F414808

General Info

Members Datasets Scaffolds Average Seq Length
341 149 340 501

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0012649|Ga0373937_0012649_4870_6438
Length 511
Sequence MGEPFYITTAISYPNGPPHIGHAYEAIAADTIARFRRAQGRDVRFQTGTDEHGLKMAQAARVEGVEPRAFSDKMSRLFQEMCDTLNVSYDRFIRTSQEDHYRASQAIWKAMEERGDLYLDRYEGWYSVRDEAYYEPDELTSAKDGSKLSPNGTPVEWTVEESWFFRLSKYQQPLLDLYAANHDFIRPESRRNEVVRFVEGGLKDLSISRTSFDWGVPVPGSNHHVMYVWLDALTNYITGLGYPDDTELWRRYWPADLHLIGKDVVRFHAVMSAGIELPRQVYGHGGEKMSKSVGNVVNPMVLADRFGVDALRYFLLREVTFGQDGSYSAEAIVSRANAELANSFGNLAQRVLTQIVRNCGGGLPEIHGHNDADNGLLNIVCGAASEAIPTAYGDLALNKACEAWIQAVFACNAYIDEQAPWALKKTDPDRMQTVLATLYISIAVLAVAIRPVIPASADRLLESMGVGQELRTFDGILGHWYSPLAESDFQLAQPTPLFPRLELPEDEEAAA

Samples

Sample ID Description Type Environment
1 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
66 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
135 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
148 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
149 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0
Isolates 0.29

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.93
Nodule 0
Rhizoplane 4.69
Rhizosphere 92.08
Stem 0
Stem Tuber 0
Unclassified 0.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10003831 3300001990 Bacteria 5289
2 JGI24737J22298_10004542 3300001990 Bacteria 4828
3 JGI24738J21930_10000519 3300002075 Bacteria 10982
4 Ga0070658_10033453 3300005327 Bacteria 4136
5 Ga0070658_10104740 3300005327 Bacteria 2340
6 Ga0070670_100005677 3300005331 Bacteria 10535
7 Ga0070670_100048761 3300005331 Bacteria 3644
8 Ga0070670_100132105 3300005331 Bacteria 2156
9 Ga0070677_10013321 3300005333 Bacteria 2874
10 Ga0068869_100035811 3300005334 Bacteria 3520
11 Ga0068869_100101496 3300005334 Bacteria 2176
12 Ga0070666_10003943 3300005335 Bacteria 9013
13 Ga0070680_100001206 3300005336 Bacteria 18626
14 Ga0070680_100029910 3300005336 Bacteria 4373
15 Ga0070680_100068954 3300005336 Bacteria 2903
16 Ga0068868_100073687 3300005338 Bacteria 2726
17 Ga0070660_100004042 3300005339 Bacteria 10126
18 Ga0070660_100015215 3300005339 Bacteria 5551
19 Ga0070660_100065513 3300005339 Bacteria 2827
20 Ga0070661_100032625 3300005344 Bacteria 3769
21 Ga0070692_10007731 3300005345 Bacteria 4758
22 Ga0070669_100000384 3300005353 Bacteria 33927
23 Ga0070669_100031751 3300005353 Bacteria 3814
24 Ga0070669_100057236 3300005353 Bacteria 2860
25 Ga0070669_100058841 3300005353 Bacteria 2821
26 Ga0070675_100006030 3300005354 Bacteria 9285
27 Ga0070675_100057431 3300005354 Bacteria 3208
28 Ga0070671_100001018 3300005355 Bacteria 20600
29 Ga0070671_100005846 3300005355 Bacteria 9800
30 Ga0070671_100013189 3300005355 Bacteria 6657
31 Ga0070671_100017215 3300005355 Bacteria 5851
32 Ga0070673_100000180 3300005364 Bacteria 30888
33 Ga0070673_100001134 3300005364 Bacteria 15327
