F414570

General Info

Members Datasets Scaffolds Average Seq Length
340 302 222 207

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8016566248|8016572508
Length 246
Sequence SFIHRFEPATSAGSPPLLLLHGTGGDENDLLGLGKMISPGSALLSPRGRVLEHGMPRFFRRLGEGVFDEEDVRRRALELSDFVADARQRYGLAAPVAVGFSNGANIAAALLLLEPDVLAGAILLRAMVPLSAPPKAELAGKPVLLLVRARRPDRAGEQFGTARRVAVASWRGRDTQDPAGGPSIVASRRDARPRLDRQNRCRSRLIPKSGASFSDAAPPLYSNQPRRLNQISGSTPLAMMASHANG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
5 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
6 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
7 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
8 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
12 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
13 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
14 2643221736 Bosea sp. Root483D1 Isolate Unclassified
15 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
16 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
17 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
18 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
25 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
26 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
27 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
28 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
29 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
30 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
31 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
32 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
33 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
34 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
35 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
36 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
37 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
38 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
39 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
40 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
41 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
42 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
43 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
44 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
45 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
46 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
47 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
48 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
49 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
50 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
51 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
52 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
53 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
54 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
55 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
56 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
57 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
58 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
59 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
60 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
61 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
62 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
63 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
64 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
65 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
66 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
67 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
68 2906610324
69 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
70 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
71 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
72 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
73 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
74 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
75 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
76 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
77 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
78 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
79 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
80 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
81 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
82 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
83 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
84 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
85 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
86 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
87 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
88 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
89 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
90 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
91 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
92 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
93 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
94 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
95 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
96 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
