F414753

General Info

Members Datasets Scaffolds Average Seq Length
341 153 341 276

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10705819|Ga0157380_107058191
Length 293
Sequence MSTTGTGLDPVSRDFYRRVMHQLQAHDIPFLVGGAYAFERYTGIGLHTKDFDLFVHPRDVDPALEMLALNGCQTDTPFPHWLAKAECGEDVVDLIYSSGNGVALVDDGWFRHSVEEIVLDVPVRLIPAEEMIWSKAFIMERERYDGADVAHILRACADTLDWPRLLQRFDTNWRVLLQHLVMFGFIYPCERARIPAAVMRELTGRLDRELTRPAADRVCQGTLISRAQYLVDVEHWGYSDPRLAPHGNITSEERERWTWSSPKIRRVLHAPDRRSLGQFPRSGALPNQGESVN

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 0.59
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010136 3300003203 Bacteria 4192
2 Ga0058862_12669425 3300004803 Bacteria 1440
3 Ga0070658_10139700 3300005327 Bacteria 2023
4 Ga0070676_10071507 3300005328 Unclassified 2084
5 Ga0070670_100076618 3300005331 Unclassified 2873
6 Ga0070680_100028221 3300005336 Bacteria 4500
7 Ga0070689_100010557 3300005340 Bacteria 6583
8 Ga0070689_100086388 3300005340 Unclassified 2467
9 Ga0070687_100004640 3300005343 Bacteria 5491
10 Ga0070692_10137536 3300005345 Bacteria 1379
11 Ga0070668_100229646 3300005347 Unclassified 1533
12 Ga0070668_100303803 3300005347 Bacteria 1339
13 Ga0070668_100456648 3300005347 Bacteria 1099
14 Ga0070669_100082638 3300005353 Unclassified 2394
15 Ga0070675_100083957 3300005354 Unclassified 2659
16 Ga0070674_100017210 3300005356 Bacteria 4542
17 Ga0070688_100164427 3300005365 Unclassified 1527
18 Ga0070667_100076514 3300005367 Bacteria 2858
19 Ga0070701_10197536 3300005438 Bacteria 1187
20 Ga0070705_100017803 3300005440 Bacteria 3714
21 Ga0070694_100190988 3300005444 Bacteria 1521
22 Ga0070708_100003480 3300005445 Bacteria 12323
23 Ga0070708_100027850 3300005445 Unclassified 4854
24 Ga0070708_100166888 3300005445 Bacteria 2054
25 Ga0070663_100019304 3300005455 Bacteria 4490
26 Ga0068867_100016254 3300005459 Bacteria 5285
27 Ga0068867_100085716 3300005459 Bacteria 2382
28 Ga0070706_100012206 3300005467 Bacteria 7963
29 Ga0070706_100255738 3300005467 Bacteria 1635
30 Ga0070706_100464240 3300005467 Bacteria 1178
31 Ga0070706_100512275 3300005467 Bacteria 1116
32 Ga0070707_100103169 3300005468 Bacteria 2763
33 Ga0070698_100011605 3300005471 Bacteria 9348
34 Ga0070698_100016616 3300005471 Bacteria 7766
35 Ga0070699_100020026 3300005518 Bacteria 5764
36 Ga0070697_100059318 3300005536 Bacteria 3116
37 Ga0070697_100070132 3300005536 Bacteria 2872
38 Ga0070697_100212335 3300005536 Bacteria 1648
39 Ga0070672_100085109 3300005543 Unclassified 2540
40 Ga0070672_100317648 3300005543 Bacteria 1323
41 Ga0070686_100016680 3300005544 Unclassified 4276
42 Ga0070686_100028777 3300005544 Bacteria 3372
43 Ga0070695_100120969 3300005545 Bacteria 1791
44 Ga0070704_100048978 3300005549 Bacteria 2961
45 Ga0068857_100295291 3300005577 Bacteria 1493
46 Ga0070702_100008674 3300005615 Bacteria 4936
47 Ga0070702_100088925 3300005615 Unclassified 1868
48 Ga0068859_100011427 3300005617 Bacteria 8925
49 Ga0068859_100723812 3300005617 Bacteria 1085
50 Ga0068864_100280575 3300005618 Bacteria 1555
51 Ga0068861_100060163 3300005719 Bacteria 2910
52 Ga0068862_100290934 3300005844 Bacteria 1500
53 Ga0068862_100545529 3300005844 Bacteria 1106
54 Ga0081539_10000454 3300005985 Bacteria 87230
55 Ga0081539_10004323 3300005985 Bacteria 15853
56 Ga0075362_10042257 3300006177 Unclassified 2014
57 Ga0075367_10037419 3300006178 Bacteria 2820
58 Ga0075366_10000494 3300006195 Bacteria 18228
59 Ga0075370_10090694 3300006353 Bacteria 1763
60 Ga0068871_100035841 3300006358 Bacteria 3946
61 Ga0075428_100000958 3300006844 Bacteria 30591
62 Ga0075428_100001955 3300006844 Bacteria 22149
63 Ga0075428_100020581 3300006844 Bacteria 7305
64 Ga0075428_100026447 3300006844 Bacteria 6422
65 Ga0075428_100042115 3300006844 Bacteria 5023
66 Ga0075428_100072169 3300006844 Bacteria 3772
67 Ga0075428_100143254 3300006844 Bacteria 2598
68 Ga0075428_100203473 3300006844 Bacteria 2140
69 Ga0075428_100299316 3300006844 Bacteria 1729
70 Ga0075430_100000404 3300006846 Bacteria 31995
71 Ga0075430_100000993 3300006846 Bacteria 22410
72 Ga0075430_100001785 3300006846 Bacteria 17586
73 Ga0075430_100016695 3300006846 Bacteria 6254
74 Ga0075430_100095625 3300006846 Bacteria 2483
75 Ga0075430_100123629 3300006846 Bacteria 2157
76 Ga0075431_100000082 3300006847 Bacteria 56660
77 Ga0075431_100000934 3300006847 Bacteria 25824
78 Ga0075431_100001308 3300006847 Bacteria 22782
79 Ga0075431_100001849 3300006847 Bacteria 20046
80 Ga0075431_100002286 3300006847 Bacteria 18391
81 Ga0075431_100002433 3300006847 Bacteria 17914
82 Ga0075431_100012063 3300006847 Bacteria 8720
83 Ga0075431_100020867 3300006847 Bacteria 6695
84 Ga0075431_100076318 3300006847 Bacteria 3458
85 Ga0075431_100104374 3300006847 Bacteria 2925
86 Ga0075431_100316348 3300006847 Bacteria 1575
87 Ga0075431_100407340 3300006847 Bacteria 1360
88 Ga0075433_10051733 3300006852 Bacteria 3578
89 Ga0075433_10087177 3300006852 Bacteria 2757
90 Ga0075433_10128149 3300006852 Bacteria 2254
91 Ga0075433_10255368 3300006852 Bacteria 1555
