F414753

General Info

Members Datasets Scaffolds Average Seq Length
341 153 341 276

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10705819|Ga0157380_107058191
Length 293
Sequence MSTTGTGLDPVSRDFYRRVMHQLQAHDIPFLVGGAYAFERYTGIGLHTKDFDLFVHPRDVDPALEMLALNGCQTDTPFPHWLAKAECGEDVVDLIYSSGNGVALVDDGWFRHSVEEIVLDVPVRLIPAEEMIWSKAFIMERERYDGADVAHILRACADTLDWPRLLQRFDTNWRVLLQHLVMFGFIYPCERARIPAAVMRELTGRLDRELTRPAADRVCQGTLISRAQYLVDVEHWGYSDPRLAPHGNITSEERERWTWSSPKIRRVLHAPDRRSLGQFPRSGALPNQGESVN

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 0.59
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010136 3300003203 Bacteria 4192
2 Ga0058862_12669425 3300004803 Bacteria 1440
3 Ga0070658_10139700 3300005327 Bacteria 2023
4 Ga0070676_10071507 3300005328 Unclassified 2084
5 Ga0070670_100076618 3300005331 Unclassified 2873
6 Ga0070680_100028221 3300005336 Bacteria 4500
7 Ga0070689_100010557 3300005340 Bacteria 6583
8 Ga0070689_100086388 3300005340 Unclassified 2467
9 Ga0070687_100004640 3300005343 Bacteria 5491
10 Ga0070692_10137536 3300005345 Bacteria 1379
11 Ga0070668_100229646 3300005347 Unclassified 1533
12 Ga0070668_100303803 3300005347 Bacteria 1339
13 Ga0070668_100456648 3300005347 Bacteria 1099
14 Ga0070669_100082638 3300005353 Unclassified 2394
15 Ga0070675_100083957 3300005354 Unclassified 2659
16 Ga0070674_100017210 3300005356 Bacteria 4542
17 Ga0070688_100164427 3300005365 Unclassified 1527
18 Ga0070667_100076514 3300005367 Bacteria 2858
19 Ga0070701_10197536 3300005438 Bacteria 1187
20 Ga0070705_100017803 3300005440 Bacteria 3714
21 Ga0070694_100190988 3300005444 Bacteria 1521
22 Ga0070708_100003480 3300005445 Bacteria 12323
23 Ga0070708_100027850 3300005445 Unclassified 4854
24 Ga0070708_100166888 3300005445 Bacteria 2054
25 Ga0070663_100019304 3300005455 Bacteria 4490
26 Ga0068867_100016254 3300005459 Bacteria 5285
27 Ga0068867_100085716 3300005459 Bacteria 2382
28 Ga0070706_100012206 3300005467 Bacteria 7963
29 Ga0070706_100255738 3300005467 Bacteria 1635
30 Ga0070706_100464240 3300005467 Bacteria 1178
31 Ga0070706_100512275 3300005467 Bacteria 1116
32 Ga0070707_100103169 3300005468 Bacteria 2763
33 Ga0070698_100011605 3300005471 Bacteria 9348
34 Ga0070698_100016616 3300005471 Bacteria 7766
35 Ga0070699_100020026 3300005518 Bacteria 5764
36 Ga0070697_100059318 3300005536 Bacteria 3116
37 Ga0070697_100070132 3300005536 Bacteria 2872
38 Ga0070697_100212335 3300005536 Bacteria 1648
39 Ga0070672_100085109 3300005543 Unclassified 2540
40 Ga0070672_100317648 3300005543 Bacteria 1323
41 Ga0070686_100016680 3300005544 Unclassified 4276
42 Ga0070686_100028777 3300005544 Bacteria 3372
43 Ga0070695_100120969 3300005545 Bacteria 1791
44 Ga0070704_100048978 3300005549 Bacteria 2961
45 Ga0068857_100295291 3300005577 Bacteria 1493
46 Ga0070702_100008674 3300005615 Bacteria 4936
47 Ga0070702_100088925 3300005615 Unclassified 1868
48 Ga0068859_100011427 3300005617 Bacteria 8925
49 Ga0068859_100723812 3300005617 Bacteria 1085
50 Ga0068864_100280575 3300005618 Bacteria 1555
51 Ga0068861_100060163 3300005719 Bacteria 2910
52 Ga0068862_100290934 3300005844 Bacteria 1500
53 Ga0068862_100545529 3300005844 Bacteria 1106
54 Ga0081539_10000454 3300005985 Bacteria 87230
55 Ga0081539_10004323 3300005985 Bacteria 15853
56 Ga0075362_10042257 3300006177 Unclassified 2014
57 Ga0075367_10037419 3300006178 Bacteria 2820
58 Ga0075366_10000494 3300006195 Bacteria 18228
59 Ga0075370_10090694 3300006353 Bacteria 1763
60 Ga0068871_100035841 3300006358 Bacteria 3946
61 Ga0075428_100000958 3300006844 Bacteria 30591
62 Ga0075428_100001955 3300006844 Bacteria 22149
63 Ga0075428_100020581 3300006844 Bacteria 7305
64 Ga0075428_100026447 3300006844 Bacteria 6422
65 Ga0075428_100042115 3300006844 Bacteria 5023
66 Ga0075428_100072169 3300006844 Bacteria 3772
67 Ga0075428_100143254 3300006844 Bacteria 2598
68 Ga0075428_100203473 3300006844 Bacteria 2140
69 Ga0075428_100299316 3300006844 Bacteria 1729
70 Ga0075430_100000404 3300006846 Bacteria 31995
71 Ga0075430_100000993 3300006846 Bacteria 22410
72 Ga0075430_100001785 3300006846 Bacteria 17586
73 Ga0075430_100016695 3300006846 Bacteria 6254
74 Ga0075430_100095625 3300006846 Bacteria 2483
75 Ga0075430_100123629 3300006846 Bacteria 2157
76 Ga0075431_100000082 3300006847 Bacteria 56660
77 Ga0075431_100000934 3300006847 Bacteria 25824
78 Ga0075431_100001308 3300006847 Bacteria 22782
79 Ga0075431_100001849 3300006847 Bacteria 20046
80 Ga0075431_100002286 3300006847 Bacteria 18391
81 Ga0075431_100002433 3300006847 Bacteria 17914
82 Ga0075431_100012063 3300006847 Bacteria 8720
83 Ga0075431_100020867 3300006847 Bacteria 6695
84 Ga0075431_100076318 3300006847 Bacteria 3458
85 Ga0075431_100104374 3300006847 Bacteria 2925
86 Ga0075431_100316348 3300006847 Bacteria 1575
87 Ga0075431_100407340 3300006847 Bacteria 1360
88 Ga0075433_10051733 3300006852 Bacteria 3578
89 Ga0075433_10087177 3300006852 Bacteria 2757
90 Ga0075433_10128149 3300006852 Bacteria 2254
91 Ga0075433_10255368 3300006852 Bacteria 1555