97 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
98 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
99 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
102 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
106 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
110 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
111 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
112 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
113 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
114 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
115 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
116 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
117 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
118 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
119 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
120 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
121 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
122 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
123 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
130 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
131 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
132 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
133 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
134 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
139 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
159 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
161 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
162 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
166 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
167 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
189 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
190 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
193 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
194 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
195 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
196 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
197 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
198 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
202 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
203 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
204 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
207 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
208 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
224 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
229 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
241 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
242 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
243 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
255 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
256 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
257 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
260 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
263 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
264 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
268 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
269 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
270 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
271 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
272 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
273 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
277 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
278 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
279 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
280 641522639 Methylobacterium sp. 4-46 Isolate Nodule
281 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
282 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
283 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
284 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
285 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
286 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
287 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
288 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
289 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
290 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
291 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
292 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
293 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
294 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
295 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
296 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
297 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
298 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
299 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
300 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
301 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
302 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 64.31
Metatranscriptomes 1.18
Isolates 34.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.12
Nodule 27.06
Rhizoplane 3.82
Rhizosphere 38.24
Stem 0
Stem Tuber 0
Unclassified 16.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1006145 3300002987 Bacteria 3640
2 JGI25151J46595_10000064 3300003187 Bacteria 145243
3 JGI25153J46596_10034978 3300003215 Bacteria 1634
4 JGI25160J50197_1031598 3300003354 Bacteria 1361
5 Ga0055539_1003470 3300003752 Bacteria 2203
6 Ga0055542_1003573 3300003762 Bacteria 4131
7 Ga0065165_1000046 3300005262 Bacteria 198873
8 Ga0070658_10114010 3300005327 Bacteria 2241
9 Ga0070682_100161042 3300005337 Bacteria 1550
10 Ga0070661_100162174 3300005344 Bacteria 1693
11 Ga0070713_100161323 3300005436 Bacteria 2002
12 Ga0070662_100126794 3300005457 Bacteria 1963
13 Ga0068867_101071037 3300005459 Bacteria 734
14 Ga0068855_100513355 3300005563 Bacteria 1301
15 Ga0068854_100527310 3300005578 Bacteria 998
16 Ga0068856_100237746 3300005614 Bacteria 1837
17 Ga0068852_100092285 3300005616 Bacteria 2711
18 Ga0068852_100121383 3300005616 Bacteria 2393
19 Ga0081540_1010753 3300005983 Bacteria 6158
20 Ga0075368_10003741 3300006042 Bacteria 5106
21 Ga0075363_100000594 3300006048 Bacteria 11930
22 Ga0070712_100376958 3300006175 Bacteria 1167
23 Ga0075367_10030393 3300006178 Bacteria 3097
24 Ga0099824_1017291 3300006942 Bacteria 6281
25 Ga0099795_10001377 3300007788 Bacteria 5234
26 Ga0105240_10101079 3300009093 Bacteria 3508
27 Ga0105245_10893843 3300009098 Bacteria 930
28 Ga0105241_10059255 3300009174 Bacteria 2943
29 Ga0105241_10648623 3300009174 Bacteria 959
30 Ga0105237_10002274 3300009545 Bacteria 23895
31 Ga0105237_10247857 3300009545 Bacteria 1783
32 Ga0099796_10001503 3300010159 Bacteria 4726
33 Ga0105239_10141549 3300010375 Bacteria 2681
34 Ga0105239_10353812 3300010375 Bacteria 1658
35 Ga0105239_10460807 3300010375 Bacteria 1443
36 Ga0105239_10800110 3300010375 Bacteria 1080
37 Ga0163162_10209120 3300013306 Bacteria 2081
38 Ga0163163_10564585 3300014325 Bacteria 1201
39 Ga0157379_10479509 3300014968 Bacteria 1151
40 Ga0214542_1000001 3300021321 Bacteria 1018696
41 Ga0214545_1000001 3300021324 Bacteria 1092817
42 Ga0214545_1035642 3300021324 Bacteria 1633
43 Ga0214543_1000006 3300021327 Bacteria 443395
44 Ga0214543_1035396 3300021327 Bacteria 1635
45 Ga0213872_10016912 3300021361 Bacteria 3379
46 Ga0213875_10000058 3300021388 Bacteria 135597
47 Ga0209677_102526 3300025253 Bacteria 6794
48 Ga0209148_1000261 3300025254 Bacteria 82670
49 Ga0209233_1004138 3300025261 Bacteria 4993
50 Ga0209673_1016600 3300025273 Bacteria 2744
51 Ga0209130_1000703 3300025284 Bacteria 29959
52 Ga0209025_1000182 3300025294 Bacteria 156443
53 Ga0209025_1002211 3300025294 Bacteria 21463
54 Ga0209564_1005079 3300025295 Bacteria 7675
55 Ga0209758_1005645 3300025297 Bacteria 9482
56 Ga0209758_1015458 3300025297 Bacteria 3948
57 Ga0207426_1004422 3300025302 Bacteria 6863
58 Ga0207426_1030827 3300025302 Bacteria 1755
59 Ga0207656_10098118 3300025321 Bacteria 1340
60 Ga0207643_10322703 3300025908 Bacteria 965
61 Ga0207695_10000008 3300025913 Bacteria 1058268
62 Ga0207671_10001041 3300025914 Bacteria 33720
63 Ga0207660_10272968 3300025917 Bacteria 1340
64 Ga0207649_10090303 3300025920 Bacteria 2004
65 Ga0207700_10392060 3300025928 Bacteria 1216
66 Ga0207706_10084396 3300025933 Bacteria 2792
67 Ga0207665_10174901 3300025939 Bacteria 1552
68 Ga0207667_10535145 3300025949 Bacteria 1186
69 Ga0207702_10315368 3300026078 Bacteria 1488
70 Ga0207648_10434073 3300026089 Bacteria 1194
71 Ga0207674_10275122 3300026116 Bacteria 1631
72 Ga0207675_100815851 3300026118 Bacteria 947
73 Ga0207698_10627471 3300026142 Bacteria 1062
74 Ga0209389_1000010 3300027296 Bacteria 223892
75 Ga0209389_1000149 3300027296 Bacteria 59631
76 Ga0209589_1000016 3300027357 Bacteria 223788
77 Ga0209489_100016 3300027361 Bacteria 223873
78 Ga0209489_115251 3300027361 Bacteria 4830
79 Ga0209700_100030 3300027363 Bacteria 212982
80 Ga0209179_1002782 3300027512 Bacteria 2421
81 Ga0209813_10003592 3300027866 Bacteria 3642
82 Ga0265334_10003484 3300028573 Bacteria 7149
83 Ga0265318_10035924 3300028577 Bacteria 1904
84 Ga0265323_10002861 3300028653 Bacteria 7753
85 Ga0265336_10009965 3300028666 Bacteria 3266
86 Ga0265338_10000176 3300028800 Bacteria 118726
87 Ga0265324_10004317 3300029957 Bacteria 6479
88 Ga0265329_10048669 3300031242 Bacteria 1352
89 Ga0265340_10003105 3300031247 Bacteria 9419
90 Ga0265339_10010388 3300031249 Bacteria 5785
91 Ga0265331_10006941 3300031250 Bacteria 6612
92 Ga0265316_10076722 3300031344 Bacteria 2567
93 Ga0265314_10012131 3300031711 Bacteria 7058
94 Ga0265342_10000031 3300031712 Bacteria 152577
95 Ga0307405_10126386 3300031731 Bacteria 1759
96 Ga0307410_10085044 3300031852 Bacteria 2231
97 Ga0307410_11110619 3300031852 Bacteria 686
98 Ga0307407_10053363 3300031903 Bacteria 2326
99 Ga0307412_10147750 3300031911 Bacteria 1730
100 Ga0307409_100657466 3300031995 Bacteria 1043
101 Ga0307414_10101328 3300032004 Bacteria 2168
102 Ga0373947_0635158 3300035725 Bacteria 728
103 Ga0395898_0728769 3300037466 Bacteria 933
104 Ga0436364_0370476 3300037853 Bacteria 58769
105 Ga0436364_0677801 3300037853 Bacteria 3351
106 Ga0436364_0871303 3300037853 Bacteria 1350
107 Ga0436365_1578464 3300039437 Bacteria 1820
108 Ga0436362_0137370 3300039453 Bacteria 1851
109 Ga0439461_0075611 3300041410 Bacteria 787