92 Ga0075434_100021028 3300006871 Bacteria 6339
93 Ga0075434_100066624 3300006871 Bacteria 3587
94 Ga0075434_100086845 3300006871 Unclassified 3128
95 Ga0075434_100156237 3300006871 Bacteria 2300
96 Ga0075434_100176345 3300006871 Bacteria 2157
97 Ga0075429_100000023 3300006880 Bacteria 68064
98 Ga0075429_100007755 3300006880 Bacteria 9321
99 Ga0075429_100011837 3300006880 Bacteria 7565
100 Ga0075429_100054061 3300006880 Bacteria 3493
101 Ga0075429_100098278 3300006880 Bacteria 2554
102 Ga0075429_100122135 3300006880 Bacteria 2277
103 Ga0075429_100197152 3300006880 Bacteria 1764
104 Ga0075429_100364096 3300006880 Bacteria 1266
105 Ga0075429_100426765 3300006880 Bacteria 1161
106 Ga0068865_100060018 3300006881 Bacteria 2661
107 Ga0075436_100032820 3300006914 Bacteria 3578
108 Ga0075436_100036749 3300006914 Bacteria 3382
109 Ga0075436_100329450 3300006914 Bacteria 1098
110 Ga0097620_100011426 3300006931 Bacteria 8925
111 Ga0097620_100723781 3300006931 Bacteria 1085
112 Ga0075435_100004101 3300007076 Bacteria 9983
113 Ga0075435_100030020 3300007076 Bacteria 4271
114 Ga0075435_100049425 3300007076 Bacteria 3382
115 Ga0075435_100309531 3300007076 Unclassified 1351
116 Ga0105240_10000112 3300009093 Bacteria 169461
117 Ga0111539_10000603 3300009094 Bacteria 46477
118 Ga0111539_10002644 3300009094 Bacteria 23738
119 Ga0111539_10003359 3300009094 Bacteria 21129
120 Ga0111539_10014232 3300009094 Bacteria 9935
121 Ga0105245_10077995 3300009098 Bacteria 3022
122 Ga0105247_10283884 3300009101 Bacteria 1143
123 Ga0114129_10000441 3300009147 Bacteria 49260
124 Ga0114129_10001852 3300009147 Bacteria 28822
125 Ga0114129_10004164 3300009147 Bacteria 20433
126 Ga0114129_10020175 3300009147 Bacteria 9485
127 Ga0114129_10041387 3300009147 Bacteria 6493
128 Ga0114129_10055977 3300009147 Bacteria 5527
129 Ga0114129_10062740 3300009147 Bacteria 5190
130 Ga0114129_10065825 3300009147 Bacteria 5057
131 Ga0114129_10075390 3300009147 Bacteria 4697
132 Ga0114129_10081548 3300009147 Bacteria 4496
133 Ga0114129_10118423 3300009147 Bacteria 3648
134 Ga0114129_10151425 3300009147 Bacteria 3174
135 Ga0114129_10487055 3300009147 Bacteria 1613
136 Ga0105243_10173582 3300009148 Bacteria 1869
137 Ga0105242_10024232 3300009176 Bacteria 4791
138 Ga0105248_10009545 3300009177 Bacteria 10680
139 Ga0105249_10013078 3300009553 Bacteria 7329
140 Ga0105249_10026553 3300009553 Bacteria 5220
141 Ga0105249_10172048 3300009553 Unclassified 2101
142 Ga0105249_10175839 3300009553 Bacteria 2079
143 Ga0105239_10021416 3300010375 Bacteria 7127
144 Ga0105239_10903265 3300010375 Bacteria 1014
145 Ga0163162_10317410 3300013306 Bacteria 1691
146 Ga0157380_10705819 3300014326 Bacteria 1014
147 Ga0157377_10008435 3300014745 Bacteria 5026
148 Ga0157379_10084876 3300014968 Bacteria 2837
149 Ga0207642_10032900 3300025899 Bacteria 2188
150 Ga0207645_10025946 3300025907 Bacteria 3790
151 Ga0207643_10069344 3300025908 Bacteria 2026
152 Ga0207684_10000279 3300025910 Bacteria 74399
153 Ga0207684_10136775 3300025910 Bacteria 2104
154 Ga0207684_10265938 3300025910 Bacteria 1480
155 Ga0207695_10000196 3300025913 Bacteria 171024
156 Ga0207660_10023808 3300025917 Bacteria 4139
157 Ga0207662_10001787 3300025918 Bacteria 10553
158 Ga0207646_10046882 3300025922 Bacteria 3877
159 Ga0207646_10063285 3300025922 Bacteria 3303
160 Ga0207646_10256880 3300025922 Bacteria 1579
161 Ga0207681_10310807 3300025923 Bacteria 1250
162 Ga0207687_10462576 3300025927 Bacteria 1054
163 Ga0207706_10023232 3300025933 Bacteria 5569
164 Ga0207706_10166385 3300025933 Unclassified 1938
165 Ga0207670_10162488 3300025936 Unclassified 1668
166 Ga0207669_10156341 3300025937 Bacteria 1604
167 Ga0207704_10321165 3300025938 Unclassified 1194
168 Ga0207691_10046618 3300025940 Bacteria 3981
169 Ga0207689_10011926 3300025942 Bacteria 7448
170 Ga0207668_10357535 3300025972 Bacteria 1223
171 Ga0207678_10014867 3300026067 Bacteria 6846
172 Ga0207708_10060956 3300026075 Bacteria 2880
173 Ga0207648_10001348 3300026089 Bacteria 27180
174 Ga0207648_10015429 3300026089 Bacteria 7028
175 Ga0207676_10189475 3300026095 Bacteria 1809
176 Ga0207675_100006965 3300026118 Bacteria 10696
177 Ga0207675_100312998 3300026118 Bacteria 1531
178 Ga0207683_10024272 3300026121 Bacteria 5220
179 Ga0209983_1024079 3300027665 Bacteria 1281
180 Ga0207428_10000174 3300027907 Bacteria 89762
181 Ga0207428_10001223 3300027907 Bacteria 27543
182 Ga0207428_10025667 3300027907 Bacteria 4929
183 Ga0207428_10156945 3300027907 Bacteria 1730
184 Ga0268265_10184194 3300028380 Bacteria 1797
185 Ga0268265_10269992 3300028380 Bacteria 1517
186 Ga0268264_10136122 3300028381 Bacteria 2184
187 Ga0307408_100015821 3300031548 Bacteria 5026
188 Ga0307408_100193839 3300031548 Bacteria 1639
189 Ga0307408_100638504 3300031548 Bacteria 950
190 Ga0307405_10363458 3300031731 Bacteria 1121
191 Ga0307410_10087387 3300031852 Bacteria 2205
192 Ga0307410_10241049 3300031852 Bacteria 1401
193 Ga0307410_10418512 3300031852 Bacteria 1086
194 Ga0307406_10233147 3300031901 Bacteria 1376
