F414745

General Info

Members Datasets Scaffolds Average Seq Length
341 219 684 167

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10565969|Ga0157369_105659691
Length 199
Sequence LQIAELKVRVQPLGKLWETRFNQPDTALSTIKNKKMNTNLPFDFNVDKTTKTVFIDMEFAAGLPLVWDAFTKPEILDQWYAPKPWVSKTKFMDFKVGGRRFYAMVSPEGEERWSVQKYTSISPKTNFKMYNAFADKDENPELPGSDWDLNFREQNGKTKVSITIFNESLERLEKLIDGFKIGMAMTYENLTGLLATLQK

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
136 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
137 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
166 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
179 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
180 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
184 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
187 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
205 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
209 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
210 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
211 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
215 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
216 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
217 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
218 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
219 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.4
Nodule 0
Rhizoplane 1.47
Rhizosphere 87.98
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10565969 3300013105 Bacteria 1174
2 JGI24737J22298_10006576 3300001990 Bacteria 3962
3 JGI24735J21928_10000020 3300002067 Bacteria 108706
4 JGI24744J21845_10077118 3300002077 Bacteria 609
5 JGI25164J39214_1001373 3300002772 Bacteria 5852
6 JGI25406J46586_10003469 3300003203 Bacteria 7412
7 JGI25165J46597_1000746 3300003214 Bacteria 25080
8 rootH1_10005676 3300003316 Bacteria 11468
9 rootH1_10005676 3300003323 Bacteria 4854
10 rootH2_10183880 3300003320 Bacteria 1447
11 rootH2_10214899 3300003320 Bacteria 1307
12 rootH2_10270138 3300003320 Bacteria 1003
13 rootL2_10000502 3300003322 Bacteria 11249
14 rootH1_10006920 3300003323 Bacteria 63684
15 rootH1_10007354 3300003323 Bacteria 13643
16 rootH1_10054911 3300003316 Bacteria 39663
17 rootH1_10054911 3300003323 Unclassified 4728
18 rootH1_10190191 3300003323 Bacteria 1840
19 Ga0065714_10349821 3300005288 Bacteria 636
20 Ga0065712_10401276 3300005290 Bacteria 730
21 Ga0065707_10259726 3300005295 Bacteria 1101
22 Ga0065707_10312054 3300005295 Unclassified 944
23 Ga0070658_10180733 3300005327 Bacteria 1775
24 Ga0070658_10498722 3300005327 Bacteria 1051
25 Ga0070658_11204128 3300005327 Bacteria 658
26 Ga0070683_100002245 3300005329 Bacteria 15321
27 Ga0070670_100369117 3300005331 Bacteria 1263
28 Ga0070670_100715293 3300005331 Bacteria 901
29 Ga0068869_100088161 3300005334 Bacteria 2329
30 Ga0068868_100099276 3300005338 Bacteria 2355
31 Ga0070660_100071789 3300005339 Bacteria 2704
32 Ga0070660_101026264 3300005339 Bacteria 697
33 Ga0070669_100328125 3300005353 Bacteria 1237
34 Ga0070671_100240212 3300005355 Bacteria 1538
35 Ga0070688_100659088 3300005365 Bacteria 807
36 Ga0070659_100228061 3300005366 Bacteria 1539
37 Ga0070659_100313763 3300005366 Bacteria 1310
38 Ga0070667_100208889 3300005367 Bacteria 1735
39 Ga0070714_100043948 3300005435 Bacteria 3781
40 Ga0070713_100263477 3300005436 Bacteria 1576
41 Ga0070694_100394762 3300005444 Bacteria 1082