110 Ga0439465_0071632 3300041413 Bacteria 1162
111 Ga0451802_0568610 3300041460 Bacteria 1699
112 Ga0451807_0261396 3300041486 Bacteria 1336
113 Ga0439431_0010884 3300041997 Bacteria 2072
114 Ga0466972_0002206 3300044658 Bacteria 9555
115 Ga0466972_0036722 3300044658 Bacteria 2396
116 Ga0466972_0189780 3300044658 Bacteria 963
117 Ga0466965_0089895 3300044683 Bacteria 1561
118 Ga0466965_0125801 3300044683 Bacteria 1326
119 Ga0466968_0013808 3300044735 Bacteria 3180
120 Ga0466968_0232507 3300044735 Bacteria 871
121 Ga0466968_0275547 3300044735 Bacteria 804
122 Ga0466957_0051786 3300044842 Bacteria 2499
123 Ga0466960_0479868 3300044901 Bacteria 726
124 Ga0466960_0589482 3300044901 Bacteria 659
125 Ga0466959_0178409 3300045049 Bacteria 1487
126 Ga0466967_0129259 3300045976 Bacteria 2343
127 Ga0495651_0003865 3300046462 Bacteria 11451
128 Ga0495653_0038476 3300046463 Bacteria 3755
129 Ga0495662_0127625 3300046476 Bacteria 1250
130 Ga0495585_0084214 3300046492 Bacteria 1720
131 Ga0495596_0025747 3300046500 Bacteria 2376
132 Ga0495606_0166216 3300046507 Bacteria 1283
133 Ga0495610_0159725 3300046512 Bacteria 954
134 Ga0495628_0006905 3300046516 Bacteria 9865
135 Ga0495648_0000744 3300046524 Bacteria 34793
136 Ga0495652_0008976 3300046529 Bacteria 9096
137 Ga0495652_0119040 3300046529 Bacteria 2110
138 Ga0495640_0045668 3300046533 Bacteria 3039
139 Ga0495640_0201808 3300046533 Bacteria 1260
140 Ga0495587_0005247 3300046536 Bacteria 8470
141 Ga0495645_0006930 3300046543 Bacteria 7874
142 Ga0495622_0013964 3300046557 Bacteria 3727
143 Ga0495667_0005274 3300046559 Bacteria 8739
144 Ga0495634_0011648 3300046642 Bacteria 6398
145 Ga0495611_0293030 3300046648 Bacteria 751
146 Ga0495635_0035412 3300046663 Bacteria 3460
147 Ga0495657_0006664 3300046675 Bacteria 9020
148 Ga0495599_0035262 3300046678 Bacteria 3140
149 Ga0495623_0005031 3300046679 Bacteria 8671
150 Ga0495646_0016746 3300046680 Bacteria 4654
151 Ga0495646_0132113 3300046680 Bacteria 1404
152 Ga0495624_0043866 3300046690 Bacteria 2851
153 Ga0495624_0319067 3300046690 Bacteria 936
154 Ga0495649_0121671 3300046694 Bacteria 1380
155 Ga0495600_0000891 3300046809 Bacteria 15990
156 Ga0495604_0001773 3300047317 Bacteria 17615
157 Ga0495604_0022862 3300047317 Bacteria 4990
158 Ga0495674_0011966 3300047319 Bacteria 8182
159 Ga0495676_0028110 3300047321 Bacteria 4811
160 Ga0495680_0009370 3300047322 Bacteria 8811
161 Ga0495675_0023757 3300047444 Bacteria 3906
162 Ga0495684_0177391 3300047471 Bacteria 1581
163 Ga0495602_0011851 3300048088 Bacteria 8999
164 Ga0496104_0145358 3300048907 Bacteria 2277
165 Ga0496104_0294449 3300048907 Bacteria 1535
166 Ga0496104_0548023 3300048907 Bacteria 1067
167 Ga0496105_0005753 3300048908 Bacteria 9445
168 Ga0496105_0151154 3300048908 Bacteria 1908
169 Ga0496108_1000558 3300048911 Bacteria 714
170 Ga0496110_0369494 3300048913 Bacteria 1307
171 Ga0496112_0157805 3300048915 Bacteria 2235
172 Ga0496113_0125820 3300048916 Bacteria 2007
173 Ga0496114_0459391 3300048917 Bacteria 1127
174 Ga0496115_0293994 3300048918 Bacteria 1332
175 Ga0496116_0017721 3300048919 Bacteria 5518
176 Ga0496117_0014455 3300048920 Bacteria 6799
177 Ga0496119_0109874 3300048922 Bacteria 1532
178 Ga0496120_0010123 3300048923 Bacteria 6607
179 Ga0496120_0081438 3300048923 Bacteria 1752
180 Ga0496121_0001674 3300048924 Bacteria 36437
181 Ga0496121_0037416 3300048924 Bacteria 4310
182 Ga0496122_0005763 3300048925 Bacteria 14576
183 Ga0496122_0213169 3300048925 Bacteria 1116
184 Ga0496122_0337383 3300048925 Bacteria 793
185 Ga0496123_0001445 3300048926 Bacteria 33092
186 Ga0496123_0142273 3300048926 Bacteria 1309
187 Ga0496124_0350509 3300048927 Bacteria 1044
188 Ga0496126_0060603 3300048929 Bacteria 3402
189 Ga0496126_0513792 3300048929 Bacteria 955
190 Ga0501305_004795 3300049161 Bacteria 1609
191 Ga0501311_038992 3300049527 Bacteria 715
192 Ga0501315_002708 3300049531 Bacteria 1699
193 Ga0501318_001738 3300049534 Bacteria 1777
194 Ga0501069_0041623 3300049585 Bacteria 2539
195 Ga0501252_011250 3300049682 Bacteria 1068
196 nmdc:mga03n38_1262_c1 3300050490 Bacteria 7111
197 nmdc:mga00v17_83661_c1 3300050491 Bacteria 1996
198 nmdc:mga0yw44_21057_c1 3300050492 Bacteria 3631
199 nmdc:mga06z11_1557_c1 3300050494 Bacteria 8529
200 nmdc:mga06r32_11114_c1 3300050510 Bacteria 8104
201 Ga0495619_0149309 3300053085 Bacteria 1612
202 Ga0500643_001856 3300053087 Bacteria 11528
203 Ga0500583_0161898 3300053092 Bacteria 1114
204 Ga0500556_0000220 3300053104 Bacteria 46311
205 Ga0500557_000009 3300053105 Bacteria 125806
206 Ga0500569_079953 3300053109 Bacteria 1044
207 Ga0500595_000016 3300053119 Bacteria 211397
208 Ga0500595_004763 3300053119 Bacteria 6012
209 Ga0500607_008467 3300053121 Bacteria 6255
210 Ga0500608_109872 3300053122 Bacteria 1265
211 Ga0500614_003000 3300053123 Bacteria 3674
212 Ga0500642_0000126 3300053130 Bacteria 34999
213 Ga0500655_015046 3300053133 Bacteria 1418
214 Ga0500658_0112733 3300053134 Bacteria 1198
215 Ga0500559_0187223 3300053136 Bacteria 975
216 Ga0500568_0051937 3300053139 Bacteria 1611
217 Ga0500616_0000006 3300053153 Bacteria 944738
218 Ga0500636_0000172 3300053177 Bacteria 34107
219 Ga0500637_0111189 3300053178 Bacteria 1589