34 Ga0070673_100078725 3300005364 Bacteria 2667
35 Ga0070659_100000688 3300005366 Bacteria 24629
36 Ga0070659_100001983 3300005366 Bacteria 14621
37 Ga0070659_100018486 3300005366 Bacteria 5259
38 Ga0070667_100001415 3300005367 Bacteria 21477
39 Ga0070667_100005354 3300005367 Bacteria 10719
40 Ga0070667_100018647 3300005367 Bacteria 5755
41 Ga0070667_100077404 3300005367 Bacteria 2840
42 Ga0070709_10033181 3300005434 Bacteria 3120
43 Ga0070714_100094031 3300005435 Bacteria 2631
44 Ga0070713_100006979 3300005436 Bacteria 7886
45 Ga0070663_100008010 3300005455 Bacteria 6475
46 Ga0070663_100028315 3300005455 Bacteria 3814
47 Ga0070663_100097715 3300005455 Bacteria 2186
48 Ga0070678_100001830 3300005456 Bacteria 11471
49 Ga0070678_100085709 3300005456 Bacteria 2401
50 Ga0070662_100008505 3300005457 Bacteria 6695
51 Ga0070662_100024525 3300005457 Bacteria 4156
52 Ga0070662_100076763 3300005457 Bacteria 2477
53 Ga0068867_100001815 3300005459 Bacteria 14879
54 Ga0070679_100057479 3300005530 Bacteria 3877
55 Ga0068853_100000664 3300005539 Bacteria 23670
56 Ga0068853_100023270 3300005539 Bacteria 5183
57 Ga0068853_100111448 3300005539 Bacteria 2431
58 Ga0070672_100014102 3300005543 Bacteria 5656
59 Ga0070672_100085383 3300005543 Bacteria 2537
60 Ga0070672_100181676 3300005543 Bacteria 1753
61 Ga0070665_100067591 3300005548 Bacteria 3583
62 Ga0070665_100092605 3300005548 Bacteria 3027
63 Ga0068855_100133833 3300005563 Bacteria 2829
64 Ga0068855_100149612 3300005563 Bacteria 2655
65 Ga0070664_100000817 3300005564 Bacteria 23950
66 Ga0070664_100002414 3300005564 Bacteria 15014
67 Ga0070664_100011632 3300005564 Bacteria 7142
68 Ga0070664_100032465 3300005564 Bacteria 4368
69 Ga0068857_100002689 3300005577 Bacteria 14597
70 Ga0068857_100076627 3300005577 Bacteria 2983
71 Ga0068854_100012325 3300005578 Bacteria 5595
72 Ga0068854_100027242 3300005578 Bacteria 3937
73 Ga0068854_100048497 3300005578 Bacteria 3031
74 Ga0068856_100010774 3300005614 Bacteria 8879
75 Ga0068856_100083221 3300005614 Bacteria 3177
76 Ga0068856_100189240 3300005614 Bacteria 2072
77 Ga0068852_100002278 3300005616 Bacteria 13189
78 Ga0068852_100002794 3300005616 Bacteria 12096
79 Ga0068852_100014953 3300005616 Bacteria 5999
80 Ga0068852_100056848 3300005616 Bacteria 3383
81 Ga0068852_100135362 3300005616 Bacteria 2274
82 Ga0068859_100002250 3300005617 Bacteria 19574
83 Ga0068859_100006621 3300005617 Bacteria 11765
84 Ga0068864_100000399 3300005618 Bacteria 37643
85 Ga0068864_100001958 3300005618 Bacteria 16928
86 Ga0068864_100042444 3300005618 Bacteria 3892
87 Ga0068863_100002337 3300005841 Bacteria 18844
88 Ga0068863_100005049 3300005841 Bacteria 13013
89 Ga0068858_100000377 3300005842 Bacteria 46611
90 Ga0068858_100031323 3300005842 Bacteria 4939
91 Ga0068858_100051308 3300005842 Bacteria 3816