195 Ga0307412_10159476 3300031911 Bacteria 1674
196 Ga0307409_100591457 3300031995 Bacteria 1095
197 Ga0307409_100913053 3300031995 Bacteria 892
198 Ga0307416_100069524 3300032002 Bacteria 2914
199 Ga0307416_100078557 3300032002 Bacteria 2777
200 Ga0307416_100152509 3300032002 Bacteria 2122
201 Ga0307416_100213470 3300032002 Bacteria 1843
202 Ga0373932_0032166 3300035112 Bacteria 1466
203 Ga0373931_0002062 3300035691 Bacteria 8837
204 Ga0395899_0023903 3300037312 Bacteria 4624
205 Ga0395900_0020251 3300037418 Bacteria 6789
206 Ga0395900_0132203 3300037418 Bacteria 2557
207 Ga0395898_0048703 3300037466 Bacteria 4154
208 Ga0395905_0095646 3300037471 Bacteria 2788
209 Ga0395905_0650841 3300037471 Bacteria 956
210 Ga0395901_0016328 3300038443 Bacteria 7562
211 Ga0451576_0285145 3300045051 Bacteria 1727
212 Ga0495669_0029795 3300046684 Bacteria 2394
213 Ga0495669_0128688 3300046684 Bacteria 1191
214 Ga0495669_0131892 3300046684 Bacteria 1176
215 Ga0495677_0064348 3300047445 Bacteria 1363
216 Ga0496102_0096815 3300048905 Bacteria 2736
217 Ga0496108_0267397 3300048911 Bacteria 1488
218 Ga0501031_0020113 3300049568 Bacteria 4351
219 Ga0501033_0359807 3300049570 Bacteria 1018
220 Ga0501034_0311017 3300049571 Bacteria 1510
221 Ga0501036_0089404 3300049572 Bacteria 2602
222 Ga0501036_0251741 3300049572 Bacteria 1480
223 Ga0501036_0434473 3300049572 Bacteria 1094
224 Ga0501038_0046754 3300049574 Bacteria 3752
225 Ga0501039_0083078 3300049575 Bacteria 2494
226 Ga0501039_0089412 3300049575 Bacteria 2400
227 Ga0501040_0017368 3300049576 Bacteria 4774
228 Ga0501040_0020482 3300049576 Bacteria 4408
229 Ga0501040_0098500 3300049576 Bacteria 2038
230 Ga0501040_0161315 3300049576 Bacteria 1585
231 Ga0501041_0054020 3300049577 Bacteria 2450
232 Ga0501041_0365611 3300049577 Bacteria 912
233 Ga0501046_0007135 3300049580 Bacteria 9829
234 Ga0501048_0092901 3300049582 Bacteria 2128
235 Ga0501048_0182006 3300049582 Bacteria 1490
236 Ga0501068_0058101 3300049584 Bacteria 2347
237 Ga0501070_0139000 3300049586 Bacteria 2006
238 Ga0501071_0069112 3300049587 Bacteria 2571
239 Ga0501071_0190129 3300049587 Bacteria 1540
240 Ga0501072_0015209 3300049588 Bacteria 5900
241 Ga0501072_0029720 3300049588 Bacteria 4270
242 Ga0501072_0043865 3300049588 Bacteria 3516
243 Ga0501073_0038244 3300049589 Bacteria 3405
244 Ga0501074_0204077 3300049590 Bacteria 1408
245 Ga0501075_0004088 3300049591 Bacteria 9853
246 Ga0501075_0024279 3300049591 Bacteria 4443
247 Ga0501075_0068864 3300049591 Bacteria 2674
248 Ga0501075_0319627 3300049591 Bacteria 1183
249 Ga0501076_0003244 3300049592 Bacteria 11380
250 Ga0501076_0023919 3300049592 Bacteria 4714
251 Ga0501076_0098517 3300049592 Bacteria 2355
252 Ga0501077_0009393 3300049593 Bacteria 6076
253 Ga0501077_0044210 3300049593 Bacteria 2830
254 Ga0501077_0089389 3300049593 Bacteria 1952
255 Ga0501225_0088341 3300049705 Bacteria 896
256 Ga0501079_0002633 3300049741 Bacteria 13063
257 Ga0501079_0008761 3300049741 Bacteria 7667
258 Ga0501079_0100815 3300049741 Bacteria 2239
259 Ga0501079_0117227 3300049741 Bacteria 2070
260 Ga0501079_0312824 3300049741 Bacteria 1229
261 Ga0501080_0338345 3300049742 Bacteria 1360
262 Ga0501080_0463495 3300049742 Bacteria 1135
263 Ga0501081_0004120 3300049743 Bacteria 9314
264 Ga0501081_0006423 3300049743 Bacteria 7628
265 Ga0501081_0032518 3300049743 Bacteria 3539
266 Ga0501081_0071340 3300049743 Bacteria 2421
267 Ga0501081_0375212 3300049743 Bacteria 1050
268 Ga0501045_0036525 3300049824 Bacteria 3567
269 Ga0501045_0334160 3300049824 Bacteria 1127
270 nmdc:mga03n38_246979_c1 3300050490 Unclassified 941
271 nmdc:mga00v17_10425_c1 3300050491 Bacteria 5074
272 nmdc:mga0k408_526_c1 3300050493 Bacteria 21072
273 nmdc:mga06z11_5727_c1 3300050494 Bacteria 5005
274 nmdc:mga07m45_54164_c1 3300050496 Bacteria 2267
275 nmdc:mga05p37_106014_c1 3300050507 Bacteria 3457
276 nmdc:mga05p37_119152_c1 3300050507 Bacteria 3243
277 nmdc:mga05p37_12755_c1 3300050507 Bacteria 10045
278 nmdc:mga05p37_152449_c1 3300050507 Bacteria 2826
279 nmdc:mga05p37_20607_c1 3300050507 Bacteria 7978
280 nmdc:mga05p37_23863_c1 3300050507 Bacteria 7428
281 nmdc:mga05p37_24241_c1 3300050507 Bacteria 7372
282 nmdc:mga05p37_2509_c1 3300050507 Bacteria 21339
283 nmdc:mga05p37_272706_c1 3300050507 Bacteria 2021
284 nmdc:mga05p37_3290_c1 3300050507 Bacteria 18843
285 nmdc:mga05p37_41612_c1 3300050507 Bacteria 5642
286 nmdc:mga05p37_432794_c1 3300050507 Bacteria 1528
287 nmdc:mga05p37_5040_c1 3300050507 Bacteria 15477
288 nmdc:mga05p37_74871_c1 3300050507 Bacteria 4167
289 nmdc:mga09592_114551_c1 3300050508 Bacteria 2314
290 nmdc:mga09592_144906_c1 3300050508 Bacteria 2048
291 nmdc:mga09592_25306_c1 3300050508 Bacteria 4912
292 nmdc:mga09592_323478_c1 3300050508 Bacteria 1336
293 nmdc:mga09592_371074_c1 3300050508 Bacteria 1238
294 nmdc:mga09592_55784_c1 3300050508 Bacteria 3339
295 nmdc:mga09592_56942_c1 3300050508 Bacteria 3303
296 nmdc:mga09592_61420_c1 3300050508 Bacteria 3178
297 nmdc:mga09592_721_c1 3300050508 Bacteria 25415