220 Ga0500645_000033 3300053730 Bacteria 119279
221 Ga0500645_008424 3300053730 Bacteria 3522
222 Ga0500601_000016 3300053737 Bacteria 40972

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2545555834 2545678340 198
2 iso_pu_bacteria 641522639 641643283 198
3 iso_pu_bacteria 643348564 643602914 198
4 3300048925 Ga0496122_0005763 Ga0496122_0005763_934_1569 201
5 3300048926 Ga0496123_0001445 Ga0496123_0001445_6753_7388 201
6 3300049682 Ga0501252_011250 Ga0501252_011250_307_912 201
7 iso_pu_bacteria 2508501114 2509078228 201
8 iso_pu_bacteria 2775506901 2776259179 201
9 iso_pu_bacteria 2882456835 2882459723 201
10 iso_pu_bacteria 2894232714 2894233678 201
11 3300025908 Ga0207643_10322703 Ga0207643_103227032 202
12 3300031852 Ga0307410_10085044 Ga0307410_100850442 202
13 3300031903 Ga0307407_10053363 Ga0307407_100533632 202
14 3300031911 Ga0307412_10147750 Ga0307412_101477501 202
15 3300049161 Ga0501305_004795 Ga0501305_004795_84_692 202
16 3300049585 Ga0501069_0041623 Ga0501069_0041623_586_1200 202
17 iso_pu_bacteria 2824704595 2824713059 202
18 iso_pu_bacteria 2824753945 2824763060 202
19 iso_pu_bacteria 2824763712 2824772210 202
20 iso_pu_bacteria 2844315083 2844319720 202
21 iso_pu_bacteria 2904711408 2904712286 202
22 iso_pu_bacteria 2906602504 2906609593 202
23 iso_pu_bacteria 3005594810 3005599944 202
24 iso_pu_bacteria 3005718088 3005722879 202
25 iso_pu_bacteria 8016566248 8016572508 202
26 3300005563 Ga0068855_100513355 Ga0068855_1005133552 203
27 3300005614 Ga0068856_100237746 Ga0068856_1002377462 203
28 3300009098 Ga0105245_10893843 Ga0105245_108938432 203
29 3300025949 Ga0207667_10535145 Ga0207667_105351452 203
30 3300026078 Ga0207702_10315368 Ga0207702_103153682 203
31 3300031852 Ga0307410_11110619 Ga0307410_111106191 203
32 3300037466 Ga0395898_0728769 Ga0395898_0728769_265_894 203
33 3300037853 Ga0436364_0677801 Ga0436364_0677801_994_1614 203
34 3300039437 Ga0436365_1578464 Ga0436365_1578464_621_1241 203
35 3300039453 Ga0436362_0137370 Ga0436362_0137370_24_644 203
36 3300044901 Ga0466960_0589482 Ga0466960_0589482_15_635 203
37 3300050491 nmdc:mga00v17_83661_c1 nmdc:mga00v17_83661_c1_700_1317 203
38 3300050510 nmdc:mga06r32_11114_c1 nmdc:mga06r32_11114_c1_340_960 203
39 iso_pu_bacteria 2738541281 2738743113 203
40 iso_pu_bacteria 2738543032 2739352730 203
41 3300021388 Ga0213875_10000058 Ga0213875_10000058149 204
42 3300031995 Ga0307409_100657466 Ga0307409_1006574662 204
43 3300037853 Ga0436364_0370476 Ga0436364_0370476_57573_58196 204
44 3300048911 Ga0496108_1000558 Ga0496108_1000558_74_688 204
45 3300048920 Ga0496117_0014455 Ga0496117_0014455_5579_6199 204
46 3300048925 Ga0496122_0213169 Ga0496122_0213169_226_846 204
47 3300048926 Ga0496123_0142273 Ga0496123_0142273_98_718 204
48 3300053087 Ga0500643_001856 Ga0500643_001856_1078_1698 204
49 3300053119 Ga0500595_000016 Ga0500595_000016_110517_111137 204
50 3300053153 Ga0500616_0000006 Ga0500616_0000006_608584_609204 204
51 iso_pu_bacteria 2507262055 2507507955 204
52 iso_pu_bacteria 2508501009 2508542069 204
53 iso_pu_bacteria 2508501042 2508692387 204
54 iso_pu_bacteria 2513237092 2513622552 204
55 iso_pu_bacteria 2513237095 2513647211 204
56 iso_pu_bacteria 2513237102 2513705666 204
57 iso_pu_bacteria 2513237139 2513877585 204
58 iso_pu_bacteria 2513237161 2514009730 204
59 iso_pu_bacteria 2517093001 2517103824 204
60 iso_pu_bacteria 2617270741 2617378600 204
61 iso_pu_bacteria 2791355196 2793060811 204
62 iso_pu_bacteria 2802429603 2805918405 204
63 iso_pu_bacteria 2816332527 2818236248 204
64 iso_pu_bacteria 2824617872 2824624455 204
65 iso_pu_bacteria 2824626560 2824634238 204
66 iso_pu_bacteria 2824635225 2824640907 204
67 iso_pu_bacteria 2824679649 2824684609 204
68 iso_pu_bacteria 2824696289 2824702952 204
69 iso_pu_bacteria 2824723954 2824728863 204
70 iso_pu_bacteria 2824732956 2824738420 204
71 iso_pu_bacteria 2824746037 2824752756 204
72 iso_pu_bacteria 2838122688 2838122961 204
73 iso_pu_bacteria 2841941048 2841944754 204
74 iso_pu_bacteria 2841949485 2841955955 204
75 iso_pu_bacteria 2841957949 2841960011 204
76 iso_pu_bacteria 2841966195 2841969908 204
77 iso_pu_bacteria 2841974524 2841978661 204
78 iso_pu_bacteria 2841983080 2841984213 204
79 iso_pu_bacteria 2847930680 2847937040 204
80 iso_pu_bacteria 2847939898 2847947441 204
81 iso_pu_bacteria 2849076700 2849078673 204
82 iso_pu_bacteria 2857509624 2857513079 204
83 iso_pu_bacteria 2874590934 2874599054 204
84 iso_pu_bacteria 2874612657 2874617226 204
85 iso_pu_bacteria 2874620515 2874626637 204
86 iso_pu_bacteria 2874645413 2874650501 204
87 iso_pu_bacteria 2876771140 2876779093 204
88 iso_pu_bacteria 2876818435 2876822697 204
89 iso_pu_bacteria 2879074833 2879082886 204
90 iso_pu_bacteria 2879083081 2879083899 204
91 iso_pu_bacteria 2879127579 2879133049 204
92 iso_pu_bacteria 2879142872 2879149336 204
93 iso_pu_bacteria 2881364244 2881368092 204
94 iso_pu_bacteria 2881665667 2881667822 204
95 iso_pu_bacteria 2885366525 2885369603 204
96 iso_pu_bacteria 2885409591 2885413621 204
97 iso_pu_bacteria 2888378607 2888385140 204
98 iso_pu_bacteria 2888388044 2888393087 204
99 iso_pu_bacteria 2904666416 2904671978 204
