F414669

General Info

Members Datasets Scaffolds Average Seq Length
341 237 682 293

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100077421|Ga0068864_1000774212
Length 347
Sequence MSVSFHMINAENPPATAGGTDKSVRSLLAAGCRVAGPREYLYLHQYPKVLNEYKILFMKFGQVENPDEVDFTIPPDHPDTKRILAKSKKQDFKLYVGCAKWNKTDLKNFYPKGVKDELGYYASHFNSVELNATFYKRYWEKQYTAWRDGVPDGFLFFPKLPQGITHFSRLKDVEEKVDQFAENSAFLKEKLGVPFLQMHNNFDPKDFERVESFIEYWKQFDRPIAMEFRKTNWYTDPEIATRLYGLMESNGITNVLVDTAGRRDLMHMRLTTPVPFVRWVGANHSSDKDRLDEWIARIVKWKKAGLSELHFFVHQNVEKESPLLSAYFIEKLNKKIGTKVKVPETLG

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
72 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
73 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
76 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
114 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
115 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
116 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
137 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
152 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
153 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
154 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
155 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
156 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
157 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
158 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
159 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
163 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
164 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
165 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
166 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
167 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
168 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
169 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
170 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
171 2582581278 Chryseobacterium sp. CF365 Isolate Rhizosphere
172 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
173 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
174 2582581873 Chryseobacterium sp. OV259 Isolate Rhizosphere
175 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
176 2585428045 Chryseobacterium sp. OV705 Isolate Rhizosphere
177 2585428060 Chryseobacterium sp. OV715 Isolate Rhizosphere
178 2585428061 Chryseobacterium sp. CF356 Isolate Rhizosphere
179 2585428095 Chryseobacterium sp. YR005 Isolate Rhizosphere
180 2585428115 Chryseobacterium sp. YR561 Isolate Rhizosphere
181 2585428182 Chryseobacterium sp. YR477 Isolate Rhizosphere
182 2585428183 Chryseobacterium sp. YR485 Isolate Rhizosphere
183 2585428184 Chryseobacterium sp. YR480 Isolate Rhizosphere
184 2585428185 Chryseobacterium sp. YR459 Isolate Rhizosphere
185 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
186 2588253712 Chryseobacterium sp. OV279 Isolate Rhizosphere
187 2588254255 Chryseobacterium sp. YR221 Isolate Rhizosphere
188 2588254257 Chryseobacterium sp. YR203 Isolate Rhizosphere
189 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
190 2728369107 Chryseobacterium kwangjuense KJ1R5 Isolate Unclassified
191 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
192 2738541302 Pedobacter sp. CF074 Isolate Unclassified
193 2738543014 Elizabethkingia sp. YR191 Isolate Unclassified
194 2739367651 Pedobacter sp. OK291 Isolate Unclassified
195 2739367656 Pedobacter sp. CF523 Isolate Unclassified
196 2739367663 Pedobacter sp. YR510 Isolate Unclassified
197 2739367874 Chryseobacterium sp. T16E-39 Isolate Unclassified
198 2751185877 Chryseobacterium artocarpi UTM-3 Isolate Rhizosphere
199 2765235839 Chryseobacterium indologenes AA5 Isolate Unclassified
200 2772190705 Chryseobacterium contaminans C-26 Isolate Rhizosphere
201 2775506739 Chryseobacterium sp. 1335 Isolate Unclassified
202 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