298 nmdc:mga09592_86776_c1 3300050508 Bacteria 2671
299 nmdc:mga0qj67_2832_c1 3300050509 Bacteria 12432
300 nmdc:mga0qj67_5818_c1 3300050509 Bacteria 9024
301 nmdc:mga0qj67_6578_c1 3300050509 Bacteria 8537
302 nmdc:mga0qj67_7655_c1 3300050509 Bacteria 7982
303 nmdc:mga06r32_1319_c1 3300050510 Bacteria 22367
304 nmdc:mga06r32_14329_c1 3300050510 Bacteria 7193
305 nmdc:mga06r32_21578_c1 3300050510 Bacteria 5946
306 nmdc:mga06r32_2498_c1 3300050510 Bacteria 16455
307 nmdc:mga06r32_30212_c1 3300050510 Bacteria 5084
308 nmdc:mga06r32_330725_c1 3300050510 Bacteria 1509
309 nmdc:mga06r32_42299_c1 3300050510 Bacteria 4332
310 nmdc:mga06r32_501742_c1 3300050510 Bacteria 1190
311 nmdc:mga06r32_56087_c1 3300050510 Bacteria 3781
312 nmdc:mga06r32_89651_c1 3300050510 Bacteria 3003
313 nmdc:mga08y16_17083_c1 3300050511 Bacteria 7640
314 nmdc:mga08y16_23251_c1 3300050511 Bacteria 6544
315 nmdc:mga08y16_74_c1 3300050511 Bacteria 83677
316 nmdc:mga0n895_145789_c1 3300050512 Bacteria 2397
317 nmdc:mga0n895_35795_c1 3300050512 Bacteria 4790
318 nmdc:mga0n895_48643_c1 3300050512 Unclassified 4151
319 nmdc:mga0n895_7989_c1 3300050512 Bacteria 9124
320 nmdc:mga0rr50_10680_c1 3300050513 Bacteria 5844
321 nmdc:mga0rr50_659278_c1 3300050513 Bacteria 893
322 nmdc:mga0rr50_7359_c1 3300050513 Bacteria 6784
323 nmdc:mga08x19_110653_c1 3300050514 Bacteria 1832
324 nmdc:mga08x19_1992_c1 3300050514 Bacteria 12500
325 nmdc:mga08x19_70159_c1 3300050514 Bacteria 2283
326 nmdc:mga0a205_122157_c1 3300050515 Bacteria 2504
327 nmdc:mga0a205_2294_c1 3300050515 Bacteria 16885
328 nmdc:mga0a205_309812_c1 3300050515 Unclassified 1451
329 nmdc:mga0a205_99868_c1 3300050515 Bacteria 2801
330 Ga0501084_0017837 3300054114 Bacteria 5908
331 Ga0501084_0029126 3300054114 Bacteria 4618
332 Ga0501084_0154883 3300054114 Bacteria 1932
333 Ga0501084_0163734 3300054114 Bacteria 1877
334 Ga0501082_0009524 3300060353 Bacteria 8358
335 Ga0501082_0028128 3300060353 Bacteria 4844
336 Ga0501082_0137762 3300060353 Bacteria 2118
337 Ga0501082_0199420 3300060353 Bacteria 1741
338 Ga0530510_0005484 3300061734 Bacteria 8784
339 Ga0530510_0083781 3300061734 Bacteria 2322
340 Ga0530510_0194247 3300061734 Bacteria 1507
341 Ga0530510_0229144 3300061734 Bacteria 1382

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047445 Ga0495677_0064348 Ga0495677_0064348_634_1350 238
2 3300009553 Ga0105249_10013078 Ga0105249_100130782 245
3 3300049571 Ga0501034_0311017 Ga0501034_0311017_387_1181 247
4 3300049577 Ga0501041_0054020 Ga0501041_0054020_27_794 255
5 3300049742 Ga0501080_0463495 Ga0501080_0463495_314_1081 255
6 3300050508 nmdc:mga09592_323478_c1 nmdc:mga09592_323478_c1_213_980 255
7 3300050515 nmdc:mga0a205_99868_c1 nmdc:mga0a205_99868_c1_34_846 255
8 3300054114 Ga0501084_0029126 Ga0501084_0029126_2566_3333 255
9 3300005340 Ga0070689_100086388 Ga0070689_1000863883 256
10 3300005365 Ga0070688_100164427 Ga0070688_1001644272 256
11 3300005544 Ga0070686_100016680 Ga0070686_1000166805 256
12 3300005615 Ga0070702_100088925 Ga0070702_1000889252 256
13 3300006871 Ga0075434_100086845 Ga0075434_1000868452 256
14 3300007076 Ga0075435_100309531 Ga0075435_1003095311 256
15 3300009553 Ga0105249_10026553 Ga0105249_100265537 256
16 3300025936 Ga0207670_10162488 Ga0207670_101624882 256
17 3300027907 Ga0207428_10025667 Ga0207428_100256672 256
18 3300050511 nmdc:mga08y16_23251_c1 nmdc:mga08y16_23251_c1_1880_2665 256
19 3300050512 nmdc:mga0n895_48643_c1 nmdc:mga0n895_48643_c1_2096_2881 256
20 3300050513 nmdc:mga0rr50_659278_c1 nmdc:mga0rr50_659278_c1_19_804 256
21 3300050515 nmdc:mga0a205_309812_c1 nmdc:mga0a205_309812_c1_492_1277 256
22 3300049587 Ga0501071_0190129 Ga0501071_0190129_465_1256 258
23 3300025899 Ga0207642_10032900 Ga0207642_100329002 259
24 3300031852 Ga0307410_10418512 Ga0307410_104185122 259
25 3300031901 Ga0307406_10233147 Ga0307406_102331472 259
26 3300031911 Ga0307412_10159476 Ga0307412_101594762 259
27 3300032002 Ga0307416_100069524 Ga0307416_1000695242 259
28 3300005985 Ga0081539_10004323 Ga0081539_100043236 260
29 3300009094 Ga0111539_10002644 Ga0111539_1000264414 260
30 3300009147 Ga0114129_10487055 Ga0114129_104870551 260
31 3300027907 Ga0207428_10001223 Ga0207428_100012235 260
32 3300050511 nmdc:mga08y16_17083_c1 nmdc:mga08y16_17083_c1_1839_2672 260
33 3300005347 Ga0070668_100303803 Ga0070668_1003038032 261
34 3300009093 Ga0105240_10000112 Ga0105240_1000011299 261
35 3300010375 Ga0105239_10021416 Ga0105239_100214162 261
36 3300025913 Ga0207695_10000196 Ga0207695_1000019643 261
37 3300046684 Ga0495669_0131892 Ga0495669_0131892_46_873 261
38 3300049576 Ga0501040_0098500 Ga0501040_0098500_1123_1911 261
39 3300005327 Ga0070658_10139700 Ga0070658_101397003 262
40 3300005844 Ga0068862_100290934 Ga0068862_1002909342 262
41 3300028380 Ga0268265_10184194 Ga0268265_101841941 262
42 3300005331 Ga0070670_100076618 Ga0070670_1000766182 263
43 3300006358 Ga0068871_100035841 Ga0068871_1000358415 263
44 3300005467 Ga0070706_100464240 Ga0070706_1004642401 264
