F414792

General Info

Members Datasets Scaffolds Average Seq Length
341 259 668 176

Family's Representative Sequence

Representative Sequence 3300031616|Ga0307508_10167611|Ga0307508_101676112
Length 197
Sequence VGLIRRFAFRNRQAECAILLLMSNYRRALVQGGCFFFTVNLLERRQTLLVDQIAVLREAVATTRQGHPFTIDAFVVLPDHLHAVWTLPQGDSDFSIRRRLIKNRFAKALPKQERRSAVRKARGERGIWQRRFWEHLIRDEADYARHVEYCYINPLKHRLVARVRDWPYSSFHRDVRAGLFPVDWGGDAETIGEFGER

Samples

Sample ID Description Type Environment
1 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
52 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
64 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
68 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
100 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
117 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
125 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
126 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
127 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
133 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
145 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
146 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
149 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
169 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
190 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
192 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
193 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
194 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
202 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
203 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
204 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
205 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
212 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
213 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
214 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
215 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
216 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
217 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
220 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
221 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
222 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
223 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
224 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
225 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
226 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
227 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
228 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
229 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
230 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
231 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
232 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
233 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
234 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
235 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
236 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
237 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
238 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
239 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
240 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
241 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
242 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
243 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
244 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
245 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
246 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
247 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
248 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
249 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
250 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
251 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
252 2989392574 Methylomonas rhizoryzae GJ1 Isolate Unclassified
253 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
254 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
255 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
256 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
257 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
258 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
259 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.1
Metatranscriptomes 0.59
Isolates 12.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.66
Nodule 8.5
Rhizoplane 5.28
Rhizosphere 60.7
Stem 0
Stem Tuber 0
Unclassified 1.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307508_10167611 3300031616 Bacteria 1800
2 JGI24740J21852_10013537 3300001979 Bacteria 3038
3 JGI24735J21928_10021942 3300002067 Bacteria 1947
4 JGI25153J46596_10001936 3300003215 Bacteria 12289
5 JGI25153J46596_10009626 3300003215 Bacteria 4459
6 rootH2_10097366 3300003320 Bacteria 2353
7 rootL2_10011010 3300003322 Bacteria 1152
8 JGI25404J52841_10010010 3300003659 Bacteria 2034
9 JGI25404J52841_10047605 3300003659 Bacteria 903
10 JGI25404J52841_10078106 3300003659 Bacteria 691
11 Ga0055531_10013028 3300003794 Bacteria 3863
12 Ga0065165_1013394 3300005262 Bacteria 3263
13 Ga0070658_10169068 3300005327 Bacteria 1836
14 Ga0070660_100097363 3300005339 Bacteria 2327
15 Ga0070660_100438539 3300005339 Bacteria 1083
16 Ga0070660_101094621 3300005339 Bacteria 674
17 Ga0070687_100943690 3300005343 Bacteria 621
18 Ga0070668_100096177 3300005347 Bacteria 2340
19 Ga0070671_100043742 3300005355 Bacteria 3722
20 Ga0070709_10057238 3300005434 Bacteria 2469
21 Ga0070711_101197850 3300005439 Bacteria 657
22 Ga0070708_100014002 3300005445 Bacteria 6589
23 Ga0070663_100076664 3300005455 Bacteria 2445
24 Ga0070663_100079290 3300005455 Bacteria 2409
25 Ga0070706_100787539 3300005467 Bacteria 880
26 Ga0070698_100846359 3300005471 Bacteria 859
27 Ga0070679_100713607 3300005530 Bacteria 945
28 Ga0070697_100361528 3300005536 Bacteria 1255
29 Ga0070697_100720965 3300005536 Bacteria 880
30 Ga0068853_100830565 3300005539 Bacteria 886
31 Ga0070665_100913459 3300005548 Bacteria 890
32 Ga0068855_100275906 3300005563 Bacteria 1868
33 Ga0068855_100610172 3300005563 Bacteria 1176
34 Ga0070664_100730035 3300005564 Bacteria 924
35 Ga0068857_100000349 3300005577 Bacteria 31928
36 Ga0068854_100156281 3300005578 Bacteria 1762
37 Ga0068856_101912864 3300005614 Bacteria 604
38 Ga0068852_100194306 3300005616 Bacteria 1917
39 Ga0068859_100536760 3300005617 Bacteria 1264
40 Ga0068851_10070330 3300005834 Bacteria 1810
41 Ga0068851_10104967 3300005834 Unclassified 1503
42 Ga0068863_101748055 3300005841 Bacteria 632
43 Ga0068858_100045210 3300005842 Bacteria 4080
44 Ga0068858_100084060 3300005842 Bacteria 2960
45 Ga0081540_1005547 3300005983 Bacteria 9404
46 Ga0081540_1014974 3300005983 Bacteria 4931
47 Ga0081539_10168167 3300005985 Bacteria 1039
48 Ga0070717_10795110 3300006028 Bacteria 860
49 Ga0070716_100548262 3300006173 Bacteria 862
50 Ga0070712_100666256 3300006175 Bacteria 885
51 Ga0075367_10687191 3300006178 Bacteria 651
52 Ga0075430_100557110 3300006846 Bacteria 945
53 Ga0097620_100536794 3300006931 Bacteria 1264
54 Ga0105240_10014932 3300009093 Bacteria 10581
55 Ga0105240_10215294 3300009093 Unclassified 2242