92 Ga0068860_100001953 3300005843 Bacteria 21801
93 Ga0068860_100024432 3300005843 Bacteria 5839
94 Ga0068860_100185279 3300005843 Bacteria 2013
95 Ga0068862_100018887 3300005844 Bacteria 5744
96 Ga0097621_100018861 3300006237 Bacteria 5282
97 Ga0068871_100003403 3300006358 Bacteria 10933
98 Ga0097620_100002250 3300006931 Bacteria 19574
99 Ga0097620_100006620 3300006931 Bacteria 11765
100 Ga0105240_10016997 3300009093 Bacteria 9827
101 Ga0105240_10148913 3300009093 Bacteria 2790
102 Ga0105241_10015111 3300009174 Bacteria 5655
103 Ga0105242_10081310 3300009176 Bacteria 2709
104 Ga0105248_10000075 3300009177 Bacteria 114243
105 Ga0105248_10002385 3300009177 Bacteria 20869
106 Ga0105248_10002544 3300009177 Bacteria 20305
107 Ga0105248_10006733 3300009177 Bacteria 12600
108 Ga0105248_10014828 3300009177 Bacteria 8583
109 Ga0105248_10186364 3300009177 Bacteria 2338
110 Ga0105238_10057312 3300009551 Bacteria 3907
111 Ga0105238_10302623 3300009551 Bacteria 1583
112 Ga0105239_10035405 3300010375 Bacteria 5483
113 Ga0105246_10004062 3300011119 Bacteria 8891
114 Ga0105246_10129176 3300011119 Bacteria 1884
115 Ga0157373_10018175 3300013100 Bacteria 5120
116 Ga0157373_10048092 3300013100 Bacteria 3042
117 Ga0157371_10001127 3300013102 Bacteria 28864
118 Ga0157371_10002068 3300013102 Bacteria 19673
119 Ga0157370_10058430 3300013104 Bacteria 3666
120 Ga0157369_10014674 3300013105 Bacteria 8841
121 Ga0157369_10034388 3300013105 Bacteria 5562
122 Ga0157369_10042744 3300013105 Bacteria 4943
123 Ga0157374_10001130 3300013296 Bacteria 22903
124 Ga0157374_10003689 3300013296 Bacteria 12872
125 Ga0157378_10066736 3300013297 Bacteria 3223
126 Ga0163162_10002867 3300013306 Bacteria 16409
127 Ga0163162_10101756 3300013306 Bacteria 2966
128 Ga0157372_10267926 3300013307 Bacteria 1984
129 Ga0157375_10001954 3300013308 Bacteria 17763
130 Ga0157375_10002415 3300013308 Bacteria 16179
131 Ga0157375_10016641 3300013308 Bacteria 6613
132 Ga0163163_10000161 3300014325 Bacteria 70120
133 Ga0163163_10008545 3300014325 Bacteria 9102
134 Ga0163163_10043207 3300014325 Bacteria 4418
135 Ga0157379_10003583 3300014968 Bacteria 13157
136 Ga0163161_10010826 3300017792 Bacteria 6322
137 Ga0207425_1000026 3300025245 Bacteria 301303
138 Ga0209129_1000741 3300025258 Bacteria 20872
139 Ga0209676_1006505 3300025292 Bacteria 5746
140 Ga0209025_1000551 3300025294 Bacteria 69956
141 Ga0209758_1000004 3300025297 Bacteria 1375322
142 Ga0209050_1000001 3300025298 Bacteria 3563507
143 Ga0209050_1000550 3300025298 Bacteria 61775
144 Ga0209051_1000336 3300025303 Bacteria 70491
145 Ga0209257_1002584 3300025304 Bacteria 17601
146 Ga0209257_1005603 3300025304 Bacteria 8704
147 Ga0207697_10000146 3300025315 Bacteria 34541
148 Ga0207682_10006168 3300025893 Bacteria 4845
149 Ga0207682_10011792 3300025893 Bacteria 3414
150 Ga0207688_10030304 3300025901 Bacteria 2982