45 3300005471 Ga0070698_100011605 Ga0070698_1000116054 264
46 3300005536 Ga0070697_100212335 Ga0070697_1002123351 264
47 3300009094 Ga0111539_10003359 Ga0111539_100033593 264
48 3300025922 Ga0207646_10256880 Ga0207646_102568802 264
49 3300049705 Ga0501225_0088341 Ga0501225_0088341_59_865 264
50 3300025907 Ga0207645_10025946 Ga0207645_100259464 265
51 3300005328 Ga0070676_10071507 Ga0070676_100715071 266
52 3300005340 Ga0070689_100010557 Ga0070689_1000105574 266
53 3300005343 Ga0070687_100004640 Ga0070687_1000046402 266
54 3300005354 Ga0070675_100083957 Ga0070675_1000839573 266
55 3300005356 Ga0070674_100017210 Ga0070674_1000172104 266
56 3300005367 Ga0070667_100076514 Ga0070667_1000765142 266
57 3300005444 Ga0070694_100190988 Ga0070694_1001909882 266
58 3300005445 Ga0070708_100027850 Ga0070708_1000278503 266
59 3300005455 Ga0070663_100019304 Ga0070663_1000193044 266
60 3300005459 Ga0068867_100016254 Ga0068867_1000162544 266
61 3300005467 Ga0070706_100255738 Ga0070706_1002557382 266
62 3300005468 Ga0070707_100103169 Ga0070707_1001031693 266
63 3300005536 Ga0070697_100070132 Ga0070697_1000701322 266
64 3300005543 Ga0070672_100317648 Ga0070672_1003176482 266
65 3300005544 Ga0070686_100028777 Ga0070686_1000287774 266
66 3300005577 Ga0068857_100295291 Ga0068857_1002952912 266
67 3300005615 Ga0070702_100008674 Ga0070702_1000086744 266
68 3300005617 Ga0068859_100011427 Ga0068859_1000114277 266
69 3300005617 Ga0068859_100723812 Ga0068859_1007238122 266
70 3300005719 Ga0068861_100060163 Ga0068861_1000601632 266
71 3300006177 Ga0075362_10042257 Ga0075362_100422572 266
72 3300006178 Ga0075367_10037419 Ga0075367_100374192 266
73 3300006195 Ga0075366_10000494 Ga0075366_1000049410 266
74 3300006353 Ga0075370_10090694 Ga0075370_100906942 266
75 3300006844 Ga0075428_100042115 Ga0075428_1000421153 266
76 3300006844 Ga0075428_100299316 Ga0075428_1002993162 266
77 3300006846 Ga0075430_100016695 Ga0075430_1000166953 266
78 3300006846 Ga0075430_100123629 Ga0075430_1001236292 266
79 3300006847 Ga0075431_100002286 Ga0075431_1000022867 266
80 3300006847 Ga0075431_100020867 Ga0075431_1000208676 266
81 3300006847 Ga0075431_100076318 Ga0075431_1000763183 266
82 3300006847 Ga0075431_100316348 Ga0075431_1003163481 266
83 3300006852 Ga0075433_10255368 Ga0075433_102553682 266
84 3300006880 Ga0075429_100098278 Ga0075429_1000982782 266
85 3300006880 Ga0075429_100122135 Ga0075429_1001221353 266
86 3300006881 Ga0068865_100060018 Ga0068865_1000600182 266
87 3300006931 Ga0097620_100011426 Ga0097620_1000114267 266
88 3300006931 Ga0097620_100723781 Ga0097620_1007237811 266
89 3300007076 Ga0075435_100004101 Ga0075435_1000041018 266
90 3300009094 Ga0111539_10000603 Ga0111539_1000060325 266
91 3300009098 Ga0105245_10077995 Ga0105245_100779954 266
92 3300009101 Ga0105247_10283884 Ga0105247_102838842 266
93 3300009147 Ga0114129_10055977 Ga0114129_100559773 266
94 3300009147 Ga0114129_10065825 Ga0114129_100658255 266
95 3300009147 Ga0114129_10081548 Ga0114129_100815481 266
96 3300009147 Ga0114129_10118423 Ga0114129_101184233 266
97 3300009176 Ga0105242_10024232 Ga0105242_100242324 266
98 3300009177 Ga0105248_10009545 Ga0105248_100095456 266
99 3300009553 Ga0105249_10175839 Ga0105249_101758393 266
100 3300013306 Ga0163162_10317410 Ga0163162_103174102 266
101 3300014326 Ga0157380_10705819 Ga0157380_107058191 266
102 3300014745 Ga0157377_10008435 Ga0157377_100084355 266
103 3300014968 Ga0157379_10084876 Ga0157379_100848763 266
104 3300025908 Ga0207643_10069344 Ga0207643_100693442 266
105 3300025910 Ga0207684_10136775 Ga0207684_101367752 266
106 3300025918 Ga0207662_10001787 Ga0207662_100017874 266
107 3300025922 Ga0207646_10046882 Ga0207646_100468823 266
108 3300025927 Ga0207687_10462576 Ga0207687_104625761 266
109 3300025933 Ga0207706_10023232 Ga0207706_100232322 266
110 3300025937 Ga0207669_10156341 Ga0207669_101563412 266
111 3300025940 Ga0207691_10046618 Ga0207691_100466182 266
112 3300025942 Ga0207689_10011926 Ga0207689_100119263 266
113 3300026067 Ga0207678_10014867 Ga0207678_100148676 266
114 3300026075 Ga0207708_10060956 Ga0207708_100609562 266
115 3300026089 Ga0207648_10001348 Ga0207648_1000134816 266
116 3300026095 Ga0207676_10189475 Ga0207676_101894752 266
117 3300026118 Ga0207675_100006965 Ga0207675_1000069653 266
118 3300026118 Ga0207675_100312998 Ga0207675_1003129982 266
119 3300026121 Ga0207683_10024272 Ga0207683_100242724 266
120 3300027907 Ga0207428_10000174 Ga0207428_1000017474 266
121 3300028381 Ga0268264_10136122 Ga0268264_101361222 266
122 3300031548 Ga0307408_100015821 Ga0307408_1000158212 266
123 3300031731 Ga0307405_10363458 Ga0307405_103634582 266
124 3300031852 Ga0307410_10241049 Ga0307410_102410492 266
125 3300031995 Ga0307409_100913053 Ga0307409_1009130531 266
126 3300032002 Ga0307416_100213470 Ga0307416_1002134702 266
127 3300035112 Ga0373932_0032166 Ga0373932_0032166_281_1135 266
128 3300046684 Ga0495669_0029795 Ga0495669_0029795_694_1548 266
129 3300046684 Ga0495669_0128688 Ga0495669_0128688_293_1147 266
130 3300050490 nmdc:mga03n38_246979_c1 nmdc:mga03n38_246979_c1_40_894 266