92 Ga0075434_100021028 3300006871 Bacteria 6339
93 Ga0075434_100066624 3300006871 Bacteria 3587
94 Ga0075434_100086845 3300006871 Unclassified 3128
95 Ga0075434_100156237 3300006871 Bacteria 2300
96 Ga0075434_100176345 3300006871 Bacteria 2157
97 Ga0075429_100000023 3300006880 Bacteria 68064
98 Ga0075429_100007755 3300006880 Bacteria 9321
99 Ga0075429_100011837 3300006880 Bacteria 7565
100 Ga0075429_100054061 3300006880 Bacteria 3493
101 Ga0075429_100098278 3300006880 Bacteria 2554
102 Ga0075429_100122135 3300006880 Bacteria 2277
103 Ga0075429_100197152 3300006880 Bacteria 1764
104 Ga0075429_100364096 3300006880 Bacteria 1266
105 Ga0075429_100426765 3300006880 Bacteria 1161
106 Ga0068865_100060018 3300006881 Bacteria 2661
107 Ga0075436_100032820 3300006914 Bacteria 3578
108 Ga0075436_100036749 3300006914 Bacteria 3382
109 Ga0075436_100329450 3300006914 Bacteria 1098
110 Ga0097620_100011426 3300006931 Bacteria 8925
111 Ga0097620_100723781 3300006931 Bacteria 1085
112 Ga0075435_100004101 3300007076 Bacteria 9983
113 Ga0075435_100030020 3300007076 Bacteria 4271
114 Ga0075435_100049425 3300007076 Bacteria 3382
115 Ga0075435_100309531 3300007076 Unclassified 1351
116 Ga0105240_10000112 3300009093 Bacteria 169461
117 Ga0111539_10000603 3300009094 Bacteria 46477
118 Ga0111539_10002644 3300009094 Bacteria 23738
119 Ga0111539_10003359 3300009094 Bacteria 21129
120 Ga0111539_10014232 3300009094 Bacteria 9935
121 Ga0105245_10077995 3300009098 Bacteria 3022
122 Ga0105247_10283884 3300009101 Bacteria 1143
123 Ga0114129_10000441 3300009147 Bacteria 49260
124 Ga0114129_10001852 3300009147 Bacteria 28822
125 Ga0114129_10004164 3300009147 Bacteria 20433
126 Ga0114129_10020175 3300009147 Bacteria 9485
127 Ga0114129_10041387 3300009147 Bacteria 6493
128 Ga0114129_10055977 3300009147 Bacteria 5527
129 Ga0114129_10062740 3300009147 Bacteria 5190
130 Ga0114129_10065825 3300009147 Bacteria 5057
131 Ga0114129_10075390 3300009147 Bacteria 4697
132 Ga0114129_10081548 3300009147 Bacteria 4496
133 Ga0114129_10118423 3300009147 Bacteria 3648
134 Ga0114129_10151425 3300009147 Bacteria 3174
135 Ga0114129_10487055 3300009147 Bacteria 1613
136 Ga0105243_10173582 3300009148 Bacteria 1869
137 Ga0105242_10024232 3300009176 Bacteria 4791
138 Ga0105248_10009545 3300009177 Bacteria 10680
139 Ga0105249_10013078 3300009553 Bacteria 7329
140 Ga0105249_10026553 3300009553 Bacteria 5220
141 Ga0105249_10172048 3300009553 Unclassified 2101
142 Ga0105249_10175839 3300009553 Bacteria 2079
143 Ga0105239_10021416 3300010375 Bacteria 7127
144 Ga0105239_10903265 3300010375 Bacteria 1014
145 Ga0163162_10317410 3300013306 Bacteria 1691
146 Ga0157380_10705819 3300014326 Bacteria 1014
147 Ga0157377_10008435 3300014745 Bacteria 5026
148 Ga0157379_10084876 3300014968 Bacteria 2837
149 Ga0207642_10032900 3300025899 Bacteria 2188
150 Ga0207645_10025946 3300025907 Bacteria 3790
151 Ga0207643_10069344 3300025908 Bacteria 2026
152 Ga0207684_10000279 3300025910 Bacteria 74399
153 Ga0207684_10136775 3300025910 Bacteria 2104
154 Ga0207684_10265938 3300025910 Bacteria 1480
155 Ga0207695_10000196 3300025913 Bacteria 171024
156 Ga0207660_10023808 3300025917 Bacteria 4139
157 Ga0207662_10001787 3300025918 Bacteria 10553
158 Ga0207646_10046882 3300025922 Bacteria 3877
159 Ga0207646_10063285 3300025922 Bacteria 3303
160 Ga0207646_10256880 3300025922 Bacteria 1579
161 Ga0207681_10310807 3300025923 Bacteria 1250
162 Ga0207687_10462576 3300025927 Bacteria 1054
163 Ga0207706_10023232 3300025933 Bacteria 5569
164 Ga0207706_10166385 3300025933 Unclassified 1938
165 Ga0207670_10162488 3300025936 Unclassified 1668
166 Ga0207669_10156341 3300025937 Bacteria 1604
167 Ga0207704_10321165 3300025938 Unclassified 1194
168 Ga0207691_10046618 3300025940 Bacteria 3981
169 Ga0207689_10011926 3300025942 Bacteria 7448
170 Ga0207668_10357535 3300025972 Bacteria 1223
171 Ga0207678_10014867 3300026067 Bacteria 6846
172 Ga0207708_10060956 3300026075 Bacteria 2880
173 Ga0207648_10001348 3300026089 Bacteria 27180
174 Ga0207648_10015429 3300026089 Bacteria 7028
175 Ga0207676_10189475 3300026095 Bacteria 1809
176 Ga0207675_100006965 3300026118 Bacteria 10696
177 Ga0207675_100312998 3300026118 Bacteria 1531
178 Ga0207683_10024272 3300026121 Bacteria 5220
179 Ga0209983_1024079 3300027665 Bacteria 1281
180 Ga0207428_10000174 3300027907 Bacteria 89762
181 Ga0207428_10001223 3300027907 Bacteria 27543
182 Ga0207428_10025667 3300027907 Bacteria 4929
183 Ga0207428_10156945 3300027907 Bacteria 1730
184 Ga0268265_10184194 3300028380 Bacteria 1797
185 Ga0268265_10269992 3300028380 Bacteria 1517
186 Ga0268264_10136122 3300028381 Bacteria 2184
187 Ga0307408_100015821 3300031548 Bacteria 5026
188 Ga0307408_100193839 3300031548 Bacteria 1639
189 Ga0307408_100638504 3300031548 Bacteria 950
190 Ga0307405_10363458 3300031731 Bacteria 1121
191 Ga0307410_10087387 3300031852 Bacteria 2205
192 Ga0307410_10241049 3300031852 Bacteria 1401
193 Ga0307410_10418512 3300031852 Bacteria 1086
194 Ga0307406_10233147 3300031901 Bacteria 1376