100 iso_pu_bacteria 2906643746 2906651610 204
101 iso_pu_bacteria 2922393267 2922397387 204
102 iso_pu_bacteria 2929615660 2929620566 204
103 iso_pu_bacteria 2929624759 2929626460 204
104 iso_pu_bacteria 2933577622 2933582484 204
105 iso_pu_bacteria 2935608549 2935609545 204
106 iso_pu_bacteria 2935769743 2935769944 204
107 iso_pu_bacteria 2935777560 2935782036 204
108 iso_pu_bacteria 2935785616 2935785814 204
109 iso_pu_bacteria 2935793552 2935794258 204
110 iso_pu_bacteria 2935819856 2935822707 204
111 iso_pu_bacteria 2935847175 2935848289 204
112 iso_pu_bacteria 2935908558 2935909908 204
113 iso_pu_bacteria 2935916978 2935917633 204
114 iso_pu_bacteria 2935926038 2935927388 204
115 iso_pu_bacteria 2935934488 2935936767 204
116 iso_pu_bacteria 2935942939 2935944930 204
117 iso_pu_bacteria 2935951376 2935953367 204
118 iso_pu_bacteria 2935959822 2935961135 204
119 iso_pu_bacteria 2935967501 2935970207 204
120 iso_pu_bacteria 2935975950 2935981031 204
121 iso_pu_bacteria 2935984226 2935986775 204
122 iso_pu_bacteria 3005587118 3005587350 204
123 iso_pu_bacteria 3005710791 3005715537 204
124 iso_pu_bacteria 8006926726 8006928575 204
125 iso_pu_bacteria 8016522445 8016528970 204
126 iso_pu_bacteria 8016530956 8016534166 204
127 iso_pu_bacteria 8016539877 8016547398 204
128 iso_pu_bacteria 8016548790 8016554747 204
129 iso_pu_bacteria 8016557553 8016563113 204
130 iso_pu_bacteria 8016575299 8016576675 204
131 iso_pu_bacteria 8016583857 8016593805 204
132 iso_pu_bacteria 8016595262 8016600868 204
133 iso_pu_bacteria 8016613128 8016615308 204
134 iso_pu_bacteria 8016622563 8016625901 204
135 iso_pu_bacteria 8019530166 8019533942 204
136 iso_pu_bacteria 8019538911 8019545739 204
137 iso_pu_bacteria 8019547302 8019552984 204
138 iso_pu_bacteria 8019619141 8019619506 204
139 iso_pu_bacteria 8019638758 8019646290 204
140 iso_pu_bacteria 8019668869 8019671027 204
141 iso_pu_bacteria 8019678201 8019685166 204
142 iso_pu_bacteria 8019687851 8019690759 204
143 iso_pu_bacteria 8055742211 8055745428 204
144 3300025917 Ga0207660_10272968 Ga0207660_102729682 205
145 3300046680 Ga0495646_0132113 Ga0495646_0132113_55_672 205
146 3300049527 Ga0501311_038992 Ga0501311_038992_81_698 205
147 3300049531 Ga0501315_002708 Ga0501315_002708_78_695 205
148 3300049534 Ga0501318_001738 Ga0501318_001738_1138_1755 205
149 iso_pu_bacteria 2508501128 2509147298 205
150 iso_pu_bacteria 2829745981 2829750940 205
151 iso_pu_bacteria 2906610324 2906615770 205
152 iso_pu_bacteria 3005474847 3005476720 205
153 3300003354 JGI25160J50197_1031598 JGI25160J50197_10315982 206
154 3300003762 Ga0055542_1003573 Ga0055542_10035734 206
155 3300005578 Ga0068854_100527310 Ga0068854_1005273101 206
156 3300005616 Ga0068852_100121383 Ga0068852_1001213833 206
157 3300005983 Ga0081540_1010753 Ga0081540_10107533 206
158 3300009093 Ga0105240_10101079 Ga0105240_101010795 206
159 3300009174 Ga0105241_10059255 Ga0105241_100592553 206
160 3300009174 Ga0105241_10648623 Ga0105241_106486232 206
161 3300009545 Ga0105237_10002274 Ga0105237_1000227413 206
162 3300010375 Ga0105239_10460807 Ga0105239_104608072 206
163 3300010375 Ga0105239_10800110 Ga0105239_108001102 206
164 3300013306 Ga0163162_10209120 Ga0163162_102091202 206
165 3300025254 Ga0209148_1000261 Ga0209148_100026114 206
166 3300025273 Ga0209673_1016600 Ga0209673_10166002 206
167 3300025295 Ga0209564_1005079 Ga0209564_10050795 206
168 3300025302 Ga0207426_1030827 Ga0207426_10308272 206
169 3300025913 Ga0207695_10000008 Ga0207695_10000008510 206
170 3300025914 Ga0207671_10001041 Ga0207671_1000104113 206
171 3300026118 Ga0207675_100815851 Ga0207675_1008158512 206
172 3300031731 Ga0307405_10126386 Ga0307405_101263862 206
173 3300035725 Ga0373947_0635158 Ga0373947_0635158_41_661 206
174 3300044658 Ga0466972_0002206 Ga0466972_0002206_6928_7563 206
175 3300044658 Ga0466972_0036722 Ga0466972_0036722_1061_1681 206
176 3300044658 Ga0466972_0189780 Ga0466972_0189780_214_849 206
177 3300044683 Ga0466965_0089895 Ga0466965_0089895_930_1550 206
178 3300044735 Ga0466968_0013808 Ga0466968_0013808_1811_2446 206
179 3300044735 Ga0466968_0232507 Ga0466968_0232507_76_705 206
180 3300044735 Ga0466968_0275547 Ga0466968_0275547_74_709 206
181 3300045049 Ga0466959_0178409 Ga0466959_0178409_694_1314 206
182 3300045976 Ga0466967_0129259 Ga0466967_0129259_130_750 206
183 3300046462 Ga0495651_0003865 Ga0495651_0003865_8661_9281 206
184 3300046463 Ga0495653_0038476 Ga0495653_0038476_1186_1806 206
185 3300046476 Ga0495662_0127625 Ga0495662_0127625_367_987 206
186 3300046516 Ga0495628_0006905 Ga0495628_0006905_6983_7603 206
187 3300046529 Ga0495652_0008976 Ga0495652_0008976_1161_1781 206
188 3300046529 Ga0495652_0119040 Ga0495652_0119040_753_1388 206
189 3300046533 Ga0495640_0045668 Ga0495640_0045668_280_900 206
190 3300046533 Ga0495640_0201808 Ga0495640_0201808_429_1064 206
191 3300046536 Ga0495587_0005247 Ga0495587_0005247_5689_6309 206
192 3300046543 Ga0495645_0006930 Ga0495645_0006930_4399_5019 206
193 3300046559 Ga0495667_0005274 Ga0495667_0005274_2165_2785 206
194 3300046642 Ga0495634_0011648 Ga0495634_0011648_409_1029 206
195 3300046663 Ga0495635_0035412 Ga0495635_0035412_722_1357 206