42 Ga0070678_100332042 3300005456 Bacteria 1302
43 Ga0070678_101353289 3300005456 Bacteria 664
44 Ga0070662_100097236 3300005457 Bacteria 2222
45 Ga0070662_100365309 3300005457 Bacteria 1185
46 Ga0070681_10107091 3300005458 Bacteria 2737
47 Ga0070685_11028793 3300005466 Bacteria 619
48 Ga0070699_100040805 3300005518 Bacteria 4017
49 Ga0070679_100003480 3300005530 Bacteria 14416
50 Ga0070679_100004542 3300005530 Bacteria 12815
51 Ga0070679_100201769 3300005530 Bacteria 1954
52 Ga0070679_100254591 3300005530 Bacteria 1711
53 Ga0070679_100403093 3300005530 Bacteria 1313
54 Ga0070684_100077236 3300005535 Bacteria 2940
55 Ga0070684_100303159 3300005535 Bacteria 1466
56 Ga0068853_100032797 3300005539 Bacteria 4402
57 Ga0068853_100203329 3300005539 Bacteria 1803
58 Ga0070686_100989713 3300005544 Unclassified 689
59 Ga0070665_100000189 3300005548 Bacteria 109948
60 Ga0070665_100284694 3300005548 Bacteria 1655
61 Ga0068855_100310867 3300005563 Bacteria 1743
62 Ga0068855_100347779 3300005563 Bacteria 1633
63 Ga0068855_100929852 3300005563 Bacteria 917
64 Ga0070664_100185361 3300005564 Bacteria 1852
65 Ga0070664_100514204 3300005564 Bacteria 1105
66 Ga0068857_100743235 3300005577 Unclassified 934
67 Ga0068857_101046204 3300005577 Bacteria 787
68 Ga0068856_100009832 3300005614 Bacteria 9290
69 Ga0068856_100572217 3300005614 Bacteria 1151
70 Ga0068852_100294758 3300005616 Bacteria 1568
71 Ga0068859_100419285 3300005617 Bacteria 1435
72 Ga0068859_100627009 3300005617 Bacteria 1168
73 Ga0068859_101080738 3300005617 Bacteria 882
74 Ga0068859_101262830 3300005617 Bacteria 814
75 Ga0068864_100155456 3300005618 Bacteria 2075
76 Ga0068864_100273181 3300005618 Bacteria 1575
77 Ga0068866_10238694 3300005718 Bacteria 1106
78 Ga0068861_100855314 3300005719 Bacteria 858
79 Ga0068861_101718392 3300005719 Bacteria 621
80 Ga0068851_10069921 3300005834 Bacteria 1814
81 Ga0068863_101054170 3300005841 Bacteria 817
82 Ga0068858_100133390 3300005842 Bacteria 2329
83 Ga0068860_100117855 3300005843 Bacteria 2541
84 Ga0068860_100302375 3300005843 Bacteria 1567
85 Ga0068860_100348955 3300005843 Bacteria 1456
86 Ga0068862_100012364 3300005844 Bacteria 7057
87 Ga0068862_100379661 3300005844 Bacteria 1318
88 Ga0081539_10000345 3300005985 Bacteria 102083
89 Ga0081539_10024565 3300005985 Bacteria 3905
90 Ga0070716_100233449 3300006173 Bacteria 1243
91 Ga0070712_100287970 3300006175 Unclassified 1325
92 Ga0075366_10072453 3300006195 Bacteria 2053
93 Ga0097621_100096733 3300006237 Bacteria 2478
94 Ga0068871_100134878 3300006358 Bacteria 2096
95 Ga0068871_100678279 3300006358 Bacteria 943
96 Ga0068871_100719744 3300006358 Bacteria 915
97 Ga0075428_100090426 3300006844 Bacteria 3339
98 Ga0075430_100358645 3300006846 Bacteria 1204
99 Ga0075433_10035336 3300006852 Bacteria 4297
100 Ga0075434_100129223 3300006871 Bacteria 2544
101 Ga0075429_100010254 3300006880 Bacteria 8110
102 Ga0097620_100028040 3300006931 Bacteria 5647
103 Ga0097620_100419281 3300006931 Bacteria 1435
104 Ga0097620_100627035 3300006931 Bacteria 1168
105 Ga0097620_101080885 3300006931 Bacteria 882
106 Ga0097620_101262886 3300006931 Bacteria 814
107 Ga0105251_10137456 3300009011 Bacteria 1106
108 Ga0105240_10001492 3300009093 Bacteria 39866
109 Ga0105240_10142389 3300009093 Bacteria 2865
110 Ga0111539_10114832 3300009094 Bacteria 3158
111 Ga0114129_12749761 3300009147 Bacteria 586