195 Ga0307412_10159476 3300031911 Bacteria 1674
196 Ga0307409_100591457 3300031995 Bacteria 1095
197 Ga0307409_100913053 3300031995 Bacteria 892
198 Ga0307416_100069524 3300032002 Bacteria 2914
199 Ga0307416_100078557 3300032002 Bacteria 2777
200 Ga0307416_100152509 3300032002 Bacteria 2122
201 Ga0307416_100213470 3300032002 Bacteria 1843
202 Ga0373932_0032166 3300035112 Bacteria 1466
203 Ga0373931_0002062 3300035691 Bacteria 8837
204 Ga0395899_0023903 3300037312 Bacteria 4624
205 Ga0395900_0020251 3300037418 Bacteria 6789
206 Ga0395900_0132203 3300037418 Bacteria 2557
207 Ga0395898_0048703 3300037466 Bacteria 4154
208 Ga0395905_0095646 3300037471 Bacteria 2788
209 Ga0395905_0650841 3300037471 Bacteria 956
210 Ga0395901_0016328 3300038443 Bacteria 7562
211 Ga0451576_0285145 3300045051 Bacteria 1727
212 Ga0495669_0029795 3300046684 Bacteria 2394
213 Ga0495669_0128688 3300046684 Bacteria 1191
214 Ga0495669_0131892 3300046684 Bacteria 1176
215 Ga0495677_0064348 3300047445 Bacteria 1363
216 Ga0496102_0096815 3300048905 Bacteria 2736
217 Ga0496108_0267397 3300048911 Bacteria 1488
218 Ga0501031_0020113 3300049568 Bacteria 4351
219 Ga0501033_0359807 3300049570 Bacteria 1018
220 Ga0501034_0311017 3300049571 Bacteria 1510
221 Ga0501036_0089404 3300049572 Bacteria 2602
222 Ga0501036_0251741 3300049572 Bacteria 1480
223 Ga0501036_0434473 3300049572 Bacteria 1094
224 Ga0501038_0046754 3300049574 Bacteria 3752
225 Ga0501039_0083078 3300049575 Bacteria 2494
226 Ga0501039_0089412 3300049575 Bacteria 2400
227 Ga0501040_0017368 3300049576 Bacteria 4774
228 Ga0501040_0020482 3300049576 Bacteria 4408
229 Ga0501040_0098500 3300049576 Bacteria 2038
230 Ga0501040_0161315 3300049576 Bacteria 1585
231 Ga0501041_0054020 3300049577 Bacteria 2450
232 Ga0501041_0365611 3300049577 Bacteria 912
233 Ga0501046_0007135 3300049580 Bacteria 9829
234 Ga0501048_0092901 3300049582 Bacteria 2128
235 Ga0501048_0182006 3300049582 Bacteria 1490
236 Ga0501068_0058101 3300049584 Bacteria 2347
237 Ga0501070_0139000 3300049586 Bacteria 2006
238 Ga0501071_0069112 3300049587 Bacteria 2571
239 Ga0501071_0190129 3300049587 Bacteria 1540
240 Ga0501072_0015209 3300049588 Bacteria 5900
241 Ga0501072_0029720 3300049588 Bacteria 4270
242 Ga0501072_0043865 3300049588 Bacteria 3516
243 Ga0501073_0038244 3300049589 Bacteria 3405
244 Ga0501074_0204077 3300049590 Bacteria 1408
245 Ga0501075_0004088 3300049591 Bacteria 9853
246 Ga0501075_0024279 3300049591 Bacteria 4443
247 Ga0501075_0068864 3300049591 Bacteria 2674
248 Ga0501075_0319627 3300049591 Bacteria 1183
249 Ga0501076_0003244 3300049592 Bacteria 11380
250 Ga0501076_0023919 3300049592 Bacteria 4714
251 Ga0501076_0098517 3300049592 Bacteria 2355
252 Ga0501077_0009393 3300049593 Bacteria 6076
253 Ga0501077_0044210 3300049593 Bacteria 2830
254 Ga0501077_0089389 3300049593 Bacteria 1952
255 Ga0501225_0088341 3300049705 Bacteria 896
256 Ga0501079_0002633 3300049741 Bacteria 13063
257 Ga0501079_0008761 3300049741 Bacteria 7667
258 Ga0501079_0100815 3300049741 Bacteria 2239
259 Ga0501079_0117227 3300049741 Bacteria 2070
260 Ga0501079_0312824 3300049741 Bacteria 1229
261 Ga0501080_0338345 3300049742 Bacteria 1360
262 Ga0501080_0463495 3300049742 Bacteria 1135
263 Ga0501081_0004120 3300049743 Bacteria 9314
264 Ga0501081_0006423 3300049743 Bacteria 7628
265 Ga0501081_0032518 3300049743 Bacteria 3539
266 Ga0501081_0071340 3300049743 Bacteria 2421
267 Ga0501081_0375212 3300049743 Bacteria 1050
268 Ga0501045_0036525 3300049824 Bacteria 3567
269 Ga0501045_0334160 3300049824 Bacteria 1127
270 nmdc:mga03n38_246979_c1 3300050490 Unclassified 941
271 nmdc:mga00v17_10425_c1 3300050491 Bacteria 5074
272 nmdc:mga0k408_526_c1 3300050493 Bacteria 21072
273 nmdc:mga06z11_5727_c1 3300050494 Bacteria 5005
274 nmdc:mga07m45_54164_c1 3300050496 Bacteria 2267
275 nmdc:mga05p37_106014_c1 3300050507 Bacteria 3457
276 nmdc:mga05p37_119152_c1 3300050507 Bacteria 3243
277 nmdc:mga05p37_12755_c1 3300050507 Bacteria 10045
278 nmdc:mga05p37_152449_c1 3300050507 Bacteria 2826
279 nmdc:mga05p37_20607_c1 3300050507 Bacteria 7978
280 nmdc:mga05p37_23863_c1 3300050507 Bacteria 7428
281 nmdc:mga05p37_24241_c1 3300050507 Bacteria 7372
282 nmdc:mga05p37_2509_c1 3300050507 Bacteria 21339
283 nmdc:mga05p37_272706_c1 3300050507 Bacteria 2021
284 nmdc:mga05p37_3290_c1 3300050507 Bacteria 18843
285 nmdc:mga05p37_41612_c1 3300050507 Bacteria 5642
286 nmdc:mga05p37_432794_c1 3300050507 Bacteria 1528
287 nmdc:mga05p37_5040_c1 3300050507 Bacteria 15477
288 nmdc:mga05p37_74871_c1 3300050507 Bacteria 4167
289 nmdc:mga09592_114551_c1 3300050508 Bacteria 2314
290 nmdc:mga09592_144906_c1 3300050508 Bacteria 2048
291 nmdc:mga09592_25306_c1 3300050508 Bacteria 4912
292 nmdc:mga09592_323478_c1 3300050508 Bacteria 1336
293 nmdc:mga09592_371074_c1 3300050508 Bacteria 1238
294 nmdc:mga09592_55784_c1 3300050508 Bacteria 3339
295 nmdc:mga09592_56942_c1 3300050508 Bacteria 3303
296 nmdc:mga09592_61420_c1 3300050508 Bacteria 3178
297 nmdc:mga09592_721_c1 3300050508 Bacteria 25415
