207668_10007855 3300025972 Bacteria 6343
117 Ga0207668_10012826 3300025972 Bacteria 5142
118 Ga0207668_10014241 3300025972 Bacteria 4919
119 Ga0207658_10003971 3300025986 Bacteria 10369
120 Ga0207677_10099550 3300026023 Bacteria 2135
121 Ga0207703_10006932 3300026035 Bacteria 9018
122 Ga0207641_10016195 3300026088 Bacteria 6105
123 Ga0207641_10106411 3300026088 Bacteria 2479
124 Ga0207676_10011360 3300026095 Bacteria 6365
125 Ga0207674_10026094 3300026116 Bacteria 6215
126 Ga0207675_100220640 3300026118 Bacteria 1827
127 Ga0207683_10051842 3300026121 Bacteria 3595
128 Ga0207698_10039753 3300026142 Bacteria 3488
129 Ga0207428_10056121 3300027907 Bacteria 3130
130 Ga0268266_10000002 3300028379 Bacteria 3059047
131 Ga0268266_10000576 3300028379 Bacteria 50660
132 Ga0268266_10083919 3300028379 Bacteria 2781
133 Ga0268265_10036213 3300028380 Bacteria 3613
134 Ga0268265_10279770 3300028380 Bacteria 1492
135 Ga0268264_10000136 3300028381 Bacteria 177180
136 Ga0268264_10102596 3300028381 Bacteria 2489
137 Ga0265337_1000221 3300028556 Bacteria 30366
138 Ga0265326_10001607 3300028558 Bacteria 7865
139 Ga0265319_1007058 3300028563 Bacteria 5105
140 Ga0265334_10000207 3300028573 Bacteria 34007
141 Ga0265336_10018535 3300028666 Bacteria 2254
142 Ga0265338_10002051 3300028800 Bacteria 31157
143 Ga0265324_10009569 3300029957 Bacteria 3776
144 Ga0265332_10005693 3300031238 Bacteria 5724
145 Ga0265320_10014007 3300031240 Bacteria 4589
146 Ga0265314_10032241 3300031711 Bacteria 3856
147 Ga0316576_10007521 3300031727 Bacteria 6869
148 Ga0316576_10024717 3300031727 Bacteria 4197
149 Ga0316576_10099554 3300031727 Bacteria 2172
150 Ga0307405_10003236 3300031731 Bacteria 7428
151 Ga0307412_10008768 3300031911 Bacteria 5789
152 Ga0307414_10000149 3300032004 Bacteria 46922
153 Ga0307414_10055591 3300032004 Bacteria 2772
154 Ga0307415_100020991 3300032126 Bacteria 4002
155 Ga0307415_100162859 3300032126 Bacteria 1731
156 Ga0316580_10038361 3300032139 Bacteria 1481
157 Ga0373953_0013471 3300035117 Bacteria 2922
158 Ga0373943_0051084 3300035170 Bacteria 2034
159 Ga0316574_0005059 3300035398 Bacteria 7004
160 Ga0316574_0016700 3300035398 Bacteria 4282
161 Ga0373937_0206847 3300036401 Bacteria 1846
162 Ga0316584_0028123 3300036712 Bacteria 4143
163 Ga0395899_0002608 3300037312 Bacteria 14538
164 Ga0395899_0014752 3300037312 Bacteria 5965
165 Ga0395900_0003270 3300037418 Bacteria 17541
166 Ga0395900_0006476 3300037418 Bacteria 12210
167 Ga0395900_0026869 3300037418 Bacteria 5890
168 Ga0395900_0047242 3300037418 Bacteria 4432
169 Ga0395900_0135674 3300037418 Bacteria 2521
170 Ga0395898_0002294 3300037466 Bacteria 22975
171 Ga0395898_0026132 3300037466 Bacteria 5876
172 Ga0395905_0003837 3300037471 Bacteria 15871
173 Ga0395905_0256017 3300037471 Bacteria 1635
174 Ga0395905_0289707 3300037471 Bacteria 1524
175 Ga0436364_0115627 3300037853 Bacteria 5365