112 Ga0105241_10160652 3300009174 Bacteria 1847
113 Ga0105241_10175759 3300009174 Bacteria 1772
114 Ga0105241_10230152 3300009174 Bacteria 1562
115 Ga0105237_10022652 3300009545 Bacteria 6443
116 Ga0105237_11322971 3300009545 Unclassified 727
117 Ga0105249_10061509 3300009553 Bacteria 3446
118 Ga0105249_11103461 3300009553 Bacteria 863
119 Ga0105249_11333019 3300009553 Bacteria 789
120 Ga0105239_10014883 3300010375 Bacteria 8624
121 Ga0105239_10253289 3300010375 Bacteria 1978
122 Ga0105239_10377418 3300010375 Bacteria 1603
123 Ga0105246_10135865 3300011119 Bacteria 1843
124 Ga0105246_11218745 3300011119 Bacteria 693
125 Ga0157373_10017176 3300013100 Bacteria 5268
126 Ga0157373_10088831 3300013100 Bacteria 2177
127 Ga0157373_10314969 3300013100 Bacteria 1112
128 Ga0157371_10006464 3300013102 Bacteria 9664
129 Ga0157371_10015752 3300013102 Bacteria 5659
130 Ga0157371_10028244 3300013102 Bacteria 4063
131 Ga0157371_10037264 3300013102 Bacteria 3481
132 Ga0157371_10043962 3300013102 Bacteria 3182
133 Ga0157371_10049410 3300013102 Bacteria 2988
134 Ga0157371_10052466 3300013102 Bacteria 2896
135 Ga0157371_10092153 3300013102 Bacteria 2146
136 Ga0157370_10040347 3300013104 Bacteria 4507
137 Ga0157370_10419823 3300013104 Bacteria 1230
138 Ga0157369_10078667 3300013105 Bacteria 3532
139 Ga0157369_10272371 3300013105 Bacteria 1764
140 Ga0157369_10288328 3300013105 Bacteria 1709
141 Ga0157374_10026673 3300013296 Bacteria 5201
142 Ga0157374_11245376 3300013296 Bacteria 766
143 Ga0157378_10216540 3300013297 Bacteria 1819
144 Ga0157378_10427875 3300013297 Bacteria 1310
145 Ga0157378_10625366 3300013297 Bacteria 1090
146 Ga0163162_10002594 3300013306 Bacteria 17124
147 Ga0163162_10377136 3300013306 Bacteria 1551
148 Ga0157372_10002608 3300013307 Bacteria 19498
149 Ga0157372_10003873 3300013307 Bacteria 16080
150 Ga0157372_10020154 3300013307 Bacteria 7189
151 Ga0157372_10136169 3300013307 Bacteria 2828
152 Ga0157372_10164838 3300013307 Bacteria 2562
153 Ga0157372_10173396 3300013307 Bacteria 2495
154 Ga0157372_10185131 3300013307 Bacteria 2412
155 Ga0157372_10186077 3300013307 Bacteria 2405
156 Ga0157372_10290033 3300013307 Bacteria 1903
157 Ga0157372_10358670 3300013307 Bacteria 1699
158 Ga0157372_10841362 3300013307 Bacteria 1065
159 Ga0163163_10059128 3300014325 Bacteria 3790
160 Ga0163163_10953310 3300014325 Bacteria 921
161 Ga0157380_10000088 3300014326 Bacteria 50565
162 Ga0182008_10686945 3300014497 Bacteria 583
163 Ga0157379_10014233 3300014968 Bacteria 6978
164 Ga0157376_10161295 3300014969 Bacteria 2033
165 Ga0157376_10184649 3300014969 Bacteria 1908
166 Ga0163161_10298659 3300017792 Bacteria 1268
167 Ga0213876_10001274 3300021384 Bacteria 15905
168 Ga0207427_100113 3300025231 Bacteria 107320
169 Ga0209437_100010 3300025233 Bacteria 838447
170 Ga0209233_1000017 3300025261 Bacteria 898076
171 Ga0207656_10014230 3300025321 Bacteria 3060
172 Ga0207642_10094957 3300025899 Bacteria 1483
173 Ga0207688_10425502 3300025901 Bacteria 826
174 Ga0207647_10319504 3300025904 Bacteria 882
175 Ga0207645_10123986 3300025907 Bacteria 1679
176 Ga0207643_10256741 3300025908 Bacteria 1078
177 Ga0207705_10139578 3300025909 Bacteria 1809
178 Ga0207654_10079628 3300025911 Bacteria 1968
179 Ga0207654_10164172 3300025911 Bacteria 1437
180 Ga0207707_11093360 3300025912 Bacteria 650
181 Ga0207695_10000645 3300025913 Bacteria 69294