56 Ga0105240_11322231 3300009093 Bacteria 760
57 Ga0111539_11253113 3300009094 Bacteria 861
58 Ga0105247_10140295 3300009101 Bacteria 1583
59 Ga0114129_10896924 3300009147 Bacteria 1124
60 Ga0105241_10032135 3300009174 Bacteria 3932
61 Ga0105237_10000095 3300009545 Bacteria 121776
62 Ga0105237_10313777 3300009545 Bacteria 1571
63 Ga0105238_10591816 3300009551 Bacteria 1116
64 Ga0105238_10671886 3300009551 Bacteria 1047
65 Ga0105238_12001667 3300009551 Bacteria 613
66 Ga0105239_10181068 3300010375 Bacteria 2358
67 Ga0105239_11037150 3300010375 Bacteria 943
68 Ga0157314_1000008 3300012500 Bacteria 21724
69 Ga0157339_1001997 3300012505 Bacteria 1331
70 Ga0157371_10741435 3300013102 Bacteria 737
71 Ga0157370_10127151 3300013104 Bacteria 2379
72 Ga0157370_10465159 3300013104 Bacteria 1162
73 Ga0157369_10345263 3300013105 Bacteria 1546
74 Ga0157369_10887592 3300013105 Bacteria 914
75 Ga0157378_11154550 3300013297 Bacteria 813
76 Ga0163162_10378374 3300013306 Bacteria 1549
77 Ga0163162_10552777 3300013306 Bacteria 1279
78 Ga0163162_11306035 3300013306 Bacteria 824
79 Ga0157375_10457217 3300013308 Bacteria 1442
80 Ga0157380_10910126 3300014326 Bacteria 906
81 Ga0182008_10087123 3300014497 Bacteria 1538
82 Ga0157379_10533252 3300014968 Bacteria 1091
83 Ga0157376_10299093 3300014969 Bacteria 1522
84 Ga0182007_10043399 3300015262 Bacteria 1494
85 Ga0213876_10108192 3300021384 Bacteria 1475
86 Ga0213875_10001159 3300021388 Bacteria 18080
87 Ga0224712_10476464 3300022467 Bacteria 601
88 Ga0207425_1049641 3300025245 Bacteria 771
89 Ga0209129_1003966 3300025258 Bacteria 6101
90 Ga0209455_1005384 3300025272 Bacteria 3967
91 Ga0209673_1043107 3300025273 Bacteria 1263
92 Ga0209564_1018289 3300025295 Bacteria 2680
93 Ga0209758_1000595 3300025297 Bacteria 56364
94 Ga0209758_1002764 3300025297 Bacteria 17182
95 Ga0209758_1007950 3300025297 Bacteria 7030
96 Ga0209257_1001217 3300025304 Bacteria 32229
97 Ga0207656_10049970 3300025321 Bacteria 1804
98 Ga0207656_10058720 3300025321 Bacteria 1681
99 Ga0207705_10120652 3300025909 Bacteria 1945
100 Ga0207705_10323635 3300025909 Bacteria 1185
101 Ga0207684_10274680 3300025910 Bacteria 1454
102 Ga0207654_10029647 3300025911 Bacteria 2998
103 Ga0207695_10002559 3300025913 Bacteria 26728
104 Ga0207695_10206159 3300025913 Bacteria 1879
105 Ga0207671_10000026 3300025914 Bacteria 268845
106 Ga0207671_10151140 3300025914 Bacteria 1794
107 Ga0207693_10609427 3300025915 Bacteria 850
108 Ga0207660_10010158 3300025917 Bacteria 6099
109 Ga0207657_10223740 3300025919 Unclassified 1507
110 Ga0207652_10090543 3300025921 Bacteria 2688
111 Ga0207694_10540780 3300025924 Bacteria 977
112 Ga0207694_11502548 3300025924 Bacteria 568
113 Ga0207644_10079565 3300025931 Bacteria 2418
114 Ga0207665_10164470 3300025939 Bacteria 1598
115 Ga0207661_10892685 3300025944 Bacteria 819
116 Ga0207661_11250500 3300025944 Bacteria 683
117 Ga0207667_10001181 3300025949 Bacteria 32820
118 Ga0207667_10011354 3300025949 Bacteria 10359
119 Ga0207667_10338877 3300025949 Archaea 1535
120 Ga0207668_10210889 3300025972 Bacteria 1553
121 Ga0207668_10271581 3300025972 Bacteria 1386
122 Ga0207640_10432721 3300025981 Bacteria 1080
123 Ga0207703_10311741 3300026035 Bacteria 1438
124 Ga0207703_11029259 3300026035 Bacteria 790
125 Ga0207639_10151604 3300026041 Bacteria 1942
126 Ga0207678_10031123 3300026067 Bacteria 4656
127 Ga0207678_10037133 3300026067 Bacteria 4239
128 Ga0207678_10091346 3300026067 Bacteria 2602
129 Ga0207674_10000553 3300026116 Bacteria 48913
130 Ga0207674_10044742 3300026116 Bacteria 4559
131 Ga0207698_10085191 3300026142 Bacteria 2565
132 Ga0209974_10061050 3300027876 Bacteria 1276