176 Ga0395901_0011705 3300038443 Bacteria 8891
177 Ga0395901_0015395 3300038443 Bacteria 7786
178 Ga0395901_0017721 3300038443 Bacteria 7270
179 Ga0395901_0027541 3300038443 Bacteria 5840
180 Ga0395901_0039295 3300038443 Bacteria 4896
181 Ga0395901_0114846 3300038443 Bacteria 2828
182 Ga0395901_0125634 3300038443 Bacteria 2696
183 Ga0400483_228481 3300039062 Bacteria 10888
184 Ga0439441_014390 3300042001 Bacteria 1387
185 Ga0439463_013028 3300042016 Bacteria 2045
186 Ga0439435_0023723 3300042436 Bacteria 1613
187 Ga0451577_0008895 3300042876 Bacteria 9720
188 Ga0453683_0113966 3300044673 Bacteria 1701
189 Ga0466963_0029708 3300044694 Bacteria 3521
190 Ga0466964_0034297 3300044706 Bacteria 2025
191 Ga0453684_0114468 3300044712 Bacteria 3270
192 Ga0453684_0323300 3300044712 Bacteria 1746
193 Ga0451576_0000122 3300045051 Bacteria 197797
194 Ga0451576_0015380 3300045051 Bacteria 8477
195 Ga0466958_0072323 3300045836 Bacteria 2112
196 Ga0466967_0054038 3300045976 Bacteria 3533
197 Ga0495627_000114 3300046453 Bacteria 100085
198 Ga0495627_000735 3300046453 Bacteria 24646
199 Ga0495627_000820 3300046453 Bacteria 22587
200 Ga0495638_0000024 3300046460 Bacteria 362116
201 Ga0495650_0002785 3300046471 Bacteria 13444
202 Ga0495584_0011560 3300046491 Bacteria 4521
203 Ga0495596_0000323 3300046500 Bacteria 31257
204 Ga0495596_0007296 3300046500 Bacteria 4997
205 Ga0495583_0000010 3300046506 Bacteria 353523
206 Ga0495583_0000107 3300046506 Bacteria 139964
207 Ga0495606_0026741 3300046507 Bacteria 4106
208 Ga0495606_0082270 3300046507 Bacteria 1999
209 Ga0495610_0000019 3300046512 Bacteria 351524
210 Ga0495610_0000042 3300046512 Bacteria 158665
211 Ga0495610_0000475 3300046512 Bacteria 41392
212 Ga0495610_0001079 3300046512 Bacteria 24974
213 Ga0495610_0015050 3300046512 Bacteria 4513
214 Ga0495620_0003823 3300046515 Bacteria 8584
215 Ga0495630_0078741 3300046517 Bacteria 2486
216 Ga0495632_0000006 3300046519 Bacteria 345883
217 Ga0495632_0001002 3300046519 Bacteria 24543
218 Ga0495632_0002578 3300046519 Bacteria 13693
219 Ga0495632_0009393 3300046519 Bacteria 5900
220 Ga0495637_0000479 3300046520 Bacteria 29181
221 Ga0495637_0008496 3300046520 Bacteria 5041
222 Ga0495637_0009307 3300046520 Bacteria 4795
223 Ga0495643_0000021 3300046522 Bacteria 293465
224 Ga0495643_0000565 3300046522 Bacteria 45833
225 Ga0495648_0000005 3300046524 Bacteria 362116
226 Ga0495648_0005268 3300046524 Bacteria 10796
227 Ga0495648_0025163 3300046524 Bacteria 4035
228 Ga0495663_0000008 3300046525 Bacteria 260614
229 Ga0495665_0020660 3300046531 Bacteria 3535
230 Ga0495640_0121385 3300046533 Bacteria 1699
231 Ga0495609_0011060 3300046538 Bacteria 4309
232 Ga0495597_0010123 3300046542 Bacteria 4621
233 Ga0495633_0000502 3300046558 Bacteria 39407
234 Ga0495633_0000750 3300046558 Bacteria 29269
235 Ga0495668_0097404 3300046616 Bacteria 1610