298 nmdc:mga09592_86776_c1 3300050508 Bacteria 2671
299 nmdc:mga0qj67_2832_c1 3300050509 Bacteria 12432
300 nmdc:mga0qj67_5818_c1 3300050509 Bacteria 9024
301 nmdc:mga0qj67_6578_c1 3300050509 Bacteria 8537
302 nmdc:mga0qj67_7655_c1 3300050509 Bacteria 7982
303 nmdc:mga06r32_1319_c1 3300050510 Bacteria 22367
304 nmdc:mga06r32_14329_c1 3300050510 Bacteria 7193
305 nmdc:mga06r32_21578_c1 3300050510 Bacteria 5946
306 nmdc:mga06r32_2498_c1 3300050510 Bacteria 16455
307 nmdc:mga06r32_30212_c1 3300050510 Bacteria 5084
308 nmdc:mga06r32_330725_c1 3300050510 Bacteria 1509
309 nmdc:mga06r32_42299_c1 3300050510 Bacteria 4332
310 nmdc:mga06r32_501742_c1 3300050510 Bacteria 1190
311 nmdc:mga06r32_56087_c1 3300050510 Bacteria 3781
312 nmdc:mga06r32_89651_c1 3300050510 Bacteria 3003
313 nmdc:mga08y16_17083_c1 3300050511 Bacteria 7640
314 nmdc:mga08y16_23251_c1 3300050511 Bacteria 6544
315 nmdc:mga08y16_74_c1 3300050511 Bacteria 83677
316 nmdc:mga0n895_145789_c1 3300050512 Bacteria 2397
317 nmdc:mga0n895_35795_c1 3300050512 Bacteria 4790
318 nmdc:mga0n895_48643_c1 3300050512 Unclassified 4151
319 nmdc:mga0n895_7989_c1 3300050512 Bacteria 9124
320 nmdc:mga0rr50_10680_c1 3300050513 Bacteria 5844
321 nmdc:mga0rr50_659278_c1 3300050513 Bacteria 893
322 nmdc:mga0rr50_7359_c1 3300050513 Bacteria 6784
323 nmdc:mga08x19_110653_c1 3300050514 Bacteria 1832
324 nmdc:mga08x19_1992_c1 3300050514 Bacteria 12500
325 nmdc:mga08x19_70159_c1 3300050514 Bacteria 2283
326 nmdc:mga0a205_122157_c1 3300050515 Bacteria 2504
327 nmdc:mga0a205_2294_c1 3300050515 Bacteria 16885
328 nmdc:mga0a205_309812_c1 3300050515 Unclassified 1451
329 nmdc:mga0a205_99868_c1 3300050515 Bacteria 2801
330 Ga0501084_0017837 3300054114 Bacteria 5908
331 Ga0501084_0029126 3300054114 Bacteria 4618
332 Ga0501084_0154883 3300054114 Bacteria 1932
333 Ga0501084_0163734 3300054114 Bacteria 1877
334 Ga0501082_0009524 3300060353 Bacteria 8358
335 Ga0501082_0028128 3300060353 Bacteria 4844
336 Ga0501082_0137762 3300060353 Bacteria 2118
337 Ga0501082_0199420 3300060353 Bacteria 1741
338 Ga0530510_0005484 3300061734 Bacteria 8784
339 Ga0530510_0083781 3300061734 Bacteria 2322
340 Ga0530510_0194247 3300061734 Bacteria 1507
341 Ga0530510_0229144 3300061734 Bacteria 1382

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0064348 Ga0495677_0064348_634_1350 238
2 3300009553 Ga0105249_10013078 Ga0105249_100130782 245
3 3300049571 Ga0501034_0311017 Ga0501034_0311017_387_1181 247
4 3300049577 Ga0501041_0054020 Ga0501041_0054020_27_794 255
5 3300049742 Ga0501080_0463495 Ga0501080_0463495_314_1081 255
6 3300050508 nmdc:mga09592_323478_c1 nmdc:mga09592_323478_c1_213_980 255
7 3300050515 nmdc:mga0a205_99868_c1 nmdc:mga0a205_99868_c1_34_846 255
8 3300054114 Ga0501084_0029126 Ga0501084_0029126_2566_3333 255
9 3300005340 Ga0070689_100086388 Ga0070689_1000863883 256
10 3300005365 Ga0070688_100164427 Ga0070688_1001644272 256
11 3300005544 Ga0070686_100016680 Ga0070686_1000166805 256
12 3300005615 Ga0070702_100088925 Ga0070702_1000889252 256
13 3300006871 Ga0075434_100086845 Ga0075434_1000868452 256
14 3300007076 Ga0075435_100309531 Ga0075435_1003095311 256
15 3300009553 Ga0105249_10026553 Ga0105249_100265537 256
16 3300025936 Ga0207670_10162488 Ga0207670_101624882 256
17 3300027907 Ga0207428_10025667 Ga0207428_100256672 256
18 3300050511 nmdc:mga08y16_23251_c1 nmdc:mga08y16_23251_c1_1880_2665 256
19 3300050512 nmdc:mga0n895_48643_c1 nmdc:mga0n895_48643_c1_2096_2881 256
20 3300050513 nmdc:mga0rr50_659278_c1 nmdc:mga0rr50_659278_c1_19_804 256
21 3300050515 nmdc:mga0a205_309812_c1 nmdc:mga0a205_309812_c1_492_1277 256
22 3300049587 Ga0501071_0190129 Ga0501071_0190129_465_1256 258
23 3300025899 Ga0207642_10032900 Ga0207642_100329002 259
24 3300031852 Ga0307410_10418512 Ga0307410_104185122 259
25 3300031901 Ga0307406_10233147 Ga0307406_102331472 259
26 3300031911 Ga0307412_10159476 Ga0307412_101594762 259
27 3300032002 Ga0307416_100069524 Ga0307416_1000695242 259
28 3300005985 Ga0081539_10004323 Ga0081539_100043236 260
29 3300009094 Ga0111539_10002644 Ga0111539_1000264414 260
30 3300009147 Ga0114129_10487055 Ga0114129_104870551 260
31 3300027907 Ga0207428_10001223 Ga0207428_100012235 260
32 3300050511 nmdc:mga08y16_17083_c1 nmdc:mga08y16_17083_c1_1839_2672 260
33 3300005347 Ga0070668_100303803 Ga0070668_1003038032 261
34 3300009093 Ga0105240_10000112 Ga0105240_1000011299 261
35 3300010375 Ga0105239_10021416 Ga0105239_100214162 261
36 3300025913 Ga0207695_10000196 Ga0207695_1000019643 261
37 3300046684 Ga0495669_0131892 Ga0495669_0131892_46_873 261
38 3300049576 Ga0501040_0098500 Ga0501040_0098500_1123_1911 261
39 3300005327 Ga0070658_10139700 Ga0070658_101397003 262
40 3300005844 Ga0068862_100290934 Ga0068862_1002909342 262
41 3300028380 Ga0268265_10184194 Ga0268265_101841941 262
42 3300005331 Ga0070670_100076618 Ga0070670_1000766182 263
43 3300006358 Ga0068871_100035841 Ga0068871_1000358415 263
44 3300005467 Ga0070706_100464240 Ga0070706_1004642401 264
45 3300005471 Ga0070698_100011605 Ga0070698_1000116054 264