182 Ga0207695_10068845 3300025913 Bacteria 3625
183 Ga0207671_10189718 3300025914 Bacteria 1602
184 Ga0207660_10140087 3300025917 Bacteria 1849
185 Ga0207660_10215998 3300025917 Bacteria 1503
186 Ga0207652_10000165 3300025921 Bacteria 71341
187 Ga0207652_10002803 3300025921 Bacteria 14626
188 Ga0207652_10108733 3300025921 Bacteria 2457
189 Ga0207646_10120519 3300025922 Bacteria 2357
190 Ga0207681_10217168 3300025923 Bacteria 1477
191 Ga0207650_10322882 3300025925 Bacteria 1265
192 Ga0207664_10038397 3300025929 Bacteria 3713
193 Ga0207644_10370735 3300025931 Bacteria 1166
194 Ga0207690_10098870 3300025932 Bacteria 2079
195 Ga0207706_10091448 3300025933 Bacteria 2675
196 Ga0207706_10299480 3300025933 Bacteria 1401
197 Ga0207670_10054938 3300025936 Bacteria 2689
198 Ga0207669_10700156 3300025937 Bacteria 833
199 Ga0207665_10975878 3300025939 Bacteria 673
200 Ga0207689_10036473 3300025942 Bacteria 4081
201 Ga0207689_10067625 3300025942 Bacteria 2936
202 Ga0207689_10851061 3300025942 Bacteria 770
203 Ga0207679_10034651 3300025945 Bacteria 3564
204 Ga0207667_10001334 3300025949 Bacteria 30950
205 Ga0207667_10105071 3300025949 Bacteria 2913
206 Ga0207667_10264047 3300025949 Bacteria 1760
207 Ga0207667_10984807 3300025949 Bacteria 831
208 Ga0207667_11245806 3300025949 Bacteria 722
209 Ga0207651_10409034 3300025960 Bacteria 1156
210 Ga0207712_10292827 3300025961 Bacteria 1333
211 Ga0207640_10036900 3300025981 Bacteria 3071
212 Ga0207639_10165413 3300026041 Bacteria 1868
213 Ga0207641_10436798 3300026088 Bacteria 1263
214 Ga0207648_10023353 3300026089 Bacteria 5542
215 Ga0207648_11469140 3300026089 Bacteria 641
216 Ga0207676_10120505 3300026095 Bacteria 2211
217 Ga0207676_10124644 3300026095 Bacteria 2179
218 Ga0207674_10255475 3300026116 Bacteria 1699
219 Ga0207675_100567887 3300026118 Bacteria 1135
220 Ga0207675_100743650 3300026118 Bacteria 992
221 Ga0207683_10553488 3300026121 Bacteria 1064
222 Ga0207698_10251155 3300026142 Bacteria 1618
223 Ga0210000_1010395 3300027462 Bacteria 1377
224 Ga0207428_10018846 3300027907 Bacteria 5888
225 Ga0268266_10000180 3300028379 Bacteria 112295
226 Ga0268266_10080290 3300028379 Bacteria 2842
227 Ga0268265_10265066 3300028380 Bacteria 1529
228 Ga0268265_10787533 3300028380 Bacteria 926
229 Ga0268264_10043119 3300028381 Bacteria 3737
230 Ga0268264_10090310 3300028381 Bacteria 2640
231 Ga0268264_10631199 3300028381 Bacteria 1059
232 Ga0307515_10000147 3300028794 Bacteria 170482
233 Ga0265338_10065943 3300028800 Bacteria 3137
234 Ga0316183_1062078 3300030742 Bacteria 40689
235 Ga0316181_1054941 3300030744 Bacteria 49722
236 Ga0316182_1005709 3300030745 Bacteria 3340
237 Ga0307509_10590999 3300031507 Bacteria 784
238 Ga0307514_10209425 3300031649 Bacteria 1213
239 Ga0307516_10199286 3300031730 Bacteria 1723
240 Ga0307405_10011842 3300031731 Bacteria 4591
241 Ga0307405_10584329 3300031731 Bacteria 909
242 Ga0307410_10156140 3300031852 Bacteria 1704
243 Ga0307412_10202594 3300031911 Bacteria 1508
244 Ga0307416_100019419 3300032002 Bacteria 4818
245 Ga0307414_10038452 3300032004 Bacteria 3214
246 Ga0307414_10571972 3300032004 Bacteria 1010
247 Ga0307411_10206282 3300032005 Bacteria 1514
248 Ga0307411_10789691 3300032005 Bacteria 835
249 Ga0307415_100646417 3300032126 Bacteria 947
250 Ga0373934_0335543 3300035086 Bacteria 629
251 Ga0373952_0043020 3300035092 Bacteria 1051
252 Ga0373927_1017561 3300035695 Bacteria 547