236 Ga0495625_0001148 3300046660 Bacteria 34153
237 Ga0495625_0016320 3300046660 Bacteria 5847
238 Ga0495671_0000017 3300046692 Bacteria 293465
239 Ga0495671_0000051 3300046692 Bacteria 137094
240 Ga0495636_0000702 3300047318 Bacteria 12217
241 Ga0495636_0067393 3300047318 Bacteria 1523
242 Ga0495636_0084429 3300047318 Bacteria 1371
243 Ga0495673_0000134 3300047469 Bacteria 137094
244 Ga0495681_0000003 3300047470 Bacteria 245567
245 Ga0495681_0000006 3300047470 Bacteria 221565
246 Ga0495681_0002424 3300047470 Bacteria 13325
247 Ga0495681_0009389 3300047470 Bacteria 6032
248 Ga0495686_0001568 3300047472 Bacteria 24312
249 Ga0495686_0002236 3300047472 Bacteria 18709
250 Ga0495686_0022913 3300047472 Bacteria 4126
251 Ga0495686_0026181 3300047472 Bacteria 3817
252 Ga0495686_0029553 3300047472 Bacteria 3564
253 Ga0495686_0117785 3300047472 Bacteria 1586
254 Ga0495626_0000758 3300048091 Bacteria 29809
255 Ga0496100_0126974 3300048903 Bacteria 1791
256 Ga0496101_0115356 3300048904 Bacteria 2026
257 Ga0496103_0007242 3300048906 Bacteria 6613
258 Ga0496108_0000697 3300048911 Bacteria 26063
259 Ga0496108_0012305 3300048911 Bacteria 6961
260 Ga0496109_0173213 3300048912 Bacteria 2025
261 Ga0496117_0020372 3300048920 Bacteria 5407
262 Ga0496118_0032811 3300048921 Bacteria 4270
263 Ga0496119_0000011 3300048922 Bacteria 438315
264 Ga0496120_0000329 3300048923 Bacteria 78994
265 Ga0496121_0000773 3300048924 Bacteria 58603
266 Ga0496121_0000953 3300048924 Bacteria 52360
267 Ga0496121_0004450 3300048924 Bacteria 18821
268 Ga0496121_0005805 3300048924 Bacteria 15651
269 Ga0496122_0004855 3300048925 Bacteria 16364
270 Ga0496123_0023380 3300048926 Bacteria 4731
271 Ga0496123_0039630 3300048926 Bacteria 3293
272 Ga0496124_0001757 3300048927 Bacteria 30268
273 Ga0496124_0016252 3300048927 Bacteria 7089
274 Ga0496124_0060767 3300048927 Bacteria 3169
275 Ga0496125_0007124 3300048928 Bacteria 11935
276 Ga0496125_0041800 3300048928 Bacteria 3914
277 Ga0496125_0108428 3300048928 Bacteria 2020
278 Ga0496126_0002215 3300048929 Bacteria 26924
279 Ga0496126_0006330 3300048929 Bacteria 13213
280 Ga0496126_0036683 3300048929 Bacteria 4581
281 Ga0496126_0041761 3300048929 Bacteria 4242
282 Ga0496126_0137341 3300048929 Bacteria 2107
283 Ga0495682_0057539 3300049460 Bacteria 1407
284 Ga0501034_0001860 3300049571 Bacteria 26767
285 Ga0501034_0008307 3300049571 Bacteria 10989
286 Ga0501034_0077994 3300049571 Bacteria 3318
287 Ga0501046_0281940 3300049580 Bacteria 1217
288 Ga0501068_0003738 3300049584 Bacteria 8233
289 Ga0501070_0065128 3300049586 Bacteria 3018
290 Ga0501080_0249188 3300049742 Bacteria 1620
291 Ga0501044_0063951 3300049823 Bacteria 3757
292 Ga0501044_0220835 3300049823 Bacteria 1846
293 nmdc:mga03683_1167_c1 3300050489 Bacteria 7721
294 nmdc:mga03683_8406_c1 3300050489 Bacteria 2601
295 nmdc:mga0yw44_129372_c1 3300050492 Bacteria 1633