203 2818991437 Pedobacter terrae 518 Isolate Unclassified
204 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
205 2842083920 Chryseobacterium lathyri KCTC 22544 Isolate Rhizosphere
206 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
207 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
208 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
209 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
210 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
211 2871720351 Chryseobacterium sp. KLBC 52 Isolate Nodule
212 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
213 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
214 2890737413 Parapedobacter sp. SGR-10 Isolate Rhizosphere
215 2890804823 Fluviicola sp. SGL-29 Isolate Rhizosphere
216 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
217 2896344016 Sphingobacterium sp. SGL-16 Isolate Rhizosphere
218 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
219 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
220 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
221 2905999023 Chryseobacterium elymi KCTC 22547 Isolate Rhizosphere
222 2919097161 Chryseobacterium ginsenosidimutans 1394 Isolate Rhizosphere
223 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
224 2919399522 Chryseobacterium sp. 2987 Isolate Unclassified
225 2919692658 Algoriphagus sp. 4150 Isolate Rhizosphere
226 2945924605 Chryseobacterium ginsenosidimutans W1I9 Isolate Rhizosphere
227 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
228 2946019816 Chryseobacterium sp. W4I1 Isolate Rhizosphere
229 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
230 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
231 2977243572 Chryseobacterium sp. SORGH_AS 447 Isolate Unclassified
232 2984572630 Chryseobacterium sp. SORGH_AS909 Isolate Aerial Root
233 2984606641 Chryseobacterium sp. SORGH_AS1175 Isolate Aerial Root
234 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
235 2993480792 Chryseobacterium nepalense SLBN-92 Isolate Rhizosphere
236 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
237 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.77
Metatranscriptomes 0
Isolates 20.23

Biome Distribution

Category Percentage (%)
Aerial Root 0.59
Bulb 0
Endosphere 5.87
Nodule 0.29
Rhizoplane 1.17
Rhizosphere 78.59
Stem 0
Stem Tuber 0
Unclassified 5.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100077421 3300005618 Unclassified 2908
2 SwRhRL2b_contig_1666933 2162886007 Bacteria 4485
3 JGI24741J21665_1003093 3300001915 Bacteria 4093
4 JGI25152J39213_1001678 3300002773 Bacteria 9167
5 JGI25150J39212_1000030 3300002774 Bacteria 101822
6 JGI25151J46595_10000129 3300003187 Bacteria 101822
7 JGI25153J46596_10000096 3300003215 Bacteria 101822
8 rootH2_10114277 3300003320 Bacteria 5049
9 rootH2_10337061 3300003320 Bacteria 1283
10 rootH1_10004173 3300003323 Bacteria 13878
11 rootH1_10018994 3300003323 Bacteria 8747
12 Ga0055536_1000003 3300003781 Bacteria 447744
13 Ga0055536_1008804 3300003781 Bacteria 4275
14 Ga0055530_10001501 3300003791 Bacteria 16949
15 Ga0065165_1000185 3300005262 Bacteria 108984
16 Ga0065714_10064476 3300005288 Bacteria 57050
17 Ga0065714_10064572 3300005288 Bacteria 33641
18 Ga0065704_10076350 3300005289 Bacteria 5142
19 Ga0065704_10080315 3300005289 Bacteria 3970
20 Ga0065704_10103735 3300005289 Bacteria 2163
21 Ga0065704_10108896 3300005289 Bacteria 2016
22 Ga0065704_10197904 3300005289 Bacteria 1159
23 Ga0065704_10230458 3300005289 Bacteria 1045
24 Ga0065715_10113727 3300005293 Bacteria 2475
25 Ga0065715_10142936 3300005293 Bacteria 1823
26 Ga0070658_10005384 3300005327 Bacteria 10385
27 Ga0070683_100000742 3300005329 Bacteria 23856
28 Ga0070690_100421297 3300005330 Unclassified 984
29 Ga0070670_100021790 3300005331 Bacteria 5510
30 Ga0070670_100266017 3300005331 Bacteria 1495
31 Ga0070677_10160219 3300005333 Bacteria 1055
32 Ga0070682_100000348 3300005337 Bacteria 31623