133 Ga0268266_10188397 3300028379 Bacteria 1882
134 Ga0268266_10676620 3300028379 Bacteria 994
135 Ga0307517_10000495 3300028786 Bacteria 67515
136 Ga0265338_10281409 3300028800 Bacteria 1215
137 Ga0265773_1001606 3300031018 Bacteria 1249
138 Ga0307408_100000173 3300031548 Bacteria 72937
139 Ga0307406_10000603 3300031901 Bacteria 20571
140 Ga0307409_100067714 3300031995 Bacteria 2821
141 Ga0373923_0306169 3300035111 Bacteria 753
142 Ga0373953_0167151 3300035117 Bacteria 946
143 Ga0373956_0022591 3300035119 Bacteria 2693
144 Ga0373957_0015480 3300035120 Bacteria 2626
145 Ga0373935_0779557 3300035692 Bacteria 705
146 Ga0373937_0039116 3300036401 Bacteria 4322
147 Ga0395898_0457601 3300037466 Bacteria 1215
148 Ga0395905_0059812 3300037471 Bacteria 3562
149 Ga0436364_0328145 3300037853 Bacteria 88179
150 Ga0395901_1962709 3300038443 Bacteria 532
151 Ga0400483_141130 3300039062 Bacteria 2326
152 Ga0436365_0265441 3300039437 Bacteria 1829
153 Ga0436365_0728124 3300039437 Bacteria 3187
154 Ga0436361_0786412 3300039447 Bacteria 3331
155 Ga0436363_0307655 3300039450 Bacteria 5498
156 Ga0451791_0873616 3300041451 Bacteria 767
157 Ga0451807_1776840 3300041486 Bacteria 805
158 Ga0451853_1124771 3300041512 Bacteria 1250
159 Ga0451577_0000013 3300042876 Bacteria 550689
160 Ga0466972_0030713 3300044658 Bacteria 2644
161 Ga0453683_0000113 3300044673 Bacteria 121290
162 Ga0453684_0000085 3300044712 Bacteria 397817
163 Ga0466968_0135390 3300044735 Bacteria 1123
164 Ga0466957_0121950 3300044842 Bacteria 1662
165 Ga0466959_0636940 3300045049 Bacteria 716
166 Ga0451576_0000018 3300045051 Bacteria 550689
167 Ga0495592_0100023 3300046454 Bacteria 2068
168 Ga0495592_0326670 3300046454 Bacteria 990
169 Ga0495590_0133346 3300046457 Bacteria 894
170 Ga0495651_0181848 3300046462 Bacteria 1487
171 Ga0495664_0064070 3300046477 Bacteria 2191
172 Ga0495664_0444054 3300046477 Bacteria 777
173 Ga0495585_0380498 3300046492 Bacteria 682
174 Ga0495608_0444767 3300046511 Bacteria 789
175 Ga0495618_0023874 3300046514 Bacteria 3786
176 Ga0495630_0648063 3300046517 Bacteria 809
177 Ga0495648_0198088 3300046524 Bacteria 1008
178 Ga0495652_0135129 3300046529 Bacteria 1947
179 Ga0495640_0134680 3300046533 Bacteria 1596
180 Ga0495645_0373133 3300046543 Bacteria 914
181 Ga0495645_0562139 3300046543 Bacteria 706
182 Ga0495667_0459732 3300046559 Bacteria 799
183 Ga0495634_0198250 3300046642 Bacteria 1248
184 Ga0495635_0343354 3300046663 Bacteria 997
185 Ga0495635_0427413 3300046663 Bacteria 877
186 Ga0495635_0468588 3300046663 Bacteria 831
187 Ga0495661_0162426 3300046665 Bacteria 1198
188 Ga0495588_0384077 3300046674 Bacteria 737
189 Ga0495657_0553432 3300046675 Bacteria 668
190 Ga0495599_0336096 3300046678 Bacteria 907
191 Ga0495623_0229956 3300046679 Bacteria 1052
192 Ga0495623_0370461 3300046679 Bacteria 776
193 Ga0495646_0087128 3300046680 Bacteria 1810
194 Ga0495613_0563995 3300046689 Bacteria 761
195 Ga0495624_0769590 3300046690 Bacteria 570
196 Ga0495600_0153085 3300046809 Bacteria 1492
197 Ga0495604_0147648 3300047317 Bacteria 1674
198 Ga0495604_0402972 3300047317 Bacteria 901
199 Ga0495674_0143172 3300047319 Bacteria 2008
200 Ga0495680_0073681 3300047322 Bacteria 2594
201 Ga0495684_0092399 3300047471 Bacteria 2292
202 Ga0495602_0382793 3300048088 Bacteria 1007
203 Ga0496101_0067317 3300048904 Bacteria 2615
204 Ga0496102_0343161 3300048905 Bacteria 1406
205 Ga0496103_0110987 3300048906 Bacteria 1742
206 Ga0496104_0053049 3300048907 Bacteria 3830
207 Ga0496104_0115398 3300048907 Bacteria 2576
208 Ga0496104_0450067 3300048907 Bacteria 1199
209 Ga0496105_0010626 3300048908 Bacteria 7242