296 nmdc:mga0k408_9096_c1 3300050493 Bacteria 5348
297 nmdc:mga07m45_154675_c1 3300050496 Bacteria 1330
298 nmdc:mga05p37_91876_c1 3300050507 Bacteria 3740
299 nmdc:mga09592_188006_c1 3300050508 Bacteria 1788
300 nmdc:mga0qj67_251926_c1 3300050509 Bacteria 1433
301 nmdc:mga06r32_317051_c1 3300050510 Bacteria 1545
302 nmdc:mga08y16_238367_c1 3300050511 Bacteria 1881
303 nmdc:mga08y16_65695_c1 3300050511 Bacteria 3787
304 nmdc:mga0sz30_145_c2 3300050516 Bacteria 2228
305 nmdc:mga0sz30_15312_c1 3300050516 Bacteria 3029
306 Ga0495619_0022319 3300053085 Bacteria 4049
307 Ga0500651_0008791 3300053093 Bacteria 5970
308 Ga0500566_0000146 3300053094 Bacteria 36277
309 Ga0500641_0002360 3300053096 Bacteria 6685
310 Ga0500555_000041 3300053103 Bacteria 66541
311 Ga0500592_000011 3300053116 Bacteria 73738
312 Ga0500595_044318 3300053119 Bacteria 1411
313 Ga0500608_000561 3300053122 Bacteria 13874
314 Ga0500642_0001025 3300053130 Bacteria 8043
315 Ga0500655_000038 3300053133 Bacteria 37284
316 Ga0500658_0098287 3300053134 Bacteria 1275
317 Ga0500559_0004380 3300053136 Bacteria 6723
318 Ga0500559_0069186 3300053136 Bacteria 1587
319 Ga0500564_000872 3300053138 Bacteria 9722
320 Ga0500577_0009571 3300053142 Bacteria 2818
321 Ga0500590_000664 3300053148 Bacteria 12343
322 Ga0500604_0000009 3300053151 Bacteria 112387
323 Ga0500616_0003370 3300053153 Bacteria 12275
324 Ga0500622_0017318 3300053156 Bacteria 3834
325 Ga0500624_000033 3300053157 Bacteria 102532
326 Ga0500627_0000050 3300053158 Bacteria 56420
327 Ga0500636_0012800 3300053177 Bacteria 4917
328 Ga0500570_000021 3300053724 Bacteria 41025
329 Ga0500625_000010 3300053729 Bacteria 154401
330 Ga0500552_001232 3300053733 Bacteria 2427
331 2511126522 2510917021 Bacteria 5705459
332 2739649681 2739367664 Bacteria 4114334
333 2740028154 2739367865 Bacteria 4114482
334 2753764107 2751185897 Bacteria 5322941
335 2819554227 2818991438 Bacteria 5793701
336 2848863922 2848858292 Bacteria 7391279
337 2879166334 2879163058 Bacteria 4223965
338 2941487209 2941485952 Bacteria 3591484
339 8054305201 8054302542 Bacteria 5698134
340 8057102389 8057101203 Bacteria 5034064
341 Ga0500643_000918
342 SwRhRL2b_contig_646846
343 JGI25151J46595_10019123
344 JGI25165J46597_1000012
345 JGI25407J50210_10031091
346 Ga0055530_10010590
347 Ga0058859_11776420
348 Ga0058860_12156746
349 Ga0065165_1007602
350 Ga0065704_10003064
351 Ga0065715_10173477
352 Ga0065707_10082494
353 Ga0070658_10025907
354 Ga0070670_100057080
355 Ga0070680_100000532
356 Ga0068868_100046229
357 Ga0070689_100219865
358 Ga0070691_10002110
359 Ga0070668_100006948
360 Ga0070668_100009176
361 Ga0070668_100012711
362 Ga0070668_100237756
363 Ga0070669_100003022
364 Ga0070669_100040628
365 Ga0070669_100079733
366 Ga0070671_100000550
367 Ga0070671_100016346
368 Ga0070671_100044086
369 Ga0070667_100026301
370 Ga0070678_100070538