46 3300005536 Ga0070697_100212335 Ga0070697_1002123351 264
47 3300009094 Ga0111539_10003359 Ga0111539_100033593 264
48 3300025922 Ga0207646_10256880 Ga0207646_102568802 264
49 3300049705 Ga0501225_0088341 Ga0501225_0088341_59_865 264
50 3300025907 Ga0207645_10025946 Ga0207645_100259464 265
51 3300005328 Ga0070676_10071507 Ga0070676_100715071 266
52 3300005340 Ga0070689_100010557 Ga0070689_1000105574 266
53 3300005343 Ga0070687_100004640 Ga0070687_1000046402 266
54 3300005354 Ga0070675_100083957 Ga0070675_1000839573 266
55 3300005356 Ga0070674_100017210 Ga0070674_1000172104 266
56 3300005367 Ga0070667_100076514 Ga0070667_1000765142 266
57 3300005444 Ga0070694_100190988 Ga0070694_1001909882 266
58 3300005445 Ga0070708_100027850 Ga0070708_1000278503 266
59 3300005455 Ga0070663_100019304 Ga0070663_1000193044 266
60 3300005459 Ga0068867_100016254 Ga0068867_1000162544 266
61 3300005467 Ga0070706_100255738 Ga0070706_1002557382 266
62 3300005468 Ga0070707_100103169 Ga0070707_1001031693 266
63 3300005536 Ga0070697_100070132 Ga0070697_1000701322 266
64 3300005543 Ga0070672_100317648 Ga0070672_1003176482 266
65 3300005544 Ga0070686_100028777 Ga0070686_1000287774 266
66 3300005577 Ga0068857_100295291 Ga0068857_1002952912 266
67 3300005615 Ga0070702_100008674 Ga0070702_1000086744 266
68 3300005617 Ga0068859_100011427 Ga0068859_1000114277 266
69 3300005617 Ga0068859_100723812 Ga0068859_1007238122 266
70 3300005719 Ga0068861_100060163 Ga0068861_1000601632 266
71 3300006177 Ga0075362_10042257 Ga0075362_100422572 266
72 3300006178 Ga0075367_10037419 Ga0075367_100374192 266
73 3300006195 Ga0075366_10000494 Ga0075366_1000049410 266
74 3300006353 Ga0075370_10090694 Ga0075370_100906942 266
75 3300006844 Ga0075428_100042115 Ga0075428_1000421153 266
76 3300006844 Ga0075428_100299316 Ga0075428_1002993162 266
77 3300006846 Ga0075430_100016695 Ga0075430_1000166953 266
78 3300006846 Ga0075430_100123629 Ga0075430_1001236292 266
79 3300006847 Ga0075431_100002286 Ga0075431_1000022867 266
80 3300006847 Ga0075431_100020867 Ga0075431_1000208676 266
81 3300006847 Ga0075431_100076318 Ga0075431_1000763183 266
82 3300006847 Ga0075431_100316348 Ga0075431_1003163481 266
83 3300006852 Ga0075433_10255368 Ga0075433_102553682 266
84 3300006880 Ga0075429_100098278 Ga0075429_1000982782 266
85 3300006880 Ga0075429_100122135 Ga0075429_1001221353 266
86 3300006881 Ga0068865_100060018 Ga0068865_1000600182 266
87 3300006931 Ga0097620_100011426 Ga0097620_1000114267 266
88 3300006931 Ga0097620_100723781 Ga0097620_1007237811 266
89 3300007076 Ga0075435_100004101 Ga0075435_1000041018 266
90 3300009094 Ga0111539_10000603 Ga0111539_1000060325 266
91 3300009098 Ga0105245_10077995 Ga0105245_100779954 266
92 3300009101 Ga0105247_10283884 Ga0105247_102838842 266
93 3300009147 Ga0114129_10055977 Ga0114129_100559773 266
94 3300009147 Ga0114129_10065825 Ga0114129_100658255 266
95 3300009147 Ga0114129_10081548 Ga0114129_100815481 266
96 3300009147 Ga0114129_10118423 Ga0114129_101184233 266
97 3300009176 Ga0105242_10024232 Ga0105242_100242324 266
98 3300009177 Ga0105248_10009545 Ga0105248_100095456 266
99 3300009553 Ga0105249_10175839 Ga0105249_101758393 266
100 3300013306 Ga0163162_10317410 Ga0163162_103174102 266
101 3300014326 Ga0157380_10705819 Ga0157380_107058191 266
102 3300014745 Ga0157377_10008435 Ga0157377_100084355 266
103 3300014968 Ga0157379_10084876 Ga0157379_100848763 266
104 3300025908 Ga0207643_10069344 Ga0207643_100693442 266
105 3300025910 Ga0207684_10136775 Ga0207684_101367752 266
106 3300025918 Ga0207662_10001787 Ga0207662_100017874 266
107 3300025922 Ga0207646_10046882 Ga0207646_100468823 266
108 3300025927 Ga0207687_10462576 Ga0207687_104625761 266
109 3300025933 Ga0207706_10023232 Ga0207706_100232322 266
110 3300025937 Ga0207669_10156341 Ga0207669_101563412 266
111 3300025940 Ga0207691_10046618 Ga0207691_100466182 266
112 3300025942 Ga0207689_10011926 Ga0207689_100119263 266
113 3300026067 Ga0207678_10014867 Ga0207678_100148676 266
114 3300026075 Ga0207708_10060956 Ga0207708_100609562 266
115 3300026089 Ga0207648_10001348 Ga0207648_1000134816 266
116 3300026095 Ga0207676_10189475 Ga0207676_101894752 266
117 3300026118 Ga0207675_100006965 Ga0207675_1000069653 266
118 3300026118 Ga0207675_100312998 Ga0207675_1003129982 266
119 3300026121 Ga0207683_10024272 Ga0207683_100242724 266
120 3300027907 Ga0207428_10000174 Ga0207428_1000017474 266
121 3300028381 Ga0268264_10136122 Ga0268264_101361222 266
122 3300031548 Ga0307408_100015821 Ga0307408_1000158212 266
123 3300031731 Ga0307405_10363458 Ga0307405_103634582 266
124 3300031852 Ga0307410_10241049 Ga0307410_102410492 266
125 3300031995 Ga0307409_100913053 Ga0307409_1009130531 266
126 3300032002 Ga0307416_100213470 Ga0307416_1002134702 266
127 3300035112 Ga0373932_0032166 Ga0373932_0032166_281_1135 266
128 3300046684 Ga0495669_0029795 Ga0495669_0029795_694_1548 266
129 3300046684 Ga0495669_0128688 Ga0495669_0128688_293_1147 266
130 3300050490 nmdc:mga03n38_246979_c1 nmdc:mga03n38_246979_c1_40_894 266