253 Ga0395899_0078262 3300037312 Bacteria 2410
254 Ga0395899_0163637 3300037312 Bacteria 1570
255 Ga0395899_0195683 3300037312 Bacteria 1412
256 Ga0395899_0396395 3300037312 Bacteria 914
257 Ga0395900_0006360 3300037418 Bacteria 12314
258 Ga0395900_0008764 3300037418 Bacteria 10392
259 Ga0395900_0021857 3300037418 Bacteria 6541
260 Ga0395900_0033220 3300037418 Bacteria 5311
261 Ga0395900_0076902 3300037418 Bacteria 3429
262 Ga0395900_0089985 3300037418 Bacteria 3155
263 Ga0395900_0445693 3300037418 Bacteria 1251
264 Ga0395898_0361277 3300037466 Bacteria 1384
265 Ga0395905_0000051 3300037471 Bacteria 223416
266 Ga0395905_0003216 3300037471 Bacteria 17578
267 Ga0395905_0137460 3300037471 Bacteria 2299
268 Ga0395901_0057882 3300038443 Bacteria 4031
269 Ga0395901_0244407 3300038443 Bacteria 1871
270 Ga0395901_0489258 3300038443 Bacteria 1254
271 Ga0436365_0004784 3300039437 Bacteria 42373
272 Ga0439461_0162346 3300041410 Bacteria 583
273 Ga0451793_0865712 3300041452 Bacteria 742
274 Ga0451807_2030209 3300041486 Bacteria 622
275 Ga0451837_1368878 3300041494 Bacteria 844
276 Ga0451837_1723033 3300041494 Bacteria 822
277 Ga0451853_2837711 3300041512 Bacteria 1483
278 Ga0439441_014230 3300042001 Bacteria 1392
279 Ga0439446_0094203 3300042156 Bacteria 941
280 Ga0453684_0650620 3300044712 Bacteria 1150
281 Ga0495592_0245615 3300046454 Bacteria 1186
282 Ga0495638_0027579 3300046460 Bacteria 3675
283 Ga0495651_0044057 3300046462 Bacteria 3459
284 Ga0495606_0000009 3300046507 Bacteria 306313
285 Ga0495628_0617243 3300046516 Bacteria 773
286 Ga0495630_0100432 3300046517 Bacteria 2189
287 Ga0495630_0111824 3300046517 Bacteria 2069
288 Ga0495632_0001589 3300046519 Bacteria 18738
289 Ga0495637_0039804 3300046520 Bacteria 2026
290 Ga0495648_0013159 3300046524 Bacteria 6133
291 Ga0495648_0314307 3300046524 Bacteria 729
292 Ga0495652_0090643 3300046529 Unclassified 2501
293 Ga0495586_0590028 3300046535 Bacteria 642
294 Ga0495633_0001092 3300046558 Bacteria 21904
295 Ga0495633_0070917 3300046558 Bacteria 1626
296 Ga0495668_0064879 3300046616 Bacteria 2010
297 Ga0495634_0289586 3300046642 Bacteria 993
298 Ga0495611_0000342 3300046648 Bacteria 30350
299 Ga0495636_0148052 3300047318 Bacteria 1052
300 Ga0495687_000004 3300047443 Bacteria 779298
301 Ga0495677_0097257 3300047445 Bacteria 1112
302 Ga0495685_019206 3300047447 Bacteria 2348
303 Ga0496104_0673381 3300048907 Bacteria 943
304 Ga0496111_0419116 3300048914 Bacteria 989
305 Ga0501300_000387 3300049523 Bacteria 6753
306 Ga0501033_0197730 3300049570 Bacteria 1437
307 Ga0501034_0004094 3300049571 Bacteria 16364
308 Ga0501036_0252806 3300049572 Bacteria 1477
309 Ga0501046_0201752 3300049580 Bacteria 1480
310 Ga0501046_0793139 3300049580 Bacteria 664
311 Ga0501067_0026278 3300049583 Bacteria 3226
312 Ga0501069_0099590 3300049585 Bacteria 1649
313 Ga0501070_0099992 3300049586 Bacteria 2399
314 Ga0501073_0071855 3300049589 Bacteria 2410
315 Ga0501080_0097892 3300049742 Bacteria 2723
316 Ga0501083_0013685 3300049744 Bacteria 5674
317 Ga0501044_0361163 3300049823 Bacteria 1370
318 Ga0501044_0964896 3300049823 Bacteria 725
319 Ga0501044_1161898 3300049823 Bacteria 640
320 nmdc:mga0k408_79245_c1 3300050493 Bacteria 1922
321 nmdc:mga09592_8533_c1 3300050508 Bacteria 8335
322 nmdc:mga0qj67_447389_c1 3300050509 Bacteria 1041
323 nmdc:mga08y16_22888_c1 3300050511 Bacteria 6595