151 Ga0207680_10005331 3300025903 Bacteria 6138
152 Ga0207680_10091575 3300025903 Bacteria 1935
153 Ga0207647_10000073 3300025904 Bacteria 76404
154 Ga0207647_10000793 3300025904 Bacteria 24512
155 Ga0207647_10008399 3300025904 Bacteria 7406
156 Ga0207705_10002962 3300025909 Bacteria 12977
157 Ga0207705_10021648 3300025909 Bacteria 4588
158 Ga0207705_10040464 3300025909 Bacteria 3343
159 Ga0207707_10009817 3300025912 Bacteria 8301
160 Ga0207695_10122354 3300025913 Bacteria 2569
161 Ga0207660_10001042 3300025917 Bacteria 18335
162 Ga0207657_10003761 3300025919 Bacteria 16125
163 Ga0207657_10010596 3300025919 Bacteria 9187
164 Ga0207657_10013058 3300025919 Bacteria 8162
165 Ga0207657_10027057 3300025919 Bacteria 5258
166 Ga0207657_10038237 3300025919 Bacteria 4275
167 Ga0207657_10052175 3300025919 Bacteria 3551
168 Ga0207657_10086991 3300025919 Bacteria 2615
169 Ga0207657_10126793 3300025919 Bacteria 2096
170 Ga0207649_10019488 3300025920 Bacteria 3877
171 Ga0207649_10039964 3300025920 Bacteria 2847
172 Ga0207649_10042734 3300025920 Bacteria 2766
173 Ga0207681_10019621 3300025923 Bacteria 4274
174 Ga0207681_10041230 3300025923 Bacteria 3077
175 Ga0207650_10002654 3300025925 Bacteria 12381
176 Ga0207650_10009139 3300025925 Bacteria 6773
177 Ga0207650_10029255 3300025925 Bacteria 3959
178 Ga0207650_10102197 3300025925 Bacteria 2208
179 Ga0207659_10005950 3300025926 Bacteria 7444
180 Ga0207664_10020756 3300025929 Bacteria 4875
181 Ga0207664_10125510 3300025929 Bacteria 2154
182 Ga0207644_10000494 3300025931 Bacteria 25330
183 Ga0207644_10002422 3300025931 Bacteria 12019
184 Ga0207644_10002779 3300025931 Bacteria 11273
185 Ga0207644_10178868 3300025931 Bacteria 1661
186 Ga0207690_10000593 3300025932 Bacteria 23445
187 Ga0207690_10002603 3300025932 Bacteria 10874
188 Ga0207690_10026469 3300025932 Bacteria 3652
189 Ga0207706_10000308 3300025933 Bacteria 52928
190 Ga0207706_10000707 3300025933 Bacteria 34824
191 Ga0207706_10001415 3300025933 Bacteria 24005
192 Ga0207706_10010906 3300025933 Bacteria 8293
193 Ga0207706_10013139 3300025933 Bacteria 7533
194 Ga0207706_10018590 3300025933 Bacteria 6253
195 Ga0207706_10027576 3300025933 Bacteria 5077
196 Ga0207686_10024214 3300025934 Bacteria 3515
197 Ga0207670_10049689 3300025936 Bacteria 2807
198 Ga0207691_10002641 3300025940 Bacteria 17508
199 Ga0207691_10007120 3300025940 Bacteria 10798
200 Ga0207691_10023804 3300025940 Bacteria 5764
201 Ga0207711_10000281 3300025941 Bacteria 54787
202 Ga0207711_10005667 3300025941 Bacteria 10551
203 Ga0207711_10060865 3300025941 Bacteria 3254
204 Ga0207689_10000327 3300025942 Bacteria 44239
205 Ga0207689_10060761 3300025942 Bacteria 3108
206 Ga0207679_10003123 3300025945 Bacteria 10240
207 Ga0207679_10004603 3300025945 Bacteria 8584
208 Ga0207679_10009818 3300025945 Bacteria 6143