33 Ga0070689_100308573 3300005340 Bacteria 1319
34 Ga0070661_100026177 3300005344 Bacteria 4193
35 Ga0070675_100247727 3300005354 Unclassified 1558
36 Ga0070671_100121585 3300005355 Unclassified 2197
37 Ga0070671_100278846 3300005355 Bacteria 1421
38 Ga0070673_100096194 3300005364 Bacteria 2430
39 Ga0070659_100150599 3300005366 Bacteria 1898
40 Ga0070667_100010086 3300005367 Bacteria 7819
41 Ga0070663_100061298 3300005455 Unclassified 2709
42 Ga0070678_100250423 3300005456 Bacteria 1485
43 Ga0070681_10098518 3300005458 Bacteria 2869
44 Ga0068867_100348311 3300005459 Bacteria 1235
45 Ga0070685_10003994 3300005466 Bacteria 7452
46 Ga0070684_100000564 3300005535 Bacteria 25534
47 Ga0070686_100119464 3300005544 Bacteria 1808
48 Ga0070704_100148227 3300005549 Bacteria 1841
49 Ga0068855_100339171 3300005563 Bacteria 1658
50 Ga0068855_100363171 3300005563 Unclassified 1593
51 Ga0068855_100675425 3300005563 Bacteria 1107
52 Ga0068857_100022808 3300005577 Bacteria 5507
53 Ga0068857_100584556 3300005577 Unclassified 1054
54 Ga0068854_100021311 3300005578 Bacteria 4396
55 Ga0068852_100017814 3300005616 Bacteria 5583
56 Ga0068852_100167257 3300005616 Bacteria 2058
57 Ga0068852_100716290 3300005616 Bacteria 1011
58 Ga0068859_100012979 3300005617 Bacteria 8371
59 Ga0068859_100075530 3300005617 Bacteria 3410
60 Ga0068859_100326035 3300005617 Bacteria 1629
61 Ga0068864_100078853 3300005618 Bacteria 2883
62 Ga0068864_100260713 3300005618 Bacteria 1612
63 Ga0068851_10145429 3300005834 Bacteria 1292
64 Ga0068863_100419577 3300005841 Bacteria 1311
65 Ga0068858_100079487 3300005842 Bacteria 3047
66 Ga0068858_100515919 3300005842 Bacteria 1155
67 Ga0068862_100023522 3300005844 Bacteria 5163
68 Ga0068862_100060255 3300005844 Bacteria 3260
69 Ga0097621_100083912 3300006237 Bacteria 2655
70 Ga0068871_100013027 3300006358 Bacteria 6162
71 Ga0068871_100148333 3300006358 Bacteria 1999
72 Ga0068865_100124869 3300006881 Bacteria 1919
73 Ga0097620_100075528 3300006931 Bacteria 3410
74 Ga0097620_100326028 3300006931 Bacteria 1629
75 Ga0105244_10000001 3300009036 Bacteria 1034899
76 Ga0105240_10320245 3300009093 Bacteria 1768
77 Ga0105247_10032862 3300009101 Bacteria 3153
78 Ga0105243_10000025 3300009148 Bacteria 193732
79 Ga0105243_10000529 3300009148 Bacteria 38879
80 Ga0105242_10008770 3300009176 Bacteria 7758
81 Ga0105248_10390364 3300009177 Bacteria 1567
82 Ga0105249_10020074 3300009553 Bacteria 5969
83 Ga0105249_10063827 3300009553 Bacteria 3384
84 Ga0105249_10405738 3300009553 Bacteria 1394
85 Ga0105239_10639440 3300010375 Bacteria 1215
86 Ga0157373_10000066 3300013100 Bacteria 92922
87 Ga0157373_10102332 3300013100 Unclassified 2015
88 Ga0157373_10230179 3300013100 Bacteria 1309
89 Ga0157371_10000091 3300013102 Bacteria 144664
90 Ga0157371_10000688 3300013102 Bacteria 39888
91 Ga0157371_10146816 3300013102 Bacteria 1681
92 Ga0157371_10169213 3300013102 Bacteria 1561
93 Ga0157370_10000521 3300013104 Bacteria 48152
94 Ga0157370_10001996 3300013104 Bacteria 25074
95 Ga0157370_10160930 3300013104 Bacteria 2089
96 Ga0157370_10193473 3300013104 Bacteria 1888
97 Ga0157370_10259611 3300013104 Bacteria 1606
98 Ga0157370_10390487 3300013104 Bacteria 1281
99 Ga0157370_10391936 3300013104 Bacteria 1279
100 Ga0157369_10000140 3300013105 Bacteria 102632
101 Ga0157369_10000374 3300013105 Bacteria 59538
102 Ga0157369_10170403 3300013105 Bacteria 2294
103 Ga0157369_10243091 3300013105 Bacteria 1880
104 Ga0157374_10397084 3300013296 Unclassified 1375
105 Ga0157378_10013918 3300013297 Bacteria 7037
106 Ga0157378_10352929 3300013297 Unclassified 1437
107 Ga0163162_10000121 3300013306 Bacteria 69051
108 Ga0163162_10082687 3300013306 Unclassified 3283
109 Ga0163162_10188244 3300013306 Bacteria 2191
110 Ga0163162_10235304 3300013306 Bacteria 1962
111 Ga0163162_10345174 3300013306 Bacteria 1621
112 Ga0157375_10002769 3300013308 Bacteria 15168