196 3300046675 Ga0495657_0006664 Ga0495657_0006664_6259_6879 206
197 3300046678 Ga0495599_0035262 Ga0495599_0035262_1639_2259 206
198 3300046679 Ga0495623_0005031 Ga0495623_0005031_5905_6525 206
199 3300046680 Ga0495646_0016746 Ga0495646_0016746_180_815 206
200 3300046690 Ga0495624_0043866 Ga0495624_0043866_494_1129 206
201 3300046690 Ga0495624_0319067 Ga0495624_0319067_108_728 206
202 3300046809 Ga0495600_0000891 Ga0495600_0000891_417_1037 206
203 3300047317 Ga0495604_0001773 Ga0495604_0001773_2863_3483 206
204 3300047317 Ga0495604_0022862 Ga0495604_0022862_1769_2404 206
205 3300047319 Ga0495674_0011966 Ga0495674_0011966_1584_2204 206
206 3300047321 Ga0495676_0028110 Ga0495676_0028110_584_1219 206
207 3300047322 Ga0495680_0009370 Ga0495680_0009370_2124_2744 206
208 3300047444 Ga0495675_0023757 Ga0495675_0023757_2629_3249 206
209 3300047471 Ga0495684_0177391 Ga0495684_0177391_874_1494 206
210 3300048088 Ga0495602_0011851 Ga0495602_0011851_2076_2696 206
211 3300048907 Ga0496104_0294449 Ga0496104_0294449_766_1401 206
212 3300048908 Ga0496105_0005753 Ga0496105_0005753_8510_9145 206
213 3300048917 Ga0496114_0459391 Ga0496114_0459391_86_721 206
214 3300048922 Ga0496119_0109874 Ga0496119_0109874_596_1231 206
215 3300048923 Ga0496120_0010123 Ga0496120_0010123_235_870 206
216 3300048929 Ga0496126_0513792 Ga0496126_0513792_279_914 206
217 3300050492 nmdc:mga0yw44_21057_c1 nmdc:mga0yw44_21057_c1_51_671 206
218 3300053085 Ga0495619_0149309 Ga0495619_0149309_883_1518 206
219 3300053133 Ga0500655_015046 Ga0500655_015046_19_639 206
220 3300053134 Ga0500658_0112733 Ga0500658_0112733_48_668 206
221 3300053730 Ga0500645_000033 Ga0500645_000033_85721_86368 206
222 3300053737 Ga0500601_000016 Ga0500601_000016_31852_32472 206
223 iso_pu_bacteria 2842333319 2842336388 206
224 iso_pu_bacteria 2894817345 2894822141 206
225 3300007788 Ga0099795_10001377 Ga0099795_100013775 207
226 3300010159 Ga0099796_10001503 Ga0099796_100015032 207
227 3300025261 Ga0209233_1004138 Ga0209233_10041384 207
228 3300027512 Ga0209179_1002782 Ga0209179_10027822 207
229 3300037853 Ga0436364_0871303 Ga0436364_0871303_406_1032 207
230 3300044842 Ga0466957_0051786 Ga0466957_0051786_565_1200 207
231 3300003187 JGI25151J46595_10000064 JGI25151J46595_10000064153 208
232 3300003215 JGI25153J46596_10034978 JGI25153J46596_100349782 208
233 3300003752 Ga0055539_1003470 Ga0055539_10034701 208
234 3300005327 Ga0070658_10114010 Ga0070658_101140102 208
235 3300005337 Ga0070682_100161042 Ga0070682_1001610422 208
236 3300005344 Ga0070661_100162174 Ga0070661_1001621742 208
237 3300005436 Ga0070713_100161323 Ga0070713_1001613233 208
238 3300005457 Ga0070662_100126794 Ga0070662_1001267942 208
239 3300005459 Ga0068867_101071037 Ga0068867_1010710371 208
240 3300005616 Ga0068852_100092285 Ga0068852_1000922852 208
241 3300006042 Ga0075368_10003741 Ga0075368_100037412 208
242 3300006048 Ga0075363_100000594 Ga0075363_10000059411 208
243 3300006175 Ga0070712_100376958 Ga0070712_1003769582 208
244 3300006178 Ga0075367_10030393 Ga0075367_100303932 208
245 3300006942 Ga0099824_1017291 Ga0099824_10172918 208
246 3300009545 Ga0105237_10247857 Ga0105237_102478572 208
247 3300010375 Ga0105239_10141549 Ga0105239_101415492 208
248 3300010375 Ga0105239_10353812 Ga0105239_103538122 208
249 3300014325 Ga0163163_10564585 Ga0163163_105645852 208
250 3300014968 Ga0157379_10479509 Ga0157379_104795092 208
251 3300021321 Ga0214542_1000001 Ga0214542_1000001127 208
252 3300021324 Ga0214545_1000001 Ga0214545_1000001194 208
253 3300021324 Ga0214545_1035642 Ga0214545_10356421 208
254 3300021327 Ga0214543_1000006 Ga0214543_1000006191 208
255 3300021327 Ga0214543_1035396 Ga0214543_10353961 208
256 3300025253 Ga0209677_102526 Ga0209677_1025265 208
257 3300025294 Ga0209025_1000182 Ga0209025_100018234 208
258 3300025297 Ga0209758_1005645 Ga0209758_10056453 208
259 3300025297 Ga0209758_1015458 Ga0209758_10154584 208
260 3300025321 Ga0207656_10098118 Ga0207656_100981182 208
261 3300025920 Ga0207649_10090303 Ga0207649_100903032 208
262 3300025928 Ga0207700_10392060 Ga0207700_103920601 208
263 3300025933 Ga0207706_10084396 Ga0207706_100843963 208
264 3300025939 Ga0207665_10174901 Ga0207665_101749012 208
265 3300026089 Ga0207648_10434073 Ga0207648_104340732 208
266 3300026116 Ga0207674_10275122 Ga0207674_102751222 208
267 3300026142 Ga0207698_10627471 Ga0207698_106274712 208
268 3300027296 Ga0209389_1000010 Ga0209389_1000010132 208
269 3300027296 Ga0209389_1000149 Ga0209389_100014956 208
270 3300027357 Ga0209589_1000016 Ga0209589_100001682 208
271 3300027361 Ga0209489_100016 Ga0209489_100016132 208
272 3300027361 Ga0209489_115251 Ga0209489_1152514 208
273 3300027363 Ga0209700_100030 Ga0209700_100030199 208
274 3300027866 Ga0209813_10003592 Ga0209813_100035922 208
275 3300032004 Ga0307414_10101328 Ga0307414_101013282 208
276 3300041410 Ga0439461_0075611 Ga0439461_0075611_107_742 208
277 3300041413 Ga0439465_0071632 Ga0439465_0071632_446_1081 208
278 3300041460 Ga0451802_0568610 Ga0451802_0568610_1009_1635 208
279 3300041486 Ga0451807_0261396 Ga0451807_0261396_537_1163 208
280 3300041997 Ga0439431_0010884 Ga0439431_0010884_1406_2062 208
281 3300044683 Ga0466965_0125801 Ga0466965_0125801_407_1033 208