131 3300050491 nmdc:mga00v17_10425_c1 nmdc:mga00v17_10425_c1_3095_3949 266
132 3300050493 nmdc:mga0k408_526_c1 nmdc:mga0k408_526_c1_9454_10308 266
133 3300050494 nmdc:mga06z11_5727_c1 nmdc:mga06z11_5727_c1_1789_2643 266
134 3300050496 nmdc:mga07m45_54164_c1 nmdc:mga07m45_54164_c1_938_1792 266
135 3300050507 nmdc:mga05p37_119152_c1 nmdc:mga05p37_119152_c1_1935_2753 266
136 3300050507 nmdc:mga05p37_24241_c1 nmdc:mga05p37_24241_c1_2278_3144 266
137 3300050507 nmdc:mga05p37_432794_c1 nmdc:mga05p37_432794_c1_627_1481 266
138 3300050507 nmdc:mga05p37_74871_c1 nmdc:mga05p37_74871_c1_1574_2428 266
139 3300050508 nmdc:mga09592_114551_c1 nmdc:mga09592_114551_c1_77_901 266
140 3300050508 nmdc:mga09592_144906_c1 nmdc:mga09592_144906_c1_204_1058 266
141 3300050508 nmdc:mga09592_55784_c1 nmdc:mga09592_55784_c1_1244_2110 266
142 3300050509 nmdc:mga0qj67_5818_c1 nmdc:mga0qj67_5818_c1_6527_7393 266
143 3300050509 nmdc:mga0qj67_6578_c1 nmdc:mga0qj67_6578_c1_684_1553 266
144 3300050510 nmdc:mga06r32_2498_c1 nmdc:mga06r32_2498_c1_6597_7451 266
145 3300050510 nmdc:mga06r32_330725_c1 nmdc:mga06r32_330725_c1_65_904 266
146 3300050510 nmdc:mga06r32_42299_c1 nmdc:mga06r32_42299_c1_3172_4038 266
147 3300050510 nmdc:mga06r32_501742_c1 nmdc:mga06r32_501742_c1_133_987 266
148 3300050511 nmdc:mga08y16_74_c1 nmdc:mga08y16_74_c1_5608_6462 266
149 3300050513 nmdc:mga0rr50_10680_c1 nmdc:mga0rr50_10680_c1_239_1093 266
150 3300006914 Ga0075436_100329450 Ga0075436_1003294502 267
151 3300050514 nmdc:mga08x19_110653_c1 nmdc:mga08x19_110653_c1_630_1469 267
152 3300005438 Ga0070701_10197536 Ga0070701_101975362 268
153 3300005440 Ga0070705_100017803 Ga0070705_1000178032 268
154 3300005459 Ga0068867_100085716 Ga0068867_1000857162 268
155 3300005844 Ga0068862_100545529 Ga0068862_1005455291 268
156 3300006871 Ga0075434_100021028 Ga0075434_1000210286 268
157 3300025923 Ga0207681_10310807 Ga0207681_103108072 268
158 3300026089 Ga0207648_10015429 Ga0207648_100154299 268
159 3300028380 Ga0268265_10269992 Ga0268265_102699922 268
160 3300050512 nmdc:mga0n895_7989_c1 nmdc:mga0n895_7989_c1_2897_3742 268
161 3300006844 Ga0075428_100143254 Ga0075428_1001432543 269
162 3300006846 Ga0075430_100000404 Ga0075430_10000040436 269
163 3300006847 Ga0075431_100000082 Ga0075431_10000008249 269
164 3300006880 Ga0075429_100426765 Ga0075429_1004267652 269
165 3300045051 Ga0451576_0285145 Ga0451576_0285145_366_1208 269
166 3300050507 nmdc:mga05p37_12755_c1 nmdc:mga05p37_12755_c1_633_1472 269
167 3300050508 nmdc:mga09592_371074_c1 nmdc:mga09592_371074_c1_342_1181 269
168 3300050509 nmdc:mga0qj67_2832_c1 nmdc:mga0qj67_2832_c1_9161_10000 269
169 3300050510 nmdc:mga06r32_14329_c1 nmdc:mga06r32_14329_c1_4286_5125 269
170 3300004803 Ga0058862_12669425 Ga0058862_126694252 270
171 3300005336 Ga0070680_100028221 Ga0070680_1000282213 270
172 3300005345 Ga0070692_10137536 Ga0070692_101375362 270
173 3300005347 Ga0070668_100229646 Ga0070668_1002296462 270
174 3300005347 Ga0070668_100456648 Ga0070668_1004566481 270
175 3300005353 Ga0070669_100082638 Ga0070669_1000826382 270
176 3300005543 Ga0070672_100085109 Ga0070672_1000851092 270
177 3300005545 Ga0070695_100120969 Ga0070695_1001209692 270
178 3300005549 Ga0070704_100048978 Ga0070704_1000489784 270
179 3300005618 Ga0068864_100280575 Ga0068864_1002805752 270
180 3300006844 Ga0075428_100001955 Ga0075428_1000019556 270
181 3300006844 Ga0075428_100020581 Ga0075428_1000205816 270
182 3300006844 Ga0075428_100203473 Ga0075428_1002034733 270
183 3300006846 Ga0075430_100000993 Ga0075430_1000009936 270
184 3300006847 Ga0075431_100001308 Ga0075431_1000013086 270
185 3300006852 Ga0075433_10087177 Ga0075433_100871771 270
186 3300006880 Ga0075429_100000023 Ga0075429_1000000236 270
187 3300006880 Ga0075429_100364096 Ga0075429_1003640961 270
188 3300006914 Ga0075436_100036749 Ga0075436_1000367492 270
189 3300009094 Ga0111539_10014232 Ga0111539_100142322 270
190 3300009147 Ga0114129_10075390 Ga0114129_100753902 270
191 3300009148 Ga0105243_10173582 Ga0105243_101735823 270
192 3300009553 Ga0105249_10172048 Ga0105249_101720483 270
193 3300010375 Ga0105239_10903265 Ga0105239_109032651 270
194 3300025917 Ga0207660_10023808 Ga0207660_100238084 270
195 3300025933 Ga0207706_10166385 Ga0207706_101663852 270
196 3300025938 Ga0207704_10321165 Ga0207704_103211652 270
197 3300025972 Ga0207668_10357535 Ga0207668_103575351 270
198 3300027907 Ga0207428_10156945 Ga0207428_101569451 270
199 3300032002 Ga0307416_100078557 Ga0307416_1000785572 270
200 3300035691 Ga0373931_0002062 Ga0373931_0002062_139_981 270
201 3300037312 Ga0395899_0023903 Ga0395899_0023903_88_918 270
202 3300037418 Ga0395900_0020251 Ga0395900_0020251_5039_5869 270
203 3300037466 Ga0395898_0048703 Ga0395898_0048703_1103_1933 270
204 3300037471 Ga0395905_0650841 Ga0395905_0650841_92_922 270
205 3300038443 Ga0395901_0016328 Ga0395901_0016328_122_952 270
206 3300048905 Ga0496102_0096815 Ga0496102_0096815_1447_2289 270
207 3300048911 Ga0496108_0267397 Ga0496108_0267397_477_1316 270