209 Ga0207679_10170765 3300025945 Bacteria 1790
210 Ga0207667_10016269 3300025949 Bacteria 8405
211 Ga0207667_10043801 3300025949 Bacteria 4747
212 Ga0207667_10044096 3300025949 Bacteria 4728
213 Ga0207667_10128074 3300025949 Bacteria 2615
214 Ga0207651_10003293 3300025960 Bacteria 7911
215 Ga0207651_10017953 3300025960 Bacteria 4195
216 Ga0207651_10100099 3300025960 Bacteria 2148
217 Ga0207712_10001394 3300025961 Bacteria 16514
218 Ga0207712_10004567 3300025961 Bacteria 8734
219 Ga0207640_10012902 3300025981 Bacteria 4774
220 Ga0207658_10003940 3300025986 Bacteria 10432
221 Ga0207658_10015034 3300025986 Bacteria 5307
222 Ga0207658_10020796 3300025986 Bacteria 4546
223 Ga0207703_10001696 3300026035 Bacteria 19817
224 Ga0207703_10004890 3300026035 Bacteria 10894
225 Ga0207703_10012885 3300026035 Bacteria 6521
226 Ga0207639_10042669 3300026041 Bacteria 3400
227 Ga0207639_10055468 3300026041 Bacteria 3033
228 Ga0207639_10130060 3300026041 Bacteria 2083
229 Ga0207678_10005029 3300026067 Bacteria 11863
230 Ga0207678_10008982 3300026067 Bacteria 8796
231 Ga0207702_10009481 3300026078 Bacteria 8178
232 Ga0207702_10059341 3300026078 Bacteria 3259
233 Ga0207702_10118250 3300026078 Bacteria 2368
234 Ga0207641_10000140 3300026088 Bacteria 105699
235 Ga0207641_10002968 3300026088 Bacteria 15350
236 Ga0207648_10001988 3300026089 Bacteria 22335
237 Ga0207676_10000630 3300026095 Bacteria 28536
238 Ga0207676_10007347 3300026095 Bacteria 7814
239 Ga0207676_10098057 3300026095 Bacteria 2422
240 Ga0207674_10000139 3300026116 Bacteria 84273
241 Ga0207674_10001813 3300026116 Bacteria 27264
242 Ga0207674_10051721 3300026116 Bacteria 4192
243 Ga0207675_100143143 3300026118 Bacteria 2272
244 Ga0207683_10003619 3300026121 Bacteria 13452
245 Ga0207683_10098374 3300026121 Bacteria 2610
246 Ga0207698_10001848 3300026142 Bacteria 12361
247 Ga0207698_10003636 3300026142 Bacteria 9309
248 Ga0207698_10103975 3300026142 Bacteria 2362
249 Ga0207698_10184599 3300026142 Bacteria 1851
250 Ga0268265_10005214 3300028380 Bacteria 8903
251 Ga0268265_10231374 3300028380 Bacteria 1624
252 Ga0268264_10006156 3300028381 Bacteria 10136
253 Ga0307408_100037399 3300031548 Bacteria 3419
254 Ga0307413_10002068 3300031824 Bacteria 8016
255 Ga0307413_10006636 3300031824 Bacteria 5307
256 Ga0307413_10026103 3300031824 Bacteria 3214
257 Ga0307413_10140241 3300031824 Bacteria 1669
258 Ga0307410_10009418 3300031852 Bacteria 5477
259 Ga0307410_10013890 3300031852 Bacteria 4716
260 Ga0307410_10025628 3300031852 Bacteria 3702
261 Ga0307410_10026435 3300031852 Bacteria 3654
262 Ga0307410_10079442 3300031852 Bacteria 2299
263 Ga0307410_10098025 3300031852 Bacteria 2095
264 Ga0307410_10113054 3300031852 Bacteria 1967
265 Ga0307406_10016926 3300031901 Bacteria 4242
266 Ga0307407_10021253 3300031903 Bacteria 3343