371 Ga0070706_100207240
372 Ga0070707_100144606
373 Ga0070698_100004957
374 Ga0070698_100071668
375 Ga0070699_100121959
376 Ga0070679_100060758
377 Ga0070665_100001419
378 Ga0070665_100001647
379 Ga0070665_100068872
380 Ga0070665_100158794
381 Ga0068855_100007598
382 Ga0068855_100031168
383 Ga0068855_100488106
384 Ga0070664_100095442
385 Ga0068857_100019709
386 Ga0068852_100033097
387 Ga0068859_100011175
388 Ga0068864_100000483
389 Ga0068861_100143988
390 Ga0068863_100010699
391 Ga0068858_100003343
392 Ga0068858_100042247
393 Ga0068858_100053483
394 Ga0068860_100000075
395 Ga0068860_100007199
396 Ga0068862_100005290
397 Ga0081455_10002134
398 Ga0081455_10007020
399 Ga0081455_10029148
400 Ga0081455_10054489
401 Ga0081455_10058456
402 Ga0081455_10129713
403 Ga0081538_10021348
404 Ga0081540_1075803
405 Ga0081539_10004368
406 Ga0081539_10033785
407 Ga0075365_10034206
408 Ga0075364_10063523
409 Ga0075362_10008936
410 Ga0075369_10002494
411 Ga0075366_10024016
412 Ga0075430_100226028
413 Ga0097620_100011175
414 Ga0105251_10001057
415 Ga0105251_10001957
416 Ga0105244_10055041
417 Ga0105250_10015485
418 Ga0105240_10137494
419 Ga0111539_10021420
420 Ga0111539_10064526
421 Ga0114129_10053540
422 Ga0105248_10092657
423 Ga0105248_10113397
424 Ga0157373_10193775
425 Ga0157373_10203803
426 Ga0157369_10154069
427 Ga0163162_10199415
428 Ga0157372_10684244
429 Ga0157375_10017149
430 Ga0157375_10025866
431 Ga0163163_10033111
432 Ga0157379_10001716
433 Ga0163161_10000418
434 Ga0163161_10000635
435 Ga0163161_10014873
436 Ga0209233_1000058
437 Ga0209050_1000140
438 Ga0207696_1000018
439 Ga0207713_1001100
440 Ga0207713_1001366
441 Ga0207680_10054030
442 Ga0207705_10209258
443 Ga0207646_10174760
444 Ga0207646_10222128
445 Ga0207681_10000328
446 Ga0207650_10056493
447 Ga0207700_10339924
448 Ga0207644_10000238
449 Ga0207644_10196022
450 Ga0207670_10203783
451 Ga0207711_10004651
452 Ga0207711_10176452
453 Ga0207689_10250567
454 Ga0207667_10013237
455 Ga0207712_10042962
456 Ga0207668_10007855
457 Ga0207668_10012826
458 Ga0207668_10014241
459 Ga0207658_10003971
460 Ga0207677_10099550
461 Ga0207703_10006932
462 Ga0207641_10016195
463 Ga0207641_10106411
464 Ga0207676_10011360
465 Ga0207674_10026094
466 Ga0207675_100220640
467 Ga0207683_10051842
468 Ga0207698_10039753
469 Ga0207428_10056121
470 Ga0268266_10000002
471 Ga0268266_10000576
472 Ga0268266_10083919
473 Ga0268265_10036213
474 Ga0268265_10279770
475 Ga0268264_10000136
476 Ga0268264_10102596
477 Ga0265337_1000221
478 Ga0265326_10001607
479 Ga0265319_1007058
480 Ga0265334_10000207
481 Ga0265336_10018535
482 Ga0265338_10002051
483 Ga0265324_10009569
484 Ga0265332_10005693
485 Ga0265320_10014007
486 Ga0265314_10032241
487 Ga0316576_10007521
488 Ga0316576_10024717
489 Ga0316576_10099554
490 Ga0307405_10003236
491 Ga0307412_10008768
492 Ga0307414_10000149
493 Ga0307414_10055591
494 Ga0307415_100020991