208 3300049572 Ga0501036_0434473 Ga0501036_0434473_226_1068 270
209 3300049575 Ga0501039_0089412 Ga0501039_0089412_177_1019 270
210 3300049576 Ga0501040_0161315 Ga0501040_0161315_149_991 270
211 3300049582 Ga0501048_0092901 Ga0501048_0092901_377_1219 270
212 3300049582 Ga0501048_0182006 Ga0501048_0182006_174_1016 270
213 3300049588 Ga0501072_0029720 Ga0501072_0029720_3026_3868 270
214 3300049588 Ga0501072_0043865 Ga0501072_0043865_503_1345 270
215 3300049591 Ga0501075_0319627 Ga0501075_0319627_42_983 270
216 3300049592 Ga0501076_0098517 Ga0501076_0098517_1017_1859 270
217 3300049741 Ga0501079_0117227 Ga0501079_0117227_125_967 270
218 3300049741 Ga0501079_0312824 Ga0501079_0312824_64_906 270
219 3300049743 Ga0501081_0375212 Ga0501081_0375212_157_999 270
220 3300049824 Ga0501045_0334160 Ga0501045_0334160_130_972 270
221 3300050507 nmdc:mga05p37_272706_c1 nmdc:mga05p37_272706_c1_615_1445 270
222 3300050507 nmdc:mga05p37_3290_c1 nmdc:mga05p37_3290_c1_17857_18687 270
223 3300050508 nmdc:mga09592_61420_c1 nmdc:mga09592_61420_c1_167_997 270
224 3300050508 nmdc:mga09592_721_c1 nmdc:mga09592_721_c1_3870_4700 270
225 3300050509 nmdc:mga0qj67_7655_c1 nmdc:mga0qj67_7655_c1_3866_4696 270
226 3300050514 nmdc:mga08x19_70159_c1 nmdc:mga08x19_70159_c1_814_1665 270
227 3300054114 Ga0501084_0154883 Ga0501084_0154883_508_1350 270
228 3300054114 Ga0501084_0163734 Ga0501084_0163734_599_1441 270
229 3300060353 Ga0501082_0137762 Ga0501082_0137762_334_1176 270
230 3300060353 Ga0501082_0199420 Ga0501082_0199420_415_1257 270
231 3300061734 Ga0530510_0083781 Ga0530510_0083781_146_988 270
232 3300005445 Ga0070708_100166888 Ga0070708_1001668882 271
233 3300005467 Ga0070706_100512275 Ga0070706_1005122751 271
234 3300006844 Ga0075428_100026447 Ga0075428_1000264474 271
235 3300006846 Ga0075430_100001785 Ga0075430_10000178515 271
236 3300006846 Ga0075430_100095625 Ga0075430_1000956253 271
237 3300006847 Ga0075431_100000934 Ga0075431_1000009348 271
238 3300006847 Ga0075431_100012063 Ga0075431_1000120637 271
239 3300006847 Ga0075431_100407340 Ga0075431_1004073401 271
240 3300006871 Ga0075434_100176345 Ga0075434_1001763452 271
241 3300006880 Ga0075429_100007755 Ga0075429_10000775510 271
242 3300006880 Ga0075429_100197152 Ga0075429_1001971522 271
243 3300007076 Ga0075435_100049425 Ga0075435_1000494252 271
244 3300009147 Ga0114129_10041387 Ga0114129_100413874 271
245 3300009147 Ga0114129_10062740 Ga0114129_100627402 271
246 3300009147 Ga0114129_10151425 Ga0114129_101514253 271
247 3300025910 Ga0207684_10265938 Ga0207684_102659382 271
248 3300027665 Ga0209983_1024079 Ga0209983_10240792 271
249 3300031548 Ga0307408_100193839 Ga0307408_1001938391 271
250 3300031548 Ga0307408_100638504 Ga0307408_1006385041 271
251 3300031852 Ga0307410_10087387 Ga0307410_100873873 271
252 3300031995 Ga0307409_100591457 Ga0307409_1005914572 271
253 3300032002 Ga0307416_100152509 Ga0307416_1001525092 271
254 3300049568 Ga0501031_0020113 Ga0501031_0020113_2207_3022 271
255 3300049570 Ga0501033_0359807 Ga0501033_0359807_155_970 271
256 3300049572 Ga0501036_0089404 Ga0501036_0089404_613_1428 271
257 3300049572 Ga0501036_0251741 Ga0501036_0251741_546_1361 271
258 3300049574 Ga0501038_0046754 Ga0501038_0046754_2520_3335 271
259 3300049575 Ga0501039_0083078 Ga0501039_0083078_584_1399 271
260 3300049576 Ga0501040_0017368 Ga0501040_0017368_522_1337 271
261 3300049576 Ga0501040_0020482 Ga0501040_0020482_1532_2347 271
262 3300049577 Ga0501041_0365611 Ga0501041_0365611_46_861 271
263 3300049580 Ga0501046_0007135 Ga0501046_0007135_5719_6534 271
264 3300049584 Ga0501068_0058101 Ga0501068_0058101_331_1146 271
265 3300049586 Ga0501070_0139000 Ga0501070_0139000_839_1654 271
266 3300049587 Ga0501071_0069112 Ga0501071_0069112_1361_2176 271
267 3300049588 Ga0501072_0015209 Ga0501072_0015209_2520_3335 271
268 3300049589 Ga0501073_0038244 Ga0501073_0038244_1572_2387 271
269 3300049590 Ga0501074_0204077 Ga0501074_0204077_518_1333 271
270 3300049591 Ga0501075_0004088 Ga0501075_0004088_2378_3193 271
271 3300049591 Ga0501075_0024279 Ga0501075_0024279_2782_3597 271
272 3300049591 Ga0501075_0068864 Ga0501075_0068864_863_1678 271
273 3300049592 Ga0501076_0003244 Ga0501076_0003244_7069_7884 271
274 3300049592 Ga0501076_0023919 Ga0501076_0023919_2647_3462 271
275 3300049593 Ga0501077_0009393 Ga0501077_0009393_2751_3566 271
276 3300049593 Ga0501077_0044210 Ga0501077_0044210_1041_1856 271
277 3300049593 Ga0501077_0089389 Ga0501077_0089389_680_1495 271
278 3300049741 Ga0501079_0002633 Ga0501079_0002633_8925_9740 271
279 3300049741 Ga0501079_0008761 Ga0501079_0008761_3697_4512 271
280 3300049741 Ga0501079_0100815 Ga0501079_0100815_13_828 271
281 3300049742 Ga0501080_0338345 Ga0501080_0338345_453_1268 271
282 3300049743 Ga0501081_0004120 Ga0501081_0004120_3357_4172 271
283 3300049743 Ga0501081_0006423 Ga0501081_0006423_2956_3771 271
284 3300049743 Ga0501081_0032518 Ga0501081_0032518_1689_2504 271
285 3300049743 Ga0501081_0071340 Ga0501081_0071340_854_1669 271
286 3300049824 Ga0501045_0036525 Ga0501045_0036525_328_1143 271