324 nmdc:mga08y16_280585_c1 3300050511 Bacteria 1718
325 nmdc:mga0n895_27381_c1 3300050512 Bacteria 5415
326 nmdc:mga0a205_207940_c1 3300050515 Bacteria 1846
327 nmdc:mga0a205_623981_c1 3300050515 Bacteria 930
328 Ga0500583_0066639 3300053092 Bacteria 1713
329 Ga0500562_161132 3300053108 Bacteria 610
330 Ga0500618_009529 3300053125 Bacteria 2647
331 Ga0500642_0106620 3300053130 Bacteria 1306
332 Ga0500655_067442 3300053133 Bacteria 726
333 Ga0500604_0006993 3300053151 Bacteria 2987
334 Ga0500622_0000062 3300053156 Bacteria 130392
335 Ga0500637_0025844 3300053178 Bacteria 3230
336 Ga0501084_0084383 3300054114 Bacteria 2666
337 Ga0501082_0465015 3300060353 Bacteria 1105
338 2599481294 2599185184 Bacteria 6430550
339 2896113911 2896109856 Bacteria 7140722
340 2928081892 2928078545 Bacteria 6534839
341 2928151914 2928147474 Bacteria 6512076
342 2929244466 2929239360 Bacteria 7745570
343 2932087222 2932082852 Bacteria 6563563
344 Ga0157369_10565969
345 JGI24737J22298_10006576
346 JGI24735J21928_10000020
347 JGI24744J21845_10077118
348 JGI25164J39214_1001373
349 JGI25406J46586_10003469
350 JGI25165J46597_1000746
351 rootH1_10005676
352 rootH2_10183880
353 rootH2_10214899
354 rootH2_10270138
355 rootL2_10000502
356 rootH1_10006920
357 rootH1_10007354
358 rootH1_10054911
359 rootH1_10190191
360 Ga0065714_10349821
361 Ga0065712_10401276
362 Ga0065707_10259726
363 Ga0065707_10312054
364 Ga0070658_10180733
365 Ga0070658_10498722
366 Ga0070658_11204128
367 Ga0070683_100002245
368 Ga0070670_100369117
369 Ga0070670_100715293
370 Ga0068869_100088161
371 Ga0068868_100099276
372 Ga0070660_100071789
373 Ga0070660_101026264
374 Ga0070669_100328125
375 Ga0070671_100240212
376 Ga0070688_100659088
377 Ga0070659_100228061
378 Ga0070659_100313763
379 Ga0070667_100208889
380 Ga0070714_100043948
381 Ga0070713_100263477
382 Ga0070694_100394762
383 Ga0070678_100332042
384 Ga0070678_101353289
385 Ga0070662_100097236
386 Ga0070662_100365309
387 Ga0070681_10107091
388 Ga0070685_11028793
389 Ga0070699_100040805
390 Ga0070679_100003480
391 Ga0070679_100004542
392 Ga0070679_100201769
393 Ga0070679_100254591
394 Ga0070679_100403093
395 Ga0070684_100077236
396 Ga0070684_100303159
397 Ga0068853_100032797
398 Ga0068853_100203329
399 Ga0070686_100989713
400 Ga0070665_100000189
401 Ga0070665_100284694
402 Ga0068855_100310867
403 Ga0068855_100347779
404 Ga0068855_100929852
405 Ga0070664_100185361
406 Ga0070664_100514204
407 Ga0068857_100743235
408 Ga0068857_101046204
409 Ga0068856_100009832
410 Ga0068856_100572217
411 Ga0068852_100294758
412 Ga0068859_100419285
413 Ga0068859_100627009
414 Ga0068859_101080738
415 Ga0068859_101262830
416 Ga0068864_100155456
417 Ga0068864_100273181
418 Ga0068866_10238694
419 Ga0068861_100855314
420 Ga0068861_101718392
421 Ga0068851_10069921
422 Ga0068863_101054170
423 Ga0068858_100133390
424 Ga0068860_100117855
425 Ga0068860_100302375
426 Ga0068860_100348955
427 Ga0068862_100012364
428 Ga0068862_100379661
429 Ga0081539_10000345
430 Ga0081539_10024565
431 Ga0070716_100233449
432 Ga0070712_100287970
433 Ga0075366_10072453
434 Ga0097621_100096733
435 Ga0068871_100134878
436 Ga0068871_100678279
437 Ga0068871_100719744
438 Ga0075428_100090426
439 Ga0075430_100358645
440 Ga0075433_10035336
441 Ga0075434_100129223
442 Ga0075429_100010254
443 Ga0097620_100028040
444 Ga0097620_100419281
445 Ga0097620_100627035
446 Ga0097620_101080885