495 Ga0307415_100162859
496 Ga0316580_10038361
497 Ga0373953_0013471
498 Ga0373943_0051084
499 Ga0316574_0005059
500 Ga0316574_0016700
501 Ga0373937_0206847
502 Ga0316584_0028123
503 Ga0395899_0002608
504 Ga0395899_0014752
505 Ga0395900_0003270
506 Ga0395900_0006476
507 Ga0395900_0026869
508 Ga0395900_0047242
509 Ga0395900_0135674
510 Ga0395898_0002294
511 Ga0395898_0026132
512 Ga0395905_0003837
513 Ga0395905_0256017
514 Ga0395905_0289707
515 Ga0436364_0115627
516 Ga0395901_0011705
517 Ga0395901_0015395
518 Ga0395901_0017721
519 Ga0395901_0027541
520 Ga0395901_0039295
521 Ga0395901_0114846
522 Ga0395901_0125634
523 Ga0400483_228481
524 Ga0439441_014390
525 Ga0439463_013028
526 Ga0439435_0023723
527 Ga0451577_0008895
528 Ga0453683_0113966
529 Ga0466963_0029708
530 Ga0466964_0034297
531 Ga0453684_0114468
532 Ga0453684_0323300
533 Ga0451576_0000122
534 Ga0451576_0015380
535 Ga0466958_0072323
536 Ga0466967_0054038
537 Ga0495627_000114
538 Ga0495627_000735
539 Ga0495627_000820
540 Ga0495638_0000024
541 Ga0495650_0002785
542 Ga0495584_0011560
543 Ga0495596_0000323
544 Ga0495596_0007296
545 Ga0495583_0000010
546 Ga0495583_0000107
547 Ga0495606_0026741
548 Ga0495606_0082270
549 Ga0495610_0000019
550 Ga0495610_0000042
551 Ga0495610_0000475
552 Ga0495610_0001079
553 Ga0495610_0015050
554 Ga0495620_0003823
555 Ga0495630_0078741
556 Ga0495632_0000006
557 Ga0495632_0001002
558 Ga0495632_0002578
559 Ga0495632_0009393
560 Ga0495637_0000479
561 Ga0495637_0008496
562 Ga0495637_0009307
563 Ga0495643_0000021
564 Ga0495643_0000565
565 Ga0495648_0000005
566 Ga0495648_0005268
567 Ga0495648_0025163
568 Ga0495663_0000008
569 Ga0495665_0020660
570 Ga0495640_0121385
571 Ga0495609_0011060
572 Ga0495597_0010123
573 Ga0495633_0000502
574 Ga0495633_0000750
575 Ga0495668_0097404
576 Ga0495625_0001148
577 Ga0495625_0016320
578 Ga0495671_0000017
579 Ga0495671_0000051
580 Ga0495636_0000702
581 Ga0495636_0067393
582 Ga0495636_0084429
583 Ga0495673_0000134
584 Ga0495681_0000003
585 Ga0495681_0000006
586 Ga0495681_0002424
587 Ga0495681_0009389
588 Ga0495686_0001568
589 Ga0495686_0002236
590 Ga0495686_0022913
591 Ga0495686_0026181
592 Ga0495686_0029553
593 Ga0495686_0117785
594 Ga0495626_0000758
595 Ga0496100_0126974
596 Ga0496101_0115356
597 Ga0496103_0007242
598 Ga0496108_0000697
599 Ga0496108_0012305
600 Ga0496109_0173213
601 Ga0496117_0020372
602 Ga0496118_0032811
603 Ga0496119_0000011
604 Ga0496120_0000329
605 Ga0496121_0000773
606 Ga0496121_0000953
607 Ga0496121_0004450
608 Ga0496121_0005805
609 Ga0496122_0004855
610 Ga0496123_0023380
611 Ga0496123_0039630
612 Ga0496124_0001757
613 Ga0496124_0016252
614 Ga0496124_0060767
615 Ga0496125_0007124
616 Ga0496125_0041800
617 Ga0496125_0108428
618 Ga0496126_0002215
619 Ga0496126_0006330
620 Ga0496126_0036683
621 Ga0496126_0041761
622 Ga0496126_0137341
623 Ga0495682_0057539
624 Ga0501034_0001860