210 Ga0496105_0084355 3300048908 Bacteria 2624
211 Ga0496106_0304653 3300048909 Bacteria 1278
212 Ga0496107_0199507 3300048910 Bacteria 1487
213 Ga0496109_0102301 3300048912 Bacteria 2659
214 Ga0496109_1242210 3300048912 Bacteria 681
215 Ga0496110_0079387 3300048913 Bacteria 2922
216 Ga0496113_0561822 3300048916 Bacteria 915
217 Ga0496115_0048012 3300048918 Bacteria 3415
218 Ga0496115_0048202 3300048918 Bacteria 3407
219 Ga0496117_0092256 3300048920 Bacteria 1946
220 Ga0496119_0135138 3300048922 Bacteria 1338
221 Ga0496120_0026060 3300048923 Bacteria 3618
222 Ga0496120_0063941 3300048923 Bacteria 2045
223 Ga0496121_0032137 3300048924 Bacteria 4777
224 Ga0496121_0053282 3300048924 Bacteria 3390
225 Ga0496121_0177118 3300048924 Bacteria 1543
226 Ga0496122_0117648 3300048925 Bacteria 1725
227 Ga0496126_0020646 3300048929 Bacteria 6452
228 Ga0496126_0057394 3300048929 Bacteria 3515
229 Ga0496126_0220854 3300048929 Bacteria 1592
230 Ga0496126_0362647 3300048929 Bacteria 1183
231 Ga0501031_0282625 3300049568 Bacteria 1076
232 Ga0501032_0102020 3300049569 Bacteria 1901
233 Ga0501032_0621089 3300049569 Unclassified 687
234 Ga0501033_0033897 3300049570 Bacteria 3832
235 Ga0501034_0051907 3300049571 Bacteria 4133
236 Ga0501034_0414064 3300049571 Bacteria 1269
237 Ga0501036_0068612 3300049572 Bacteria 3000
238 Ga0501037_0039989 3300049573 Bacteria 3451
239 Ga0501038_0019027 3300049574 Bacteria 6196
240 Ga0501043_0127282 3300049579 Bacteria 1997
241 Ga0501047_0379425 3300049581 Bacteria 1248
242 Ga0501048_0806288 3300049582 Bacteria 675
243 Ga0501070_0150483 3300049586 Bacteria 1920
244 Ga0501072_0012996 3300049588 Bacteria 6371
245 Ga0501221_129272 3300049704 Bacteria 652
246 Ga0501225_0000648 3300049705 Bacteria 10816
247 Ga0501083_0050827 3300049744 Bacteria 2789
248 Ga0501083_0317878 3300049744 Bacteria 1012
249 Ga0501035_0035833 3300049822 Bacteria 4501
250 Ga0501035_0049930 3300049822 Bacteria 3750
251 Ga0501044_0043461 3300049823 Bacteria 4667
252 Ga0501044_0186380 3300049823 Bacteria 2039
253 nmdc:mga0k408_220276_c1 3300050493 Bacteria 1133
254 nmdc:mga0k408_289725_c1 3300050493 Bacteria 977
255 nmdc:mga06z11_36600_c1 3300050494 Bacteria 2424
256 nmdc:mga06z11_491869_c1 3300050494 Bacteria 743
257 nmdc:mga05p37_258554_c1 3300050507 Bacteria 2085
258 nmdc:mga0qj67_347464_c1 3300050509 Bacteria 1199
259 nmdc:mga08y16_1162224_c1 3300050511 Bacteria 744
260 nmdc:mga08y16_506193_c1 3300050511 Bacteria 1226
261 Ga0495601_0065733 3300053077 Bacteria 2308
262 Ga0495601_0493662 3300053077 Bacteria 790
263 Ga0495612_0384641 3300053078 Bacteria 636
264 Ga0495595_0056020 3300053084 Bacteria 1836
265 Ga0495619_0201284 3300053085 Bacteria 1378
266 Ga0500647_0095572 3300053091 Bacteria 1421
267 Ga0500583_0281204 3300053092 Bacteria 817
268 Ga0500583_0351430 3300053092 Bacteria 714
269 Ga0500566_0004572 3300053094 Bacteria 8253
270 Ga0500640_022404 3300053095 Bacteria 2730
271 Ga0500572_000518 3300053111 Bacteria 13190
272 Ga0500572_017641 3300053111 Bacteria 1836
273 Ga0500608_039784 3300053122 Bacteria 2252
274 Ga0500608_149480 3300053122 Bacteria 1025
275 Ga0500614_000454 3300053123 Bacteria 10610
276 Ga0500642_0081708 3300053130 Bacteria 1485
277 Ga0500559_0000390 3300053136 Bacteria 32086
278 Ga0500559_0005915 3300053136 Bacteria 5568
279 Ga0500559_0310539 3300053136 Bacteria 740
280 Ga0500590_052832 3300053148 Bacteria 2061
281 Ga0500590_204666 3300053148 Bacteria 831
282 Ga0500603_001485 3300053150 Bacteria 5348
283 Ga0500630_007993 3300053159 Bacteria 5180
284 Ga0500638_041334 3300053162 Bacteria 2239
285 Ga0500639_000020 3300053163 Bacteria 102959