113 Ga0157375_10025529 3300013308 Bacteria 5492
114 Ga0157375_10173652 3300013308 Bacteria 2304
115 Ga0157375_10221175 3300013308 Bacteria 2052
116 Ga0157375_10426196 3300013308 Unclassified 1493
117 Ga0163163_10140113 3300014325 Bacteria 2461
118 Ga0163163_10154292 3300014325 Bacteria 2340
119 Ga0157380_10040526 3300014326 Bacteria 3628
120 Ga0157380_10327893 3300014326 Bacteria 1422
121 Ga0182008_10000054 3300014497 Bacteria 102738
122 Ga0182008_10001223 3300014497 Bacteria 17703
123 Ga0157379_10060801 3300014968 Bacteria 3378
124 Ga0157376_10092379 3300014969 Bacteria 2624
125 Ga0182006_1000003 3300015261 Bacteria 826681
126 Ga0182006_1000356 3300015261 Bacteria 38331
127 Ga0182006_1001652 3300015261 Bacteria 13148
128 Ga0182007_10000058 3300015262 Bacteria 89490
129 Ga0183373_1006 3300015682 Bacteria 328276
130 Ga0163161_10000627 3300017792 Bacteria 28166
131 Ga0163161_10004567 3300017792 Bacteria 9642
132 Ga0163161_10005773 3300017792 Bacteria 8579
133 Ga0163161_10043749 3300017792 Bacteria 3225
134 Ga0163161_10100144 3300017792 Bacteria 2156
135 Ga0163161_10122347 3300017792 Bacteria 1956
136 Ga0163161_10246885 3300017792 Bacteria 1390
137 Ga0207425_1000004 3300025245 Bacteria 1092421
138 Ga0209129_1000005 3300025258 Bacteria 777812
139 Ga0209675_1000053 3300025291 Bacteria 194511
140 Ga0209676_1000001 3300025292 Bacteria 1852142
141 Ga0209676_1000810 3300025292 Bacteria 40868
142 Ga0209025_1000009 3300025294 Bacteria 1092561
143 Ga0209758_1000010 3300025297 Bacteria 1092782
144 Ga0209050_1000016 3300025298 Bacteria 729149
145 Ga0207655_1000013 3300025728 Bacteria 637510
146 Ga0207680_10111232 3300025903 Bacteria 1777
147 Ga0207705_10094412 3300025909 Bacteria 2194
148 Ga0207707_10153876 3300025912 Bacteria 2011
149 Ga0207649_10186175 3300025920 Bacteria 1457
150 Ga0207652_10129470 3300025921 Bacteria 2250
151 Ga0207650_10013260 3300025925 Bacteria 5702
152 Ga0207659_10150267 3300025926 Bacteria 1818
153 Ga0207706_10035668 3300025933 Bacteria 4421
154 Ga0207706_10081670 3300025933 Bacteria 2840
155 Ga0207686_10093130 3300025934 Bacteria 1994
156 Ga0207709_10000003 3300025935 Bacteria 1050072
157 Ga0207709_10000737 3300025935 Bacteria 25962
158 Ga0207704_10137360 3300025938 Bacteria 1704
159 Ga0207691_10365756 3300025940 Bacteria 1232
160 Ga0207689_10111162 3300025942 Unclassified 2252
161 Ga0207661_10001225 3300025944 Bacteria 17177
162 Ga0207661_10382093 3300025944 Bacteria 1275
163 Ga0207667_10508089 3300025949 Unclassified 1222
164 Ga0207712_10014145 3300025961 Bacteria 5122
165 Ga0207712_10126653 3300025961 Bacteria 1940
166 Ga0207668_10291845 3300025972 Bacteria 1342
167 Ga0207658_10107955 3300025986 Unclassified 2194
168 Ga0207658_10157693 3300025986 Bacteria 1857
169 Ga0207677_10006378 3300026023 Bacteria 6469
170 Ga0207703_10197862 3300026035 Bacteria 1784
171 Ga0207639_10005514 3300026041 Bacteria 8553
172 Ga0207678_10049608 3300026067 Bacteria 3628
173 Ga0207641_10038548 3300026088 Bacteria 3995
174 Ga0207641_10058195 3300026088 Bacteria 3289
175 Ga0207641_10342595 3300026088 Bacteria 1423
176 Ga0207648_10158908 3300026089 Bacteria 1996
177 Ga0207648_10273942 3300026089 Bacteria 1508
178 Ga0207676_10117782 3300026095 Unclassified 2234
179 Ga0207676_10323024 3300026095 Bacteria 1417
180 Ga0207674_10031233 3300026116 Bacteria 5596
181 Ga0207683_10213416 3300026121 Bacteria 1757
182 Ga0207698_10475286 3300026142 Bacteria 1211
183 Ga0268265_10037861 3300028380 Bacteria 3543
184 Ga0268264_10129689 3300028381 Bacteria 2233
185 Ga0316177_1180877 3300030731 Bacteria 6096
186 Ga0316183_1163276 3300030742 Bacteria 5990
187 Ga0316181_1033811 3300030744 Unclassified 2592
188 Ga0316182_1313746 3300030745 Unclassified 1269
189 Ga0307405_10000028 3300031731 Bacteria 117832
190 Ga0307413_10065278 3300031824 Unclassified 2266
191 Ga0307413_10446192 3300031824 Bacteria 1026
192 Ga0307410_10154165 3300031852 Bacteria 1714