282 3300044901 Ga0466960_0479868 Ga0466960_0479868_60_686 208
283 3300046492 Ga0495585_0084214 Ga0495585_0084214_535_1161 208
284 3300046500 Ga0495596_0025747 Ga0495596_0025747_325_951 208
285 3300046507 Ga0495606_0166216 Ga0495606_0166216_510_1136 208
286 3300046512 Ga0495610_0159725 Ga0495610_0159725_113_739 208
287 3300046557 Ga0495622_0013964 Ga0495622_0013964_2288_2914 208
288 3300046648 Ga0495611_0293030 Ga0495611_0293030_74_700 208
289 3300046694 Ga0495649_0121671 Ga0495649_0121671_70_708 208
290 3300048907 Ga0496104_0145358 Ga0496104_0145358_709_1335 208
291 3300048907 Ga0496104_0548023 Ga0496104_0548023_205_831 208
292 3300048908 Ga0496105_0151154 Ga0496105_0151154_238_864 208
293 3300048913 Ga0496110_0369494 Ga0496110_0369494_148_774 208
294 3300048915 Ga0496112_0157805 Ga0496112_0157805_189_815 208
295 3300048916 Ga0496113_0125820 Ga0496113_0125820_59_685 208
296 3300048919 Ga0496116_0017721 Ga0496116_0017721_1648_2274 208
297 3300048923 Ga0496120_0081438 Ga0496120_0081438_1099_1725 208
298 3300048924 Ga0496121_0037416 Ga0496121_0037416_3640_4266 208
299 3300048925 Ga0496122_0337383 Ga0496122_0337383_28_654 208
300 3300050490 nmdc:mga03n38_1262_c1 nmdc:mga03n38_1262_c1_5145_5783 208
301 3300050494 nmdc:mga06z11_1557_c1 nmdc:mga06z11_1557_c1_6637_7275 208
302 3300053092 Ga0500583_0161898 Ga0500583_0161898_34_660 208
303 3300053104 Ga0500556_0000220 Ga0500556_0000220_27916_28551 208
304 3300053105 Ga0500557_000009 Ga0500557_000009_37089_37715 208
305 3300053109 Ga0500569_079953 Ga0500569_079953_71_697 208
306 3300053121 Ga0500607_008467 Ga0500607_008467_5594_6220 208
307 3300053122 Ga0500608_109872 Ga0500608_109872_49_675 208
308 3300053123 Ga0500614_003000 Ga0500614_003000_746_1372 208
309 3300053130 Ga0500642_0000126 Ga0500642_0000126_19154_19780 208
310 3300053136 Ga0500559_0187223 Ga0500559_0187223_38_664 208
311 3300053139 Ga0500568_0051937 Ga0500568_0051937_955_1581 208
312 3300053177 Ga0500636_0000172 Ga0500636_0000172_10366_10992 208
313 3300053178 Ga0500637_0111189 Ga0500637_0111189_928_1554 208
314 3300053730 Ga0500645_008424 Ga0500645_008424_1070_1705 208
315 3300002987 JGI25159J45721_1006145 JGI25159J45721_10061454 209
316 3300005262 Ga0065165_1000046 Ga0065165_1000046151 209
317 3300021361 Ga0213872_10016912 Ga0213872_100169122 209
318 3300025284 Ga0209130_1000703 Ga0209130_100070323 209
319 3300025294 Ga0209025_1002211 Ga0209025_100221117 209
320 3300025302 Ga0207426_1004422 Ga0207426_10044222 209
321 3300028573 Ga0265334_10003484 Ga0265334_100034845 209
322 3300028577 Ga0265318_10035924 Ga0265318_100359242 209
323 3300028653 Ga0265323_10002861 Ga0265323_100028616 209
324 3300028666 Ga0265336_10009965 Ga0265336_100099653 209
325 3300028800 Ga0265338_10000176 Ga0265338_1000017645 209
326 3300029957 Ga0265324_10004317 Ga0265324_100043175 209
327 3300031242 Ga0265329_10048669 Ga0265329_100486692 209
328 3300031247 Ga0265340_10003105 Ga0265340_100031052 209
329 3300031249 Ga0265339_10010388 Ga0265339_100103884 209
330 3300031250 Ga0265331_10006941 Ga0265331_100069414 209
331 3300031344 Ga0265316_10076722 Ga0265316_100767223 209
332 3300031711 Ga0265314_10012131 Ga0265314_100121314 209
333 3300031712 Ga0265342_10000031 Ga0265342_1000003186 209
334 3300046524 Ga0495648_0000744 Ga0495648_0000744_19994_20626 209
335 3300048918 Ga0496115_0293994 Ga0496115_0293994_443_1105 209
336 3300048924 Ga0496121_0001674 Ga0496121_0001674_27336_27977 209
337 3300048927 Ga0496124_0350509 Ga0496124_0350509_285_917 209
338 3300048929 Ga0496126_0060603 Ga0496126_0060603_1087_1749 209
339 3300053119 Ga0500595_004763 Ga0500595_004763_1997_2638 209
340 iso_pu_bacteria 2643221736 2644746692 209

Structural Annotation

Top 5 Hits

ID Description Score Start End
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9693 7 203
3b5e-assembly1.cif.gz_A crystal structure of carboxylesterase (np_108484.1) from mesorhizobium loti at 1.75 a resolution 0.94 2 204
3og9-assembly2.cif.gz_B structure of yahd with malic acid 0.9376 7 203
2r8b-assembly2.cif.gz_B the crystal structure of the protein atu2452 of unknown function from agrobacterium tumefaciens str. c58 0.9148 1 203
2h1i-assembly1.cif.gz_A crystal structure of the bacillus cereus carboxylesterase 0.9106 7 203
ID Description Score Start End Superfamily
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9501 9 203 3.40.50.1820
3og9B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9376 7 203 3.40.50.1820
af_Q2FVA9_1_197_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.936 8 202 3.40.50.1820
3b5eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9309 2 204 3.40.50.1820
2h1iC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9265 9 203 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A5D3KR89-F1-model_v4 Alpha/beta hydrolase 0.9981 7 203 GO:0016787
AF-A0A7T7XUR2-F1-model_v4 deleted 0.9981 7 203
AF-A0A1E1UVP9-F1-model_v4 Carboxylesterase (EC 3.1.1.1) 0.9961 7 204 GO:0106435
AF-A0A1B3NFV6-F1-model_v4 Phospholipase/Carboxylesterase family protein 0.9954 7 204
AF-A0A2Z3I490-F1-model_v4 Hydrolase 0.9937 6 204 GO:0016787

Feature Viewer

pLDDT pTM Quality
94.05 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map