286 Ga0500639_051297 3300053163 Bacteria 2148
287 Ga0500596_001016 3300053735 Bacteria 5626
288 Ga0500596_001318 3300053735 Bacteria 5001
289 Ga0500601_015710 3300053737 Bacteria 861
290 Ga0500601_023481 3300053737 Bacteria 716
291 Ga0501084_0250763 3300054114 Bacteria 1494
292 Ga0501082_0000013 3300060353 Bacteria 119623
293 2508541834 2508501009 Bacteria 7784016
294 2508694450 2508501042 Bacteria 8719808
295 2513856401 2513237137 Bacteria 9558895
296 2513872832 2513237139 Bacteria 8737671
297 2524437425 2524023205 Bacteria 8918781
298 2745076584 2744054633 Bacteria 8678936
299 2793062341 2791355196 Bacteria 7323613
300 2805915270 2802429603 Bacteria 8777136
301 2824608037 2824600985 Bacteria 8488197
302 2824616596 2824609381 Bacteria 8672835
303 2824658697 2824653114 Bacteria 8493680
304 2824739543 2824732956 Bacteria 7810675
305 2824780632 2824773399 Bacteria 8360218
306 2847946629 2847939898 Bacteria 8606328
307 2849077108 2849076700 Bacteria 7039503
308 2881368773 2881364244 Bacteria 7710352
309 2885375579 2885374607 Bacteria 8927485
310 2903730991 2903727486 Bacteria 8281579
311 2904691272 2904690495 Bacteria 9412302
312 2908759086 2908756301 Bacteria 8864324
313 2932810846 2932809354 Bacteria 9135765
314 2932823822 2932818245 Bacteria 9955613
315 2935701143 2935694250 Bacteria 9291695
316 2935766568 2935760218 Bacteria 9817913
317 2935838386 2935837841 Bacteria 9454360
318 2935909038 2935908558 Bacteria 8568796
319 2935919758 2935916978 Bacteria 9113783
320 2935926388 2935926038 Bacteria 8601059
321 2935934838 2935934488 Bacteria 8602579
322 2935943288 2935942939 Bacteria 8599779
323 2935951726 2935951376 Bacteria 8602333
324 2935967851 2935967501 Bacteria 8603075
325 2941538946 2941538514 Bacteria 9402094
326 2989396170 2989392574 Bacteria 4554005
327 3005481170 3005474847 Bacteria 9259049
328 3005588560 3005587118 Bacteria 7794411
329 8006927085 8006926726 Bacteria 6749210
330 8016637087 8016630954 Bacteria 9217207
331 8016640203 8016630954 Bacteria 9217207
332 8019658481 8019648815 Bacteria 10014479
333 8019690145 8019687851 Bacteria 8712826
334 8056684922 8056681323 Bacteria 8472857
335 Ga0307508_10167611
336 JGI24740J21852_10013537
337 JGI24735J21928_10021942
338 JGI25153J46596_10001936
339 JGI25153J46596_10009626
340 rootH2_10097366
341 rootL2_10011010
342 JGI25404J52841_10010010
343 JGI25404J52841_10047605
344 JGI25404J52841_10078106
345 Ga0055531_10013028
346 Ga0065165_1013394
347 Ga0070658_10169068
348 Ga0070660_100097363
349 Ga0070660_100438539
350 Ga0070660_101094621
351 Ga0070687_100943690
352 Ga0070668_100096177
353 Ga0070671_100043742
354 Ga0070709_10057238
355 Ga0070711_101197850
356 Ga0070708_100014002
357 Ga0070663_100076664
358 Ga0070663_100079290
359 Ga0070706_100787539
360 Ga0070698_100846359
361 Ga0070679_100713607
362 Ga0070697_100361528
363 Ga0070697_100720965
364 Ga0068853_100830565
365 Ga0070665_100913459
366 Ga0068855_100275906
367 Ga0068855_100610172
368 Ga0070664_100730035
369 Ga0068857_100000349
370 Ga0068854_100156281
371 Ga0068856_101912864
372 Ga0068852_100194306
373 Ga0068859_100536760
374 Ga0068851_10070330
375 Ga0068851_10104967
376 Ga0068863_101748055
377 Ga0068858_100045210
378 Ga0068858_100084060
379 Ga0081540_1005547
380 Ga0081540_1014974
381 Ga0081539_10168167
382 Ga0070717_10795110
383 Ga0070716_100548262
384 Ga0070712_100666256
385 Ga0075367_10687191
386 Ga0075430_100557110
387 Ga0097620_100536794
388 Ga0105240_10014932
389 Ga0105240_10215294
390 Ga0105240_11322231
391 Ga0111539_11253113
392 Ga0105247_10140295
393 Ga0114129_10896924
394 Ga0105241_10032135
395 Ga0105237_10000095
396 Ga0105237_10313777
397 Ga0105238_10591816