193 Ga0307406_10105808 3300031901 Bacteria 1926
194 Ga0307407_10000023 3300031903 Bacteria 118352
195 Ga0307412_10000032 3300031911 Bacteria 207098
196 Ga0307412_10002860 3300031911 Bacteria 9578
197 Ga0307412_10011218 3300031911 Bacteria 5183
198 Ga0307412_10148136 3300031911 Bacteria 1728
199 Ga0307412_10185742 3300031911 Bacteria 1567
200 Ga0307416_100000017 3300032002 Bacteria 201722
201 Ga0307416_100000049 3300032002 Bacteria 118358
202 Ga0307414_10000010 3300032004 Bacteria 357863
203 Ga0307414_10000153 3300032004 Bacteria 46402
204 Ga0307414_10003190 3300032004 Bacteria 8716
205 Ga0307414_10004268 3300032004 Bacteria 7752
206 Ga0307414_10014511 3300032004 Bacteria 4727
207 Ga0307414_10016980 3300032004 Bacteria 4443
208 Ga0307414_10018776 3300032004 Bacteria 4267
209 Ga0307414_10059430 3300032004 Bacteria 2699
210 Ga0373937_0237498 3300036401 Bacteria 1717
211 Ga0439465_0001275 3300041413 Bacteria 8103
212 Ga0439445_0000002 3300042004 Bacteria 31972
213 Ga0466972_0000046 3300044658 Bacteria 127926
214 Ga0453683_0021161 3300044673 Bacteria 4152
215 Ga0453684_0092898 3300044712 Bacteria 3718
216 Ga0451576_0000389 3300045051 Bacteria 102554
217 Ga0451576_0008105 3300045051 Bacteria 12382
218 Ga0495627_000002 3300046453 Bacteria 903861
219 Ga0495590_0004496 3300046457 Bacteria 5626
220 Ga0495596_0000669 3300046500 Bacteria 21370
221 Ga0495610_0000006 3300046512 Bacteria 856822
222 Ga0495610_0000350 3300046512 Bacteria 48523
223 Ga0495610_0014544 3300046512 Bacteria 4618
224 Ga0495632_0018149 3300046519 Bacteria 3866
225 Ga0495637_0030462 3300046520 Bacteria 2394
226 Ga0495643_0013941 3300046522 Bacteria 4792
227 Ga0495663_0000062 3300046525 Bacteria 50363
228 Ga0495663_0001091 3300046525 Bacteria 8825
229 Ga0495654_0000006 3300046530 Bacteria 451432
230 Ga0495609_0000394 3300046538 Bacteria 36823
231 Ga0495633_0000003 3300046558 Bacteria 472476
232 Ga0495633_0000351 3300046558 Bacteria 50537
233 Ga0495668_0000616 3300046616 Bacteria 43040
234 Ga0495625_0000531 3300046660 Bacteria 56100
235 Ga0495599_0278609 3300046678 Bacteria 1013
236 Ga0495686_0000079 3300047472 Bacteria 202668
237 Ga0496102_0059434 3300048905 Bacteria 3496
238 Ga0496103_0024555 3300048906 Bacteria 3639
239 Ga0496110_0113327 3300048913 Bacteria 2439
240 Ga0496114_0156866 3300048917 Bacteria 1977
241 Ga0496116_0000006 3300048919 Bacteria 811937
242 Ga0496117_0000027 3300048920 Bacteria 412234
243 Ga0496117_0004727 3300048920 Bacteria 14786
244 Ga0496118_0000141 3300048921 Bacteria 126552
245 Ga0496118_0046757 3300048921 Bacteria 3363
246 Ga0496119_0000006 3300048922 Bacteria 505999
247 Ga0496122_0000444 3300048925 Bacteria 86587
248 Ga0496122_0000448 3300048925 Bacteria 86293
249 Ga0496122_0000665 3300048925 Bacteria 69182
250 Ga0496122_0008218 3300048925 Bacteria 11336
251 Ga0496122_0009304 3300048925 Bacteria 10386
252 Ga0496122_0013977 3300048925 Bacteria 7802
253 Ga0496123_0003393 3300048926 Bacteria 17965
254 Ga0496123_0006263 3300048926 Bacteria 11594
255 Ga0496123_0009279 3300048926 Bacteria 8880
256 Ga0496124_0000475 3300048927 Bacteria 69109
257 Ga0496124_0155726 3300048927 Bacteria 1787
258 Ga0496125_0001997 3300048928 Bacteria 27666
259 Ga0496125_0005786 3300048928 Bacteria 13580
260 Ga0496125_0009983 3300048928 Bacteria 9649
261 Ga0496125_0028162 3300048928 Bacteria 5080
262 Ga0496126_0000459 3300048929 Bacteria 81162
263 Ga0496126_0190912 3300048929 Bacteria 1735
264 Ga0501040_0160928 3300049576 Bacteria 1587
265 Ga0501072_0013099 3300049588 Bacteria 6346
266 Ga0501241_000057 3300049758 Bacteria 29165
267 Ga0501269_000038 3300049766 Bacteria 41108
268 Ga0500642_0010889 3300053130 Unclassified 3229
269 Ga0500577_0007560 3300053142 Bacteria 3055
270 Ga0500616_0005962 3300053153 Bacteria 8129
271 Ga0500627_0031005 3300053158 Bacteria 2242
272 Ga0501082_0410601 3300060353 Bacteria 1182
273 2511231750 2511231000 Bacteria 4488346
274 2522552751 2522125168 Bacteria 7376607