267 Ga0307407_10032570 3300031903 Bacteria 2835
268 Ga0307412_10047211 3300031911 Bacteria 2827
269 Ga0307409_100002226 3300031995 Bacteria 10028
270 Ga0307409_100003263 3300031995 Bacteria 8754
271 Ga0307409_100006640 3300031995 Bacteria 6826
272 Ga0307409_100014162 3300031995 Bacteria 5171
273 Ga0307409_100019445 3300031995 Bacteria 4599
274 Ga0307409_100045024 3300031995 Bacteria 3328
275 Ga0307409_100048011 3300031995 Bacteria 3245
276 Ga0307409_100064832 3300031995 Bacteria 2872
277 Ga0307409_100088818 3300031995 Bacteria 2524
278 Ga0307416_100006729 3300032002 Bacteria 7223
279 Ga0307416_100012611 3300032002 Bacteria 5705
280 Ga0307416_100045968 3300032002 Bacteria 3442
281 Ga0307416_100062449 3300032002 Bacteria 3046
282 Ga0307416_100123127 3300032002 Bacteria 2317
283 Ga0307414_10008461 3300032004 Bacteria 5835
284 Ga0307414_10014825 3300032004 Bacteria 4687
285 Ga0307414_10038826 3300032004 Bacteria 3201
286 Ga0307414_10173947 3300032004 Bacteria 1724
287 Ga0307411_10000215 3300032005 Bacteria 18597
288 Ga0307411_10000971 3300032005 Bacteria 10993
289 Ga0307411_10015698 3300032005 Bacteria 4263
290 Ga0307411_10027367 3300032005 Bacteria 3449
291 Ga0307411_10060592 3300032005 Bacteria 2514
292 Ga0307415_100002303 3300032126 Bacteria 9469
293 Ga0307415_100007055 3300032126 Bacteria 6113
294 Ga0307415_100124889 3300032126 Bacteria 1937
295 Ga0373955_0005703 3300035172 Bacteria 5606
296 Ga0373937_0012649 3300036401 Bacteria 7429
297 Ga0395899_0003164 3300037312 Bacteria 13068
298 Ga0395899_0040877 3300037312 Bacteria 3467
299 Ga0395900_0006436 3300037418 Bacteria 12241
300 Ga0395900_0006857 3300037418 Bacteria 11819
301 Ga0395900_0269656 3300037418 Bacteria 1697
302 Ga0395898_0020443 3300037466 Bacteria 6723
303 Ga0395898_0154070 3300037466 Bacteria 2198
304 Ga0395898_0220832 3300037466 Bacteria 1807
305 Ga0395898_0223875 3300037466 Bacteria 1794
306 Ga0395898_0261336 3300037466 Bacteria 1651
307 Ga0395905_0007179 3300037471 Bacteria 11125
308 Ga0395905_0009061 3300037471 Bacteria 9761
309 Ga0395905_0010792 3300037471 Bacteria 8851
310 Ga0395905_0088715 3300037471 Bacteria 2898
311 Ga0395905_0103538 3300037471 Bacteria 2672
312 Ga0395905_0151236 3300037471 Bacteria 2183
313 Ga0395905_0172316 3300037471 Bacteria 2033
314 Ga0395901_0032196 3300038443 Bacteria 5411
315 Ga0395901_0053930 3300038443 Bacteria 4178
316 Ga0395901_0216375 3300038443 Bacteria 2004
317 Ga0436365_0118374 3300039437 Bacteria 1855
318 Ga0439464_0000478 3300042439 Bacteria 8085
319 Ga0466966_0035886 3300044684 Bacteria 3202
320 Ga0466963_0023781 3300044694 Bacteria 3895
321 Ga0466963_0062204 3300044694 Bacteria 2497
322 Ga0466967_0161270 3300045976 Bacteria 2105
323 Ga0495669_0003864 3300046684 Bacteria 6162
324 Ga0496102_0082039 3300048905 Bacteria 2974
325 Ga0496107_0030547 3300048910 Bacteria 3840