287 3300050507 nmdc:mga05p37_106014_c1 nmdc:mga05p37_106014_c1_99_968 271
288 3300050507 nmdc:mga05p37_152449_c1 nmdc:mga05p37_152449_c1_1096_1911 271
289 3300050507 nmdc:mga05p37_41612_c1 nmdc:mga05p37_41612_c1_2158_2973 271
290 3300050508 nmdc:mga09592_25306_c1 nmdc:mga09592_25306_c1_4004_4819 271
291 3300050510 nmdc:mga06r32_1319_c1 nmdc:mga06r32_1319_c1_17549_18364 271
292 3300050510 nmdc:mga06r32_56087_c1 nmdc:mga06r32_56087_c1_501_1316 271
293 3300050510 nmdc:mga06r32_89651_c1 nmdc:mga06r32_89651_c1_1675_2490 271
294 3300050512 nmdc:mga0n895_35795_c1 nmdc:mga0n895_35795_c1_659_1528 271
295 3300054114 Ga0501084_0017837 Ga0501084_0017837_3309_4124 271
296 3300060353 Ga0501082_0009524 Ga0501082_0009524_5578_6393 271
297 3300060353 Ga0501082_0028128 Ga0501082_0028128_2145_2960 271
298 3300061734 Ga0530510_0005484 Ga0530510_0005484_115_930 271
299 3300061734 Ga0530510_0194247 Ga0530510_0194247_230_1045 271
300 3300061734 Ga0530510_0229144 Ga0530510_0229144_463_1278 271
301 3300003203 JGI25406J46586_10010136 JGI25406J46586_100101363 272
302 3300005445 Ga0070708_100003480 Ga0070708_1000034801 272
303 3300005467 Ga0070706_100012206 Ga0070706_10001220610 272
304 3300005471 Ga0070698_100016616 Ga0070698_1000166162 272
305 3300005518 Ga0070699_100020026 Ga0070699_1000200263 272
306 3300005536 Ga0070697_100059318 Ga0070697_1000593184 272
307 3300005985 Ga0081539_10000454 Ga0081539_1000045458 272
308 3300006844 Ga0075428_100000958 Ga0075428_10000095815 272
309 3300006844 Ga0075428_100072169 Ga0075428_1000721693 272
310 3300006847 Ga0075431_100001849 Ga0075431_1000018497 272
311 3300006847 Ga0075431_100002433 Ga0075431_1000024336 272
312 3300006847 Ga0075431_100104374 Ga0075431_1001043742 272
313 3300006852 Ga0075433_10051733 Ga0075433_100517333 272
314 3300006852 Ga0075433_10128149 Ga0075433_101281491 272
315 3300006871 Ga0075434_100066624 Ga0075434_1000666244 272
316 3300006871 Ga0075434_100156237 Ga0075434_1001562372 272
317 3300006880 Ga0075429_100011837 Ga0075429_1000118379 272
318 3300006880 Ga0075429_100054061 Ga0075429_1000540612 272
319 3300006914 Ga0075436_100032820 Ga0075436_1000328203 272
320 3300007076 Ga0075435_100030020 Ga0075435_1000300203 272
321 3300009147 Ga0114129_10000441 Ga0114129_1000044152 272
322 3300009147 Ga0114129_10001852 Ga0114129_1000185210 272
323 3300009147 Ga0114129_10004164 Ga0114129_1000416418 272
324 3300009147 Ga0114129_10020175 Ga0114129_100201757 272
325 3300025910 Ga0207684_10000279 Ga0207684_1000027933 272
326 3300025922 Ga0207646_10063285 Ga0207646_100632854 272
327 3300037418 Ga0395900_0132203 Ga0395900_0132203_1601_2419 272
328 3300037471 Ga0395905_0095646 Ga0395905_0095646_241_1059 272
329 3300050507 nmdc:mga05p37_20607_c1 nmdc:mga05p37_20607_c1_2447_3265 272
330 3300050507 nmdc:mga05p37_23863_c1 nmdc:mga05p37_23863_c1_5811_6629 272
331 3300050507 nmdc:mga05p37_2509_c1 nmdc:mga05p37_2509_c1_9035_9853 272
332 3300050507 nmdc:mga05p37_5040_c1 nmdc:mga05p37_5040_c1_11285_12103 272
333 3300050508 nmdc:mga09592_56942_c1 nmdc:mga09592_56942_c1_2455_3285 272
334 3300050508 nmdc:mga09592_86776_c1 nmdc:mga09592_86776_c1_1578_2396 272
335 3300050510 nmdc:mga06r32_21578_c1 nmdc:mga06r32_21578_c1_2550_3380 272
336 3300050510 nmdc:mga06r32_30212_c1 nmdc:mga06r32_30212_c1_538_1356 272
337 3300050512 nmdc:mga0n895_145789_c1 nmdc:mga0n895_145789_c1_434_1252 272
338 3300050513 nmdc:mga0rr50_7359_c1 nmdc:mga0rr50_7359_c1_3140_3958 272
339 3300050514 nmdc:mga08x19_1992_c1 nmdc:mga08x19_1992_c1_1993_2811 272
340 3300050515 nmdc:mga0a205_122157_c1 nmdc:mga0a205_122157_c1_253_1071 272
341 3300050515 nmdc:mga0a205_2294_c1 nmdc:mga0a205_2294_c1_3140_3958 272

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7562 47 91
1r9c-assembly1.cif.gz_A crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.741 49 91
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7314 49 91
2p7m-assembly4.cif.gz_B crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7303 49 91
2p7m-assembly4.cif.gz_D-2 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7182 47 91
ID Description Score Start End Superfamily
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7607 49 91 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7563 47 91 3.10.180.10
3vb0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7442 47 91 3.10.180.10
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7201 5 128 3.30.460.40
af_A4IAC0_1_224_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6382 16 132 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A517SDL2-F1-model_v4 Uncharacterized protein 0.9776 7 255
AF-A0A2N5K9V3-F1-model_v4 Nucleotidyltransferase family protein 0.9764 3 262
AF-K9WEY8-F1-model_v4 Nucleotidyltransferase family protein 0.9749 3 261
AF-A0A1G1GCV8-F1-model_v4 Nucleotidyltransferase family protein 0.9745 3 239
AF-A0A2V8GYY9-F1-model_v4 Nucleotidyltransferase family protein 0.9738 20 262

Feature Viewer

pLDDT pTM Quality
89.95 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map