275 2585142872 2582581278 Bacteria 5296881
276 2585156188 2582581281 Bacteria 4487904
277 2585160397 2582581282 Bacteria 4495830
278 2585424218 2582581873 Bacteria 3032664
279 2586209471 2585427687 Bacteria 5544917
280 2587678705 2585428045 Bacteria 5203023
281 2587746111 2585428060 Bacteria 5304711
282 2587751499 2585428061 Bacteria 3939663
283 2587865138 2585428095 Bacteria 3789702
284 2587941755 2585428115 Bacteria 4420269
285 2588210262 2585428182 Bacteria 5007281
286 2588214512 2585428183 Bacteria 5166119
287 2588217743 2585428184 Bacteria 4978681
288 2588223043 2585428185 Bacteria 4969476
289 2588232943 2585428187 Bacteria 4629388
290 2588444128 2588253712 Bacteria 5403181
291 2590601493 2588254255 Bacteria 5014294
292 2590609116 2588254257 Bacteria 5436094
293 2722729460 2721755487 Bacteria 6357185
294 2729200014 2728369107 Bacteria 5082720
295 2738701269 2738541273 Bacteria 4048577
296 2738853464 2738541302 Bacteria 5944758
297 2739255567 2738543014 Bacteria 4048139
298 2739591062 2739367651 Bacteria 6359826
299 2739615564 2739367656 Bacteria 5152243
300 2739644791 2739367663 Bacteria 5040914
301 2740059033 2739367874 Bacteria 4872888
302 2753673076 2751185877 Bacteria 4921427
303 2765574165 2765235839 Bacteria 5314748
304 2772607517 2772190705 Bacteria 4666226
305 2775671971 2775506739 Bacteria 3855222
306 2816874383 2816332188 Bacteria 5133218
307 2819548279 2818991437 Bacteria 5805520
308 2833643611 2833640130 Bacteria 4858325
309 2842085952 2842083920 Bacteria 4857652
310 2842723419 2842722452 Bacteria 6263924
311 2842907743 2842903701 Bacteria 6986368
312 2842909914 2842909656 Bacteria 6185908
313 2849285963 2849281842 Bacteria 6065644
314 2857628785 2857627736 Bacteria 5625397
315 2871724060 2871720351 Bacteria 4862476
316 2887378899 2887375801 Bacteria 5334027
317 2889295313 2889290771 Bacteria 5530962
318 2890739427 2890737413 Bacteria 4269751
319 2890806264 2890804823 Bacteria 3717572
320 2896317733 2896317667 Bacteria 4606601
321 2896347376 2896344016 Bacteria 3811746
322 2898715005 2898713307 Bacteria 4110805
323 2904446027 2904445276 Bacteria 5310396
324 2904781120 2904780799 Bacteria 5840761
325 2905999992 2905999023 Bacteria 4591259
326 2919098591 2919097161 Bacteria 3860339
327 2919178722 2919177583 Bacteria 5641607
328 2919403866 2919399522 Bacteria 5164947
329 2919696061 2919692658 Bacteria 5943958
330 2945926034 2945924605 Bacteria 4296724
331 2946000241 2945997725 Bacteria 6404843
332 2946022625 2946019816 Bacteria 4621265
333 2954017143 2954016120 Bacteria 6446024
334 2965323141 2965320100 Bacteria 3975600
335 2977244972 2977243572 Bacteria 4374394
336 2984574880 2984572630 Bacteria 4186940
337 2984608334 2984606641 Bacteria 4186971
338 2993374622 2993372514 Bacteria 4214139
339 2993481504 2993480792 Bacteria 4022225
340 3003236438 3003233435 Bacteria 4458031
341 8055589375 8055588893 Bacteria 3619545
342 Ga0068864_100077421
343 SwRhRL2b_contig_1666933
344 JGI24741J21665_1003093
345 JGI25152J39213_1001678
346 JGI25150J39212_1000030
347 JGI25151J46595_10000129
348 JGI25153J46596_10000096
349 rootH2_10114277
350 rootH2_10337061
351 rootH1_10004173
352 rootH1_10018994
353 Ga0055536_1000003
354 Ga0055536_1008804
355 Ga0055530_10001501
356 Ga0065165_1000185
357 Ga0065714_10064476
358 Ga0065714_10064572
359 Ga0065704_10076350
360 Ga0065704_10080315
361 Ga0065704_10103735
362 Ga0065704_10108896
363 Ga0065704_10197904
364 Ga0065704_10230458
365 Ga0065715_10113727
366 Ga0065715_10142936
367 Ga0070658_10005384
368 Ga0070683_100000742
369 Ga0070690_100421297
370 Ga0070670_100021790
371 Ga0070670_100266017
372 Ga0070677_10160219
373 Ga0070682_100000348
374 Ga0070689_100308573
375 Ga0070661_100026177
376 Ga0070675_100247727
377 Ga0070671_100121585
378 Ga0070671_100278846
379 Ga0070673_100096194
380 Ga0070659_100150599
381 Ga0070667_100010086
382 Ga0070663_100061298
383 Ga0070678_100250423
384 Ga0070681_10098518