326 Ga0496108_0000918 3300048911 Bacteria 22958
327 Ga0496108_0141459 3300048911 Bacteria 2073
328 Ga0496109_0004342 3300048912 Bacteria 11847
329 Ga0496109_0053562 3300048912 Bacteria 3680
330 Ga0496110_0002254 3300048913 Bacteria 14427
331 Ga0496110_0002542 3300048913 Bacteria 13717
332 Ga0496110_0094004 3300048913 Bacteria 2684
333 Ga0496111_0043777 3300048914 Bacteria 3218
334 Ga0496112_0002859 3300048915 Bacteria 14027
335 Ga0496112_0005464 3300048915 Bacteria 10999
336 Ga0496112_0010416 3300048915 Bacteria 8432
337 Ga0496113_0001331 3300048916 Bacteria 13670
338 Ga0496115_0000965 3300048918 Bacteria 20893
339 Ga0501070_0020255 3300049586 Bacteria 5579
340 nmdc:mga0a205_1022_c1 3300050515 Bacteria 23264

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014968 Ga0157379_10003583 Ga0157379_1000358313 454
2 3300048905 Ga0496102_0082039 Ga0496102_0082039_1037_2527 458
3 3300005327 Ga0070658_10033453 Ga0070658_100334534 459
4 3300031995 Ga0307409_100048011 Ga0307409_1000480113 473
5 3300037466 Ga0395898_0220832 Ga0395898_0220832_194_1705 473
6 3300026095 Ga0207676_10098057 Ga0207676_100980571 479
7 3300025245 Ga0207425_1000026 Ga0207425_1000026272 480
8 3300025258 Ga0209129_1000741 Ga0209129_10007417 480
9 3300025294 Ga0209025_1000551 Ga0209025_100055162 480
10 3300025297 Ga0209758_1000004 Ga0209758_10000041214 480
11 3300025304 Ga0209257_1005603 Ga0209257_10056037 480
12 3300035172 Ga0373955_0005703 Ga0373955_0005703_1521_3089 480
13 3300036401 Ga0373937_0012649 Ga0373937_0012649_4870_6438 480
14 iso_pu_bacteria 2599185354 2600203888 480
15 3300025292 Ga0209676_1006505 Ga0209676_10065053 481
16 3300025298 Ga0209050_1000001 Ga0209050_10000013217 481
17 3300025298 Ga0209050_1000550 Ga0209050_100055038 481
18 3300025303 Ga0209051_1000336 Ga0209051_100033665 481
19 3300025304 Ga0209257_1002584 Ga0209257_100258413 481
20 3300031824 Ga0307413_10006636 Ga0307413_100066362 481
21 3300031995 Ga0307409_100006640 Ga0307409_1000066405 481
22 3300032004 Ga0307414_10173947 Ga0307414_101739471 481
23 3300032005 Ga0307411_10015698 Ga0307411_100156983 481
24 3300048918 Ga0496115_0000965 Ga0496115_0000965_1642_3144 481
25 3300031824 Ga0307413_10140241 Ga0307413_101402412 482
26 3300031852 Ga0307410_10098025 Ga0307410_100980252 482
27 3300031995 Ga0307409_100088818 Ga0307409_1000888182 482
28 3300001990 JGI24737J22298_10004542 JGI24737J22298_100045422 483
29 3300005327 Ga0070658_10104740 Ga0070658_101047402 483
30 3300005334 Ga0068869_100101496 Ga0068869_1001014962 483
31 3300005336 Ga0070680_100068954 Ga0070680_1000689543 483
32 3300005339 Ga0070660_100015215 Ga0070660_1000152154 483
33 3300005345 Ga0070692_10007731 Ga0070692_100077314 483
34 3300005455 Ga0070663_100097715 Ga0070663_1000977152 483
35 3300005457 Ga0070662_100076763 Ga0070662_1000767632 483
36 3300005543 Ga0070672_100014102 Ga0070672_1000141022 483