398 Ga0105238_10671886
399 Ga0105238_12001667
400 Ga0105239_10181068
401 Ga0105239_11037150
402 Ga0157314_1000008
403 Ga0157339_1001997
404 Ga0157371_10741435
405 Ga0157370_10127151
406 Ga0157370_10465159
407 Ga0157369_10345263
408 Ga0157369_10887592
409 Ga0157378_11154550
410 Ga0163162_10378374
411 Ga0163162_10552777
412 Ga0163162_11306035
413 Ga0157375_10457217
414 Ga0157380_10910126
415 Ga0182008_10087123
416 Ga0157379_10533252
417 Ga0157376_10299093
418 Ga0182007_10043399
419 Ga0213876_10108192
420 Ga0213875_10001159
421 Ga0224712_10476464
422 Ga0207425_1049641
423 Ga0209129_1003966
424 Ga0209455_1005384
425 Ga0209673_1043107
426 Ga0209564_1018289
427 Ga0209758_1000595
428 Ga0209758_1002764
429 Ga0209758_1007950
430 Ga0209257_1001217
431 Ga0207656_10049970
432 Ga0207656_10058720
433 Ga0207705_10120652
434 Ga0207705_10323635
435 Ga0207684_10274680
436 Ga0207654_10029647
437 Ga0207695_10002559
438 Ga0207695_10206159
439 Ga0207671_10000026
440 Ga0207671_10151140
441 Ga0207693_10609427
442 Ga0207660_10010158
443 Ga0207657_10223740
444 Ga0207652_10090543
445 Ga0207694_10540780
446 Ga0207694_11502548
447 Ga0207644_10079565
448 Ga0207665_10164470
449 Ga0207661_10892685
450 Ga0207661_11250500
451 Ga0207667_10001181
452 Ga0207667_10011354
453 Ga0207667_10338877
454 Ga0207668_10210889
455 Ga0207668_10271581
456 Ga0207640_10432721
457 Ga0207703_10311741
458 Ga0207703_11029259
459 Ga0207639_10151604
460 Ga0207678_10031123
461 Ga0207678_10037133
462 Ga0207678_10091346
463 Ga0207674_10000553
464 Ga0207674_10044742
465 Ga0207698_10085191
466 Ga0209974_10061050
467 Ga0268266_10188397
468 Ga0268266_10676620
469 Ga0307517_10000495
470 Ga0265338_10281409
471 Ga0265773_1001606
472 Ga0307408_100000173
473 Ga0307406_10000603
474 Ga0307409_100067714
475 Ga0373923_0306169
476 Ga0373953_0167151
477 Ga0373956_0022591
478 Ga0373957_0015480
479 Ga0373935_0779557
480 Ga0373937_0039116
481 Ga0395898_0457601
482 Ga0395905_0059812
483 Ga0436364_0328145
484 Ga0395901_1962709
485 Ga0400483_141130
486 Ga0436365_0265441
487 Ga0436365_0728124
488 Ga0436361_0786412
489 Ga0436363_0307655
490 Ga0451791_0873616
491 Ga0451807_1776840
492 Ga0451853_1124771
493 Ga0451577_0000013
494 Ga0466972_0030713
495 Ga0453683_0000113
496 Ga0453684_0000085
497 Ga0466968_0135390
498 Ga0466957_0121950
499 Ga0466959_0636940
500 Ga0451576_0000018
501 Ga0495592_0100023
502 Ga0495592_0326670
503 Ga0495590_0133346
504 Ga0495651_0181848
505 Ga0495664_0064070
506 Ga0495664_0444054
507 Ga0495585_0380498
508 Ga0495608_0444767
509 Ga0495618_0023874
510 Ga0495630_0648063
511 Ga0495648_0198088
512 Ga0495652_0135129
513 Ga0495640_0134680
514 Ga0495645_0373133
515 Ga0495645_0562139
516 Ga0495667_0459732
517 Ga0495634_0198250
518 Ga0495635_0343354
519 Ga0495635_0427413
520 Ga0495635_0468588
521 Ga0495661_0162426
522 Ga0495588_0384077
523 Ga0495657_0553432
524 Ga0495599_0336096
525 Ga0495623_0229956
526 Ga0495623_0370461
527 Ga0495646_0087128
528 Ga0495613_0563995
529 Ga0495624_0769590
530 Ga0495600_0153085
531 Ga0495604_0147648
532 Ga0495604_0402972
533 Ga0495674_0143172
534 Ga0495680_0073681
535 Ga0495684_0092399
536 Ga0495602_0382793
537 Ga0496101_0067317
538 Ga0496102_0343161
539 Ga0496103_0110987
540 Ga0496104_0053049
541 Ga0496104_0115398
542 Ga0496104_0450067
543 Ga0496105_0010626
544 Ga0496105_0084355
545 Ga0496106_0304653
546 Ga0496107_0199507
547 Ga0496109_0102301
548 Ga0496109_1242210
549 Ga0496110_0079387
550 Ga0496113_0561822
551 Ga0496115_0048012
552 Ga0496115_0048202
553 Ga0496117_0092256
554 Ga0496119_0135138
555 Ga0496120_0026060
556 Ga0496120_0063941
557 Ga0496121_0032137
558 Ga0496121_0053282