385 Ga0068867_100348311
386 Ga0070685_10003994
387 Ga0070684_100000564
388 Ga0070686_100119464
389 Ga0070704_100148227
390 Ga0068855_100339171
391 Ga0068855_100363171
392 Ga0068855_100675425
393 Ga0068857_100022808
394 Ga0068857_100584556
395 Ga0068854_100021311
396 Ga0068852_100017814
397 Ga0068852_100167257
398 Ga0068852_100716290
399 Ga0068859_100012979
400 Ga0068859_100075530
401 Ga0068859_100326035
402 Ga0068864_100078853
403 Ga0068864_100260713
404 Ga0068851_10145429
405 Ga0068863_100419577
406 Ga0068858_100079487
407 Ga0068858_100515919
408 Ga0068862_100023522
409 Ga0068862_100060255
410 Ga0097621_100083912
411 Ga0068871_100013027
412 Ga0068871_100148333
413 Ga0068865_100124869
414 Ga0097620_100075528
415 Ga0097620_100326028
416 Ga0105244_10000001
417 Ga0105240_10320245
418 Ga0105247_10032862
419 Ga0105243_10000025
420 Ga0105243_10000529
421 Ga0105242_10008770
422 Ga0105248_10390364
423 Ga0105249_10020074
424 Ga0105249_10063827
425 Ga0105249_10405738
426 Ga0105239_10639440
427 Ga0157373_10000066
428 Ga0157373_10102332
429 Ga0157373_10230179
430 Ga0157371_10000091
431 Ga0157371_10000688
432 Ga0157371_10146816
433 Ga0157371_10169213
434 Ga0157370_10000521
435 Ga0157370_10001996
436 Ga0157370_10160930
437 Ga0157370_10193473
438 Ga0157370_10259611
439 Ga0157370_10390487
440 Ga0157370_10391936
441 Ga0157369_10000140
442 Ga0157369_10000374
443 Ga0157369_10170403
444 Ga0157369_10243091
445 Ga0157374_10397084
446 Ga0157378_10013918
447 Ga0157378_10352929
448 Ga0163162_10000121
449 Ga0163162_10082687
450 Ga0163162_10188244
451 Ga0163162_10235304
452 Ga0163162_10345174
453 Ga0157375_10002769
454 Ga0157375_10025529
455 Ga0157375_10173652
456 Ga0157375_10221175
457 Ga0157375_10426196
458 Ga0163163_10140113
459 Ga0163163_10154292
460 Ga0157380_10040526
461 Ga0157380_10327893
462 Ga0182008_10000054
463 Ga0182008_10001223
464 Ga0157379_10060801
465 Ga0157376_10092379
466 Ga0182006_1000003
467 Ga0182006_1000356
468 Ga0182006_1001652
469 Ga0182007_10000058
470 Ga0183373_1006
471 Ga0163161_10000627
472 Ga0163161_10004567
473 Ga0163161_10005773
474 Ga0163161_10043749
475 Ga0163161_10100144
476 Ga0163161_10122347
477 Ga0163161_10246885
478 Ga0207425_1000004
479 Ga0209129_1000005
480 Ga0209675_1000053
481 Ga0209676_1000001
482 Ga0209676_1000810
483 Ga0209025_1000009
484 Ga0209758_1000010
485 Ga0209050_1000016
486 Ga0207655_1000013
487 Ga0207680_10111232
488 Ga0207705_10094412
489 Ga0207707_10153876
490 Ga0207649_10186175
491 Ga0207652_10129470
492 Ga0207650_10013260
493 Ga0207659_10150267
494 Ga0207706_10035668
495 Ga0207706_10081670
496 Ga0207686_10093130
497 Ga0207709_10000003
498 Ga0207709_10000737
499 Ga0207704_10137360
500 Ga0207691_10365756
501 Ga0207689_10111162
502 Ga0207661_10001225
503 Ga0207661_10382093
504 Ga0207667_10508089
505 Ga0207712_10014145
506 Ga0207712_10126653
507 Ga0207668_10291845
508 Ga0207658_10107955
509 Ga0207658_10157693
510 Ga0207677_10006378
511 Ga0207703_10197862
512 Ga0207639_10005514
513 Ga0207678_10049608
514 Ga0207641_10038548
515 Ga0207641_10058195
516 Ga0207641_10342595
517 Ga0207648_10158908
518 Ga0207648_10273942
519 Ga0207676_10117782
520 Ga0207676_10323024
521 Ga0207674_10031233
522 Ga0207683_10213416
523 Ga0207698_10475286
524 Ga0268265_10037861
525 Ga0268264_10129689
526 Ga0316177_1180877
527 Ga0316183_1163276
528 Ga0316181_1033811
529 Ga0316182_1313746
530 Ga0307405_10000028
531 Ga0307413_10065278
532 Ga0307413_10446192
533 Ga0307410_10154165
534 Ga0307406_10105808
535 Ga0307407_10000023
536 Ga0307412_10000032
537 Ga0307412_10002860
538 Ga0307412_10011218
539 Ga0307412_10148136
540 Ga0307412_10185742
541 Ga0307416_100000017
542 Ga0307416_100000049
543 Ga0307414_10000010
544 Ga0307414_10000153
545 Ga0307414_10003190
546 Ga0307414_10004268
547 Ga0307414_10014511
548 Ga0307414_10016980
549 Ga0307414_10018776
550 Ga0307414_10059430
551 Ga0373937_0237498
552 Ga0439465_0001275
553 Ga0439445_0000002