131 3300050491 nmdc:mga00v17_10425_c1 nmdc:mga00v17_10425_c1_3095_3949 266
132 3300050493 nmdc:mga0k408_526_c1 nmdc:mga0k408_526_c1_9454_10308 266
133 3300050494 nmdc:mga06z11_5727_c1 nmdc:mga06z11_5727_c1_1789_2643 266
134 3300050496 nmdc:mga07m45_54164_c1 nmdc:mga07m45_54164_c1_938_1792 266
135 3300050507 nmdc:mga05p37_119152_c1 nmdc:mga05p37_119152_c1_1935_2753 266
136 3300050507 nmdc:mga05p37_24241_c1 nmdc:mga05p37_24241_c1_2278_3144 266
137 3300050507 nmdc:mga05p37_432794_c1 nmdc:mga05p37_432794_c1_627_1481 266
138 3300050507 nmdc:mga05p37_74871_c1 nmdc:mga05p37_74871_c1_1574_2428 266
139 3300050508 nmdc:mga09592_114551_c1 nmdc:mga09592_114551_c1_77_901 266
140 3300050508 nmdc:mga09592_144906_c1 nmdc:mga09592_144906_c1_204_1058 266
141 3300050508 nmdc:mga09592_55784_c1 nmdc:mga09592_55784_c1_1244_2110 266
142 3300050509 nmdc:mga0qj67_5818_c1 nmdc:mga0qj67_5818_c1_6527_7393 266
143 3300050509 nmdc:mga0qj67_6578_c1 nmdc:mga0qj67_6578_c1_684_1553 266
144 3300050510 nmdc:mga06r32_2498_c1 nmdc:mga06r32_2498_c1_6597_7451 266
145 3300050510 nmdc:mga06r32_330725_c1 nmdc:mga06r32_330725_c1_65_904 266
146 3300050510 nmdc:mga06r32_42299_c1 nmdc:mga06r32_42299_c1_3172_4038 266
147 3300050510 nmdc:mga06r32_501742_c1 nmdc:mga06r32_501742_c1_133_987 266
148 3300050511 nmdc:mga08y16_74_c1 nmdc:mga08y16_74_c1_5608_6462 266
149 3300050513 nmdc:mga0rr50_10680_c1 nmdc:mga0rr50_10680_c1_239_1093 266
150 3300006914 Ga0075436_100329450 Ga0075436_1003294502 267
151 3300050514 nmdc:mga08x19_110653_c1 nmdc:mga08x19_110653_c1_630_1469 267
152 3300005438 Ga0070701_10197536 Ga0070701_101975362 268
153 3300005440 Ga0070705_100017803 Ga0070705_1000178032 268
154 3300005459 Ga0068867_100085716 Ga0068867_1000857162 268
155 3300005844 Ga0068862_100545529 Ga0068862_1005455291 268
156 3300006871 Ga0075434_100021028 Ga0075434_1000210286 268
157 3300025923 Ga0207681_10310807 Ga0207681_103108072 268
158 3300026089 Ga0207648_10015429 Ga0207648_100154299 268
159 3300028380 Ga0268265_10269992 Ga0268265_102699922 268
160 3300050512 nmdc:mga0n895_7989_c1 nmdc:mga0n895_7989_c1_2897_3742 268
161 3300006844 Ga0075428_100143254 Ga0075428_1001432543 269
162 3300006846 Ga0075430_100000404 Ga0075430_10000040436 269
163 3300006847 Ga0075431_100000082 Ga0075431_10000008249 269
164 3300006880 Ga0075429_100426765 Ga0075429_1004267652 269
165 3300045051 Ga0451576_0285145 Ga0451576_0285145_366_1208 269
166 3300050507 nmdc:mga05p37_12755_c1 nmdc:mga05p37_12755_c1_633_1472 269
167 3300050508 nmdc:mga09592_371074_c1 nmdc:mga09592_371074_c1_342_1181 269
168 3300050509 nmdc:mga0qj67_2832_c1 nmdc:mga0qj67_2832_c1_9161_10000 269
169 3300050510 nmdc:mga06r32_14329_c1 nmdc:mga06r32_14329_c1_4286_5125 269
170 3300004803 Ga0058862_12669425 Ga0058862_126694252 270
171 3300005336 Ga0070680_100028221 Ga0070680_1000282213 270
172 3300005345 Ga0070692_10137536 Ga0070692_101375362 270
173 3300005347 Ga0070668_100229646 Ga0070668_1002296462 270
174 3300005347 Ga0070668_100456648 Ga0070668_1004566481 270
175 3300005353 Ga0070669_100082638 Ga0070669_1000826382 270
176 3300005543 Ga0070672_100085109 Ga0070672_1000851092 270
177 3300005545 Ga0070695_100120969 Ga0070695_1001209692 270
178 3300005549 Ga0070704_100048978 Ga0070704_1000489784 270
179 3300005618 Ga0068864_100280575 Ga0068864_1002805752 270
180 3300006844 Ga0075428_100001955 Ga0075428_1000019556 270
181 3300006844 Ga0075428_100020581 Ga0075428_1000205816 270
182 3300006844 Ga0075428_100203473 Ga0075428_1002034733 270
183 3300006846 Ga0075430_100000993 Ga0075430_1000009936 270
184 3300006847 Ga0075431_100001308 Ga0075431_1000013086 270
185 3300006852 Ga0075433_10087177 Ga0075433_100871771 270
186 3300006880 Ga0075429_100000023 Ga0075429_1000000236 270
187 3300006880 Ga0075429_100364096 Ga0075429_1003640961 270
188 3300006914 Ga0075436_100036749 Ga0075436_1000367492 270
189 3300009094 Ga0111539_10014232 Ga0111539_100142322 270
190 3300009147 Ga0114129_10075390 Ga0114129_100753902 270
191 3300009148 Ga0105243_10173582 Ga0105243_101735823 270
192 3300009553 Ga0105249_10172048 Ga0105249_101720483 270
193 3300010375 Ga0105239_10903265 Ga0105239_109032651 270
194 3300025917 Ga0207660_10023808 Ga0207660_100238084 270
195 3300025933 Ga0207706_10166385 Ga0207706_101663852 270
196 3300025938 Ga0207704_10321165 Ga0207704_103211652 270
197 3300025972 Ga0207668_10357535 Ga0207668_103575351 270
198 3300027907 Ga0207428_10156945 Ga0207428_101569451 270
199 3300032002 Ga0307416_100078557 Ga0307416_1000785572 270
200 3300035691 Ga0373931_0002062 Ga0373931_0002062_139_981 270
201 3300037312 Ga0395899_0023903 Ga0395899_0023903_88_918 270
202 3300037418 Ga0395900_0020251 Ga0395900_0020251_5039_5869 270
203 3300037466 Ga0395898_0048703 Ga0395898_0048703_1103_1933 270
204 3300037471 Ga0395905_0650841 Ga0395905_0650841_92_922 270
205 3300038443 Ga0395901_0016328 Ga0395901_0016328_122_952 270
206 3300048905 Ga0496102_0096815 Ga0496102_0096815_1447_2289 270
207 3300048911 Ga0496108_0267397 Ga0496108_0267397_477_1316 270