625 Ga0501034_0008307
626 Ga0501034_0077994
627 Ga0501046_0281940
628 Ga0501068_0003738
629 Ga0501070_0065128
630 Ga0501080_0249188
631 Ga0501044_0063951
632 Ga0501044_0220835
633 nmdc:mga03683_1167_c1
634 nmdc:mga03683_8406_c1
635 nmdc:mga0yw44_129372_c1
636 nmdc:mga0k408_9096_c1
637 nmdc:mga07m45_154675_c1
638 nmdc:mga05p37_91876_c1
639 nmdc:mga09592_188006_c1
640 nmdc:mga0qj67_251926_c1
641 nmdc:mga06r32_317051_c1
642 nmdc:mga08y16_238367_c1
643 nmdc:mga08y16_65695_c1
644 nmdc:mga0sz30_145_c2
645 nmdc:mga0sz30_15312_c1
646 Ga0495619_0022319
647 Ga0500651_0008791
648 Ga0500566_0000146
649 Ga0500641_0002360
650 Ga0500555_000041
651 Ga0500592_000011
652 Ga0500595_044318
653 Ga0500608_000561
654 Ga0500642_0001025
655 Ga0500655_000038
656 Ga0500658_0098287
657 Ga0500559_0004380
658 Ga0500559_0069186
659 Ga0500564_000872
660 Ga0500577_0009571
661 Ga0500590_000664
662 Ga0500604_0000009
663 Ga0500616_0003370
664 Ga0500622_0017318
665 Ga0500624_000033
666 Ga0500627_0000050
667 Ga0500636_0012800
668 Ga0500570_000021
669 Ga0500625_000010
670 Ga0500552_001232
671 2511126522
672 2739649681
673 2740028154
674 2753764107
675 2819554227
676 2848863922
677 2879166334
678 2941487209
679 8054305201
680 8057102389

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02515

CoA_transf_3

CoA-transferase family III

58

420

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yit-assembly1.cif.gz_B crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8882 9 374
5yx6-assembly2.cif.gz_D crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.8825 9 370
5yx6-assembly1.cif.gz_B crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.8796 9 370
5yx6-assembly2.cif.gz_C crystal structure of rv3272 from m. tuberculosis orthorhombic form 0.8781 9 370
5yit-assembly2.cif.gz_D crystal structure of hypothetical protein (rv3272) from mycobacterium tuberculosis 0.8759 9 370
ID Description Score Start End Superfamily
af_Q68FU4_261_348_3.30.1540.10 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.93 229 314 3.30.1540.10
4hl6E02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9213 229 316 3.30.1540.10
4ed9A02 Alpha Beta;2-Layer Sandwich;formyl-coa transferase, domain 3;formyl-coa transferase, domain 3 0.9123 229 317 3.30.1540.10
af_Q9VDL4_46_327_3.40.50.10540 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8876 8 282 3.40.50.10540
1x74D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Crotonobetainyl-coa:carnitine coa-transferase; domain 1 0.8825 13 194 3.40.50.10540
ID Description Score Start End GO Terms
AF-A0A7G5EKM5-F1-model_v4 CoA transferase 0.9483 8 390 GO:0008410
AF-A0A4V2AJS6-F1-model_v4 deleted 0.9475 8 390
AF-A0A4Q3N187-F1-model_v4 CoA transferase 0.9412 159 390 GO:0008410
AF-A0A7C9GHG5-F1-model_v4 CoA transferase 0.9379 12 137 GO:0008410
AF-A0A4U0Z4Z9-F1-model_v4 CoA transferase 0.9376 8 390 GO:0016740

Map