554 Ga0466972_0000046
555 Ga0453683_0021161
556 Ga0453684_0092898
557 Ga0451576_0000389
558 Ga0451576_0008105
559 Ga0495627_000002
560 Ga0495590_0004496
561 Ga0495596_0000669
562 Ga0495610_0000006
563 Ga0495610_0000350
564 Ga0495610_0014544
565 Ga0495632_0018149
566 Ga0495637_0030462
567 Ga0495643_0013941
568 Ga0495663_0000062
569 Ga0495663_0001091
570 Ga0495654_0000006
571 Ga0495609_0000394
572 Ga0495633_0000003
573 Ga0495633_0000351
574 Ga0495668_0000616
575 Ga0495625_0000531
576 Ga0495599_0278609
577 Ga0495686_0000079
578 Ga0496102_0059434
579 Ga0496103_0024555
580 Ga0496110_0113327
581 Ga0496114_0156866
582 Ga0496116_0000006
583 Ga0496117_0000027
584 Ga0496117_0004727
585 Ga0496118_0000141
586 Ga0496118_0046757
587 Ga0496119_0000006
588 Ga0496122_0000444
589 Ga0496122_0000448
590 Ga0496122_0000665
591 Ga0496122_0008218
592 Ga0496122_0009304
593 Ga0496122_0013977
594 Ga0496123_0003393
595 Ga0496123_0006263
596 Ga0496123_0009279
597 Ga0496124_0000475
598 Ga0496124_0155726
599 Ga0496125_0001997
600 Ga0496125_0005786
601 Ga0496125_0009983
602 Ga0496125_0028162
603 Ga0496126_0000459
604 Ga0496126_0190912
605 Ga0501040_0160928
606 Ga0501072_0013099
607 Ga0501241_000057
608 Ga0501269_000038
609 Ga0500642_0010889
610 Ga0500577_0007560
611 Ga0500616_0005962
612 Ga0500627_0031005
613 Ga0501082_0410601
614 2511231750
615 2522552751
616 2585142872
617 2585156188
618 2585160397
619 2585424218
620 2586209471
621 2587678705
622 2587746111
623 2587751499
624 2587865138
625 2587941755
626 2588210262
627 2588214512
628 2588217743
629 2588223043
630 2588232943
631 2588444128
632 2590601493
633 2590609116
634 2722729460
635 2729200014
636 2738701269
637 2738853464
638 2739255567
639 2739591062
640 2739615564
641 2739644791
642 2740059033
643 2753673076
644 2765574165
645 2772607517
646 2775671971
647 2816874383
648 2819548279
649 2833643611
650 2842085952
651 2842723419
652 2842907743
653 2842909914
654 2849285963
655 2857628785
656 2871724060
657 2887378899
658 2889295313
659 2890739427
660 2890806264
661 2896317733
662 2896347376
663 2898715005
664 2904446027
665 2904781120
666 2905999992
667 2919098591
668 2919178722
669 2919403866
670 2919696061
671 2945926034
672 2946000241
673 2946022625
674 2954017143
675 2965323141
676 2977244972
677 2984574880
678 2984608334
679 2993374622
680 2993481504
681 3003236438
682 8055589375

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01904

DUF72

Protein of unknown function DUF72

110

331

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7958 37 276
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7706 35 282
1vpy-assembly1.cif.gz_A crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 2.52 a resolution 0.7593 35 282
1ztv-assembly1.cif.gz_B crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 a resolution 0.7459 38 292
1vpq-assembly1.cif.gz_A crystal structure of a duf72 family protein (tm1631) from thermotoga maritima msb8 at 2.20 a resolution 0.7368 37 276
ID Description Score Start End Superfamily
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8793 38 282 3.20.20.410
af_P37348_1_259_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8308 38 282 3.20.20.410
af_Q4E4B4_140_369_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.8161 98 280 3.20.20.410
1vpqA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7958 37 276 3.20.20.410
af_Q2FZX7_1_282_3.20.20.410 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Protein of unknown function UPF0759 0.7719 38 295 3.20.20.410
ID Description Score Start End GO Terms
AF-L0G006-F1-model_v4 DUF72 domain-containing protein 0.9903 1 288
AF-L0G006-F1-model_v4 DUF72 domain-containing protein 0.9869 1 288
AF-A0A4Q3AWH2-F1-model_v4 DUF72 domain-containing protein 0.9828 1 257
AF-A0A519SFL5-F1-model_v4 Txe/YoeB family addiction module toxin 0.981 1 261 GO:0004519
GO:0006401
AF-A0A4Q3AX90-F1-model_v4 DUF72 domain-containing protein 0.9796 1 221

Map