559 Ga0496121_0177118
560 Ga0496122_0117648
561 Ga0496126_0020646
562 Ga0496126_0057394
563 Ga0496126_0220854
564 Ga0496126_0362647
565 Ga0501031_0282625
566 Ga0501032_0102020
567 Ga0501032_0621089
568 Ga0501033_0033897
569 Ga0501034_0051907
570 Ga0501034_0414064
571 Ga0501036_0068612
572 Ga0501037_0039989
573 Ga0501038_0019027
574 Ga0501043_0127282
575 Ga0501047_0379425
576 Ga0501048_0806288
577 Ga0501070_0150483
578 Ga0501072_0012996
579 Ga0501221_129272
580 Ga0501225_0000648
581 Ga0501083_0050827
582 Ga0501083_0317878
583 Ga0501035_0035833
584 Ga0501035_0049930
585 Ga0501044_0043461
586 Ga0501044_0186380
587 nmdc:mga0k408_220276_c1
588 nmdc:mga0k408_289725_c1
589 nmdc:mga06z11_36600_c1
590 nmdc:mga06z11_491869_c1
591 nmdc:mga05p37_258554_c1
592 nmdc:mga0qj67_347464_c1
593 nmdc:mga08y16_1162224_c1
594 nmdc:mga08y16_506193_c1
595 Ga0495601_0065733
596 Ga0495601_0493662
597 Ga0495612_0384641
598 Ga0495595_0056020
599 Ga0495619_0201284
600 Ga0500647_0095572
601 Ga0500583_0281204
602 Ga0500583_0351430
603 Ga0500566_0004572
604 Ga0500640_022404
605 Ga0500572_000518
606 Ga0500572_017641
607 Ga0500608_039784
608 Ga0500608_149480
609 Ga0500614_000454
610 Ga0500642_0081708
611 Ga0500559_0000390
612 Ga0500559_0005915
613 Ga0500559_0310539
614 Ga0500590_052832
615 Ga0500590_204666
616 Ga0500603_001485
617 Ga0500630_007993
618 Ga0500638_041334
619 Ga0500639_000020
620 Ga0500639_051297
621 Ga0500596_001016
622 Ga0500596_001318
623 Ga0500601_015710
624 Ga0500601_023481
625 Ga0501084_0250763
626 Ga0501082_0000013
627 2508541834
628 2508694450
629 2513856401
630 2513872832
631 2524437425
632 2745076584
633 2793062341
634 2805915270
635 2824608037
636 2824616596
637 2824658697
638 2824739543
639 2824780632
640 2847946629
641 2849077108
642 2881368773
643 2885375579
644 2903730991
645 2904691272
646 2908759086
647 2932810846
648 2932823822
649 2935701143
650 2935766568
651 2935838386
652 2935909038
653 2935919758
654 2935926388
655 2935934838
656 2935943288
657 2935951726
658 2935967851
659 2941538946
660 2989396170
661 3005481170
662 3005588560
663 8006927085
664 8016637087
665 8016640203
666 8019658481
667 8019690145
668 8056684922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8748 1 176
4er8-assembly1.cif.gz_A structure of the rep associates tyrosine transposase bound to a rep hairpin 0.8593 1 176
2a6m-assembly2.cif.gz_A-2 crystal structure of the ishp608 transposase 0.6906 11 127
2a6o-assembly1.cif.gz_A crystal structure of the ishp608 transposase in complex with stem-loop dna 0.6887 11 130
3ab2-assembly3.cif.gz_L crystal structure of aspartate kinase from corynebacterium glutamicum in complex with threonine 0.6884 11 83
ID Description Score Start End Superfamily
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8748 1 176 3.30.70.1290
4er8A00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Transposase IS200-like 0.8593 1 176 3.30.70.1290
af_A0A1D6LBY0_366_425_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.7258 14 79 3.30.70.260
af_A0A1D6K384_16_63_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.722 14 63 3.30.70.260
2zhoB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.705 12 64 3.30.70.260
ID Description Score Start End GO Terms
AF-A0A525CVN9-F1-model_v4 Transposase 0.9813 42 163 GO:0004803
GO:0006313
GO:0043565
AF-A0A0E9MJL9-F1-model_v4 Transposase 0.9801 3 151 GO:0004803
GO:0006313
GO:0043565
AF-A0A809R759-F1-model_v4 Transposase IS200-like domain-containing protein 0.9787 29 136 GO:0004803
GO:0006313
GO:0043565
AF-A0A290TI02-F1-model_v4 deleted 0.978 28 163
AF-A0A2S0VXS1-F1-model_v4 Transposase 0.9766 3 163 GO:0004803
GO:0006313
GO:0043565

Map