447 Ga0097620_101262886
448 Ga0105251_10137456
449 Ga0105240_10001492
450 Ga0105240_10142389
451 Ga0111539_10114832
452 Ga0114129_12749761
453 Ga0105241_10160652
454 Ga0105241_10175759
455 Ga0105241_10230152
456 Ga0105237_10022652
457 Ga0105237_11322971
458 Ga0105249_10061509
459 Ga0105249_11103461
460 Ga0105249_11333019
461 Ga0105239_10014883
462 Ga0105239_10253289
463 Ga0105239_10377418
464 Ga0105246_10135865
465 Ga0105246_11218745
466 Ga0157373_10017176
467 Ga0157373_10088831
468 Ga0157373_10314969
469 Ga0157371_10006464
470 Ga0157371_10015752
471 Ga0157371_10028244
472 Ga0157371_10037264
473 Ga0157371_10043962
474 Ga0157371_10049410
475 Ga0157371_10052466
476 Ga0157371_10092153
477 Ga0157370_10040347
478 Ga0157370_10419823
479 Ga0157369_10078667
480 Ga0157369_10272371
481 Ga0157369_10288328
482 Ga0157374_10026673
483 Ga0157374_11245376
484 Ga0157378_10216540
485 Ga0157378_10427875
486 Ga0157378_10625366
487 Ga0163162_10002594
488 Ga0163162_10377136
489 Ga0157372_10002608
490 Ga0157372_10003873
491 Ga0157372_10020154
492 Ga0157372_10136169
493 Ga0157372_10164838
494 Ga0157372_10173396
495 Ga0157372_10185131
496 Ga0157372_10186077
497 Ga0157372_10290033
498 Ga0157372_10358670
499 Ga0157372_10841362
500 Ga0163163_10059128
501 Ga0163163_10953310
502 Ga0157380_10000088
503 Ga0182008_10686945
504 Ga0157379_10014233
505 Ga0157376_10161295
506 Ga0157376_10184649
507 Ga0163161_10298659
508 Ga0213876_10001274
509 Ga0207427_100113
510 Ga0209437_100010
511 Ga0209233_1000017
512 Ga0207656_10014230
513 Ga0207642_10094957
514 Ga0207688_10425502
515 Ga0207647_10319504
516 Ga0207645_10123986
517 Ga0207643_10256741
518 Ga0207705_10139578
519 Ga0207654_10079628
520 Ga0207654_10164172
521 Ga0207707_11093360
522 Ga0207695_10000645
523 Ga0207695_10068845
524 Ga0207671_10189718
525 Ga0207660_10140087
526 Ga0207660_10215998
527 Ga0207652_10000165
528 Ga0207652_10002803
529 Ga0207652_10108733
530 Ga0207646_10120519
531 Ga0207681_10217168
532 Ga0207650_10322882
533 Ga0207664_10038397
534 Ga0207644_10370735
535 Ga0207690_10098870
536 Ga0207706_10091448
537 Ga0207706_10299480
538 Ga0207670_10054938
539 Ga0207669_10700156
540 Ga0207665_10975878
541 Ga0207689_10036473
542 Ga0207689_10067625
543 Ga0207689_10851061
544 Ga0207679_10034651
545 Ga0207667_10001334
546 Ga0207667_10105071
547 Ga0207667_10264047
548 Ga0207667_10984807
549 Ga0207667_11245806
550 Ga0207651_10409034
551 Ga0207712_10292827
552 Ga0207640_10036900
553 Ga0207639_10165413
554 Ga0207641_10436798
555 Ga0207648_10023353
556 Ga0207648_11469140
557 Ga0207676_10120505
558 Ga0207676_10124644
559 Ga0207674_10255475
560 Ga0207675_100567887
561 Ga0207675_100743650
562 Ga0207683_10553488
563 Ga0207698_10251155
564 Ga0210000_1010395
565 Ga0207428_10018846
566 Ga0268266_10000180
567 Ga0268266_10080290
568 Ga0268265_10265066
569 Ga0268265_10787533
570 Ga0268264_10043119
571 Ga0268264_10090310
572 Ga0268264_10631199
573 Ga0307515_10000147
574 Ga0265338_10065943
575 Ga0316183_1062078
576 Ga0316181_1054941
577 Ga0316182_1005709
578 Ga0307509_10590999
579 Ga0307514_10209425
580 Ga0307516_10199286
581 Ga0307405_10011842
582 Ga0307405_10584329
583 Ga0307410_10156140
584 Ga0307412_10202594
585 Ga0307416_100019419
586 Ga0307414_10038452
587 Ga0307414_10571972
588 Ga0307411_10206282
589 Ga0307411_10789691
590 Ga0307415_100646417
591 Ga0373934_0335543
592 Ga0373952_0043020
593 Ga0373927_1017561
594 Ga0395899_0078262