208 3300049572 Ga0501036_0434473 Ga0501036_0434473_226_1068 270
209 3300049575 Ga0501039_0089412 Ga0501039_0089412_177_1019 270
210 3300049576 Ga0501040_0161315 Ga0501040_0161315_149_991 270
211 3300049582 Ga0501048_0092901 Ga0501048_0092901_377_1219 270
212 3300049582 Ga0501048_0182006 Ga0501048_0182006_174_1016 270
213 3300049588 Ga0501072_0029720 Ga0501072_0029720_3026_3868 270
214 3300049588 Ga0501072_0043865 Ga0501072_0043865_503_1345 270
215 3300049591 Ga0501075_0319627 Ga0501075_0319627_42_983 270
216 3300049592 Ga0501076_0098517 Ga0501076_0098517_1017_1859 270
217 3300049741 Ga0501079_0117227 Ga0501079_0117227_125_967 270
218 3300049741 Ga0501079_0312824 Ga0501079_0312824_64_906 270
219 3300049743 Ga0501081_0375212 Ga0501081_0375212_157_999 270
220 3300049824 Ga0501045_0334160 Ga0501045_0334160_130_972 270
221 3300050507 nmdc:mga05p37_272706_c1 nmdc:mga05p37_272706_c1_615_1445 270
222 3300050507 nmdc:mga05p37_3290_c1 nmdc:mga05p37_3290_c1_17857_18687 270
223 3300050508 nmdc:mga09592_61420_c1 nmdc:mga09592_61420_c1_167_997 270
224 3300050508 nmdc:mga09592_721_c1 nmdc:mga09592_721_c1_3870_4700 270
225 3300050509 nmdc:mga0qj67_7655_c1 nmdc:mga0qj67_7655_c1_3866_4696 270
226 3300050514 nmdc:mga08x19_70159_c1 nmdc:mga08x19_70159_c1_814_1665 270
227 3300054114 Ga0501084_0154883 Ga0501084_0154883_508_1350 270
228 3300054114 Ga0501084_0163734 Ga0501084_0163734_599_1441 270
229 3300060353 Ga0501082_0137762 Ga0501082_0137762_334_1176 270
230 3300060353 Ga0501082_0199420 Ga0501082_0199420_415_1257 270
231 3300061734 Ga0530510_0083781 Ga0530510_0083781_146_988 270
232 3300005445 Ga0070708_100166888 Ga0070708_1001668882 271
233 3300005467 Ga0070706_100512275 Ga0070706_1005122751 271
234 3300006844 Ga0075428_100026447 Ga0075428_1000264474 271
235 3300006846 Ga0075430_100001785 Ga0075430_10000178515 271
236 3300006846 Ga0075430_100095625 Ga0075430_1000956253 271
237 3300006847 Ga0075431_100000934 Ga0075431_1000009348 271
238 3300006847 Ga0075431_100012063 Ga0075431_1000120637 271
239 3300006847 Ga0075431_100407340 Ga0075431_1004073401 271
240 3300006871 Ga0075434_100176345 Ga0075434_1001763452 271
241 3300006880 Ga0075429_100007755 Ga0075429_10000775510 271
242 3300006880 Ga0075429_100197152 Ga0075429_1001971522 271
243 3300007076 Ga0075435_100049425 Ga0075435_1000494252 271
244 3300009147 Ga0114129_10041387 Ga0114129_100413874 271
245 3300009147 Ga0114129_10062740 Ga0114129_100627402 271
246 3300009147 Ga0114129_10151425 Ga0114129_101514253 271
247 3300025910 Ga0207684_10265938 Ga0207684_102659382 271
248 3300027665 Ga0209983_1024079 Ga0209983_10240792 271
249 3300031548 Ga0307408_100193839 Ga0307408_1001938391 271
250 3300031548 Ga0307408_100638504 Ga0307408_1006385041 271
251 3300031852 Ga0307410_10087387 Ga0307410_100873873 271
252 3300031995 Ga0307409_100591457 Ga0307409_1005914572 271
253 3300032002 Ga0307416_100152509 Ga0307416_1001525092 271
254 3300049568 Ga0501031_0020113 Ga0501031_0020113_2207_3022 271
255 3300049570 Ga0501033_0359807 Ga0501033_0359807_155_970 271
256 3300049572 Ga0501036_0089404 Ga0501036_0089404_613_1428 271
257 3300049572 Ga0501036_0251741 Ga0501036_0251741_546_1361 271
258 3300049574 Ga0501038_0046754 Ga0501038_0046754_2520_3335 271
259 3300049575 Ga0501039_0083078 Ga0501039_0083078_584_1399 271
260 3300049576 Ga0501040_0017368 Ga0501040_0017368_522_1337 271
261 3300049576 Ga0501040_0020482 Ga0501040_0020482_1532_2347 271
262 3300049577 Ga0501041_0365611 Ga0501041_0365611_46_861 271
263 3300049580 Ga0501046_0007135 Ga0501046_0007135_5719_6534 271
264 3300049584 Ga0501068_0058101 Ga0501068_0058101_331_1146 271
265 3300049586 Ga0501070_0139000 Ga0501070_0139000_839_1654 271
266 3300049587 Ga0501071_0069112 Ga0501071_0069112_1361_2176 271
267 3300049588 Ga0501072_0015209 Ga0501072_0015209_2520_3335 271
268 3300049589 Ga0501073_0038244 Ga0501073_0038244_1572_2387 271
269 3300049590 Ga0501074_0204077 Ga0501074_0204077_518_1333 271
270 3300049591 Ga0501075_0004088 Ga0501075_0004088_2378_3193 271
271 3300049591 Ga0501075_0024279 Ga0501075_0024279_2782_3597 271
272 3300049591 Ga0501075_0068864 Ga0501075_0068864_863_1678 271
273 3300049592 Ga0501076_0003244 Ga0501076_0003244_7069_7884 271
274 3300049592 Ga0501076_0023919 Ga0501076_0023919_2647_3462 271
275 3300049593 Ga0501077_0009393 Ga0501077_0009393_2751_3566 271
276 3300049593 Ga0501077_0044210 Ga0501077_0044210_1041_1856 271
277 3300049593 Ga0501077_0089389 Ga0501077_0089389_680_1495 271
278 3300049741 Ga0501079_0002633 Ga0501079_0002633_8925_9740 271
279 3300049741 Ga0501079_0008761 Ga0501079_0008761_3697_4512 271
280 3300049741 Ga0501079_0100815 Ga0501079_0100815_13_828 271
281 3300049742 Ga0501080_0338345 Ga0501080_0338345_453_1268 271
282 3300049743 Ga0501081_0004120 Ga0501081_0004120_3357_4172 271
283 3300049743 Ga0501081_0006423 Ga0501081_0006423_2956_3771 271
284 3300049743 Ga0501081_0032518 Ga0501081_0032518_1689_2504 271
285 3300049743 Ga0501081_0071340 Ga0501081_0071340_854_1669 271
286 3300049824 Ga0501045_0036525 Ga0501045_0036525_328_1143 271