595 Ga0395899_0163637
596 Ga0395899_0195683
597 Ga0395899_0396395
598 Ga0395900_0006360
599 Ga0395900_0008764
600 Ga0395900_0021857
601 Ga0395900_0033220
602 Ga0395900_0076902
603 Ga0395900_0089985
604 Ga0395900_0445693
605 Ga0395898_0361277
606 Ga0395905_0000051
607 Ga0395905_0003216
608 Ga0395905_0137460
609 Ga0395901_0057882
610 Ga0395901_0244407
611 Ga0395901_0489258
612 Ga0436365_0004784
613 Ga0439461_0162346
614 Ga0451793_0865712
615 Ga0451807_2030209
616 Ga0451837_1368878
617 Ga0451837_1723033
618 Ga0451853_2837711
619 Ga0439441_014230
620 Ga0439446_0094203
621 Ga0453684_0650620
622 Ga0495592_0245615
623 Ga0495638_0027579
624 Ga0495651_0044057
625 Ga0495606_0000009
626 Ga0495628_0617243
627 Ga0495630_0100432
628 Ga0495630_0111824
629 Ga0495632_0001589
630 Ga0495637_0039804
631 Ga0495648_0013159
632 Ga0495648_0314307
633 Ga0495652_0090643
634 Ga0495586_0590028
635 Ga0495633_0001092
636 Ga0495633_0070917
637 Ga0495668_0064879
638 Ga0495634_0289586
639 Ga0495611_0000342
640 Ga0495636_0148052
641 Ga0495687_000004
642 Ga0495677_0097257
643 Ga0495685_019206
644 Ga0496104_0673381
645 Ga0496111_0419116
646 Ga0501300_000387
647 Ga0501033_0197730
648 Ga0501034_0004094
649 Ga0501036_0252806
650 Ga0501046_0201752
651 Ga0501046_0793139
652 Ga0501067_0026278
653 Ga0501069_0099590
654 Ga0501070_0099992
655 Ga0501073_0071855
656 Ga0501080_0097892
657 Ga0501083_0013685
658 Ga0501044_0361163
659 Ga0501044_0964896
660 Ga0501044_1161898
661 nmdc:mga0k408_79245_c1
662 nmdc:mga09592_8533_c1
663 nmdc:mga0qj67_447389_c1
664 nmdc:mga08y16_22888_c1
665 nmdc:mga08y16_280585_c1
666 nmdc:mga0n895_27381_c1
667 nmdc:mga0a205_207940_c1
668 nmdc:mga0a205_623981_c1
669 Ga0500583_0066639
670 Ga0500562_161132
671 Ga0500618_009529
672 Ga0500642_0106620
673 Ga0500655_067442
674 Ga0500604_0006993
675 Ga0500622_0000062
676 Ga0500637_0025844
677 Ga0501084_0084383
678 Ga0501082_0465015
679 2599481294
680 2896113911
681 2928081892
682 2928151914
683 2929244466
684 2932087222

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

60

195

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ldk-assembly1.cif.gz_A solution nmr structure of protein aaur_3427 from arthrobacter aurescens, northeast structural genomics consortium target aar96 0.952 8 161
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9318 5 162
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9184 17 158
3uid-assembly2.cif.gz_B crystal structure of protein ms6760 from mycobacterium smegmatis 0.9147 5 162
3uid-assembly1.cif.gz_A crystal structure of protein ms6760 from mycobacterium smegmatis 0.9092 5 158
ID Description Score Start End Superfamily
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.952 8 161 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9346 8 158 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9318 5 162 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9147 5 162 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9111 17 158 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A2V8RZT3-F1-model_v4 ATPase 0.9895 6 162
AF-A0A4R7EUR0-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9843 1 158
AF-A0A4V2MLS7-F1-model_v4 SRPBCC domain-containing protein 0.9836 1 111
AF-A0A3P1CHR4-F1-model_v4 SRPBCC domain-containing protein 0.9826 4 166
AF-A0A1G9HHE1-F1-model_v4 Uncharacterized conserved protein YndB, AHSA1/START domain 0.9808 4 162

Map