287 3300050507 nmdc:mga05p37_106014_c1 nmdc:mga05p37_106014_c1_99_968 271
288 3300050507 nmdc:mga05p37_152449_c1 nmdc:mga05p37_152449_c1_1096_1911 271
289 3300050507 nmdc:mga05p37_41612_c1 nmdc:mga05p37_41612_c1_2158_2973 271
290 3300050508 nmdc:mga09592_25306_c1 nmdc:mga09592_25306_c1_4004_4819 271
291 3300050510 nmdc:mga06r32_1319_c1 nmdc:mga06r32_1319_c1_17549_18364 271
292 3300050510 nmdc:mga06r32_56087_c1 nmdc:mga06r32_56087_c1_501_1316 271
293 3300050510 nmdc:mga06r32_89651_c1 nmdc:mga06r32_89651_c1_1675_2490 271
294 3300050512 nmdc:mga0n895_35795_c1 nmdc:mga0n895_35795_c1_659_1528 271
295 3300054114 Ga0501084_0017837 Ga0501084_0017837_3309_4124 271
296 3300060353 Ga0501082_0009524 Ga0501082_0009524_5578_6393 271
297 3300060353 Ga0501082_0028128 Ga0501082_0028128_2145_2960 271
298 3300061734 Ga0530510_0005484 Ga0530510_0005484_115_930 271
299 3300061734 Ga0530510_0194247 Ga0530510_0194247_230_1045 271
300 3300061734 Ga0530510_0229144 Ga0530510_0229144_463_1278 271
301 3300003203 JGI25406J46586_10010136 JGI25406J46586_100101363 272
302 3300005445 Ga0070708_100003480 Ga0070708_1000034801 272
303 3300005467 Ga0070706_100012206 Ga0070706_10001220610 272
304 3300005471 Ga0070698_100016616 Ga0070698_1000166162 272
305 3300005518 Ga0070699_100020026 Ga0070699_1000200263 272
306 3300005536 Ga0070697_100059318 Ga0070697_1000593184 272
307 3300005985 Ga0081539_10000454 Ga0081539_1000045458 272
308 3300006844 Ga0075428_100000958 Ga0075428_10000095815 272
309 3300006844 Ga0075428_100072169 Ga0075428_1000721693 272
310 3300006847 Ga0075431_100001849 Ga0075431_1000018497 272
311 3300006847 Ga0075431_100002433 Ga0075431_1000024336 272
312 3300006847 Ga0075431_100104374 Ga0075431_1001043742 272
313 3300006852 Ga0075433_10051733 Ga0075433_100517333 272
314 3300006852 Ga0075433_10128149 Ga0075433_101281491 272
315 3300006871 Ga0075434_100066624 Ga0075434_1000666244 272
316 3300006871 Ga0075434_100156237 Ga0075434_1001562372 272
317 3300006880 Ga0075429_100011837 Ga0075429_1000118379 272
318 3300006880 Ga0075429_100054061 Ga0075429_1000540612 272
319 3300006914 Ga0075436_100032820 Ga0075436_1000328203 272
320 3300007076 Ga0075435_100030020 Ga0075435_1000300203 272
321 3300009147 Ga0114129_10000441 Ga0114129_1000044152 272
322 3300009147 Ga0114129_10001852 Ga0114129_1000185210 272
323 3300009147 Ga0114129_10004164 Ga0114129_1000416418 272
324 3300009147 Ga0114129_10020175 Ga0114129_100201757 272
325 3300025910 Ga0207684_10000279 Ga0207684_1000027933 272
326 3300025922 Ga0207646_10063285 Ga0207646_100632854 272
327 3300037418 Ga0395900_0132203 Ga0395900_0132203_1601_2419 272
328 3300037471 Ga0395905_0095646 Ga0395905_0095646_241_1059 272
329 3300050507 nmdc:mga05p37_20607_c1 nmdc:mga05p37_20607_c1_2447_3265 272
330 3300050507 nmdc:mga05p37_23863_c1 nmdc:mga05p37_23863_c1_5811_6629 272
331 3300050507 nmdc:mga05p37_2509_c1 nmdc:mga05p37_2509_c1_9035_9853 272
332 3300050507 nmdc:mga05p37_5040_c1 nmdc:mga05p37_5040_c1_11285_12103 272
333 3300050508 nmdc:mga09592_56942_c1 nmdc:mga09592_56942_c1_2455_3285 272
334 3300050508 nmdc:mga09592_86776_c1 nmdc:mga09592_86776_c1_1578_2396 272
335 3300050510 nmdc:mga06r32_21578_c1 nmdc:mga06r32_21578_c1_2550_3380 272
336 3300050510 nmdc:mga06r32_30212_c1 nmdc:mga06r32_30212_c1_538_1356 272
337 3300050512 nmdc:mga0n895_145789_c1 nmdc:mga0n895_145789_c1_434_1252 272
338 3300050513 nmdc:mga0rr50_7359_c1 nmdc:mga0rr50_7359_c1_3140_3958 272
339 3300050514 nmdc:mga08x19_1992_c1 nmdc:mga08x19_1992_c1_1993_2811 272
340 3300050515 nmdc:mga0a205_122157_c1 nmdc:mga0a205_122157_c1_253_1071 272
341 3300050515 nmdc:mga0a205_2294_c1 nmdc:mga0a205_2294_c1_3140_3958 272

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7562 47 91
1r9c-assembly1.cif.gz_A crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.741 49 91
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7314 49 91
2p7m-assembly4.cif.gz_B crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7303 49 91
2p7m-assembly4.cif.gz_D-2 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7182 47 91
ID Description Score Start End Superfamily
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7607 49 91 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7563 47 91 3.10.180.10
3vb0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7442 47 91 3.10.180.10
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7201 5 128 3.30.460.40
af_A4IAC0_1_224_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6382 16 132 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A517SDL2-F1-model_v4 Uncharacterized protein 0.9776 7 255
AF-A0A2N5K9V3-F1-model_v4 Nucleotidyltransferase family protein 0.9764 3 262
AF-K9WEY8-F1-model_v4 Nucleotidyltransferase family protein 0.9749 3 261
AF-A0A1G1GCV8-F1-model_v4 Nucleotidyltransferase family protein 0.9745 3 239
AF-A0A2V8GYY9-F1-model_v4 Nucleotidyltransferase family protein 0.9738 20 262

Feature Viewer

pLDDT pTM Quality
89.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map