37 3300005842 Ga0068858_100051308 Ga0068858_1000513082 483
38 3300005843 Ga0068860_100024432 Ga0068860_1000244323 483
39 3300011119 Ga0105246_10129176 Ga0105246_101291762 483
40 3300013306 Ga0163162_10101756 Ga0163162_101017563 483
41 3300025904 Ga0207647_10000073 Ga0207647_100000739 483
42 3300025919 Ga0207657_10013058 Ga0207657_100130584 483
43 3300025932 Ga0207690_10002603 Ga0207690_100026033 483
44 3300025933 Ga0207706_10000308 Ga0207706_1000030833 483
45 3300025933 Ga0207706_10001415 Ga0207706_1000141517 483
46 3300025934 Ga0207686_10024214 Ga0207686_100242142 483
47 3300025942 Ga0207689_10060761 Ga0207689_100607612 483
48 3300025961 Ga0207712_10001394 Ga0207712_1000139413 483
49 3300026035 Ga0207703_10012885 Ga0207703_100128854 483
50 3300026067 Ga0207678_10008982 Ga0207678_100089829 483
51 3300028380 Ga0268265_10231374 Ga0268265_102313742 483
52 3300028381 Ga0268264_10006156 Ga0268264_1000615610 483
53 3300032002 Ga0307416_100045968 Ga0307416_1000459683 483
54 3300042439 Ga0439464_0000478 Ga0439464_0000478_4101_5603 483
55 3300049586 Ga0501070_0020255 Ga0501070_0020255_1377_2936 483
56 3300050515 nmdc:mga0a205_1022_c1 nmdc:mga0a205_1022_c1_6626_8128 483
57 3300005336 Ga0070680_100001206 Ga0070680_10000120616 484
58 3300005344 Ga0070661_100032625 Ga0070661_1000326254 484
59 3300005455 Ga0070663_100008010 Ga0070663_1000080102 484
60 3300005530 Ga0070679_100057479 Ga0070679_1000574793 484
61 3300005539 Ga0068853_100023270 Ga0068853_1000232704 484
62 3300005539 Ga0068853_100111448 Ga0068853_1001114482 484
63 3300005543 Ga0070672_100085383 Ga0070672_1000853832 484
64 3300005563 Ga0068855_100133833 Ga0068855_1001338332 484
65 3300005564 Ga0070664_100011632 Ga0070664_1000116324 484
66 3300005578 Ga0068854_100027242 Ga0068854_1000272422 484
67 3300005578 Ga0068854_100048497 Ga0068854_1000484973 484
68 3300005614 Ga0068856_100010774 Ga0068856_1000107746 484
69 3300005614 Ga0068856_100189240 Ga0068856_1001892402 484
70 3300005616 Ga0068852_100002278 Ga0068852_1000022788 484
71 3300005616 Ga0068852_100002794 Ga0068852_1000027944 484
72 3300005616 Ga0068852_100014953 Ga0068852_1000149537 484
73 3300005616 Ga0068852_100056848 Ga0068852_1000568482 484
74 3300009093 Ga0105240_10016997 Ga0105240_100169975 484
75 3300009093 Ga0105240_10148913 Ga0105240_101489133 484
76 3300009177 Ga0105248_10186364 Ga0105248_101863642 484
77 3300009551 Ga0105238_10057312 Ga0105238_100573121 484
78 3300009551 Ga0105238_10302623 Ga0105238_103026231 484
79 3300013100 Ga0157373_10048092 Ga0157373_100480923 484
80 3300013102 Ga0157371_10002068 Ga0157371_1000206818 484
81 3300013105 Ga0157369_10014674 Ga0157369_100146746 484
82 3300013105 Ga0157369_10034388 Ga0157369_100343885 484
83 3300013307 Ga0157372_10267926 Ga0157372_102679262 484
84 3300013308 Ga0157375_10016641 Ga0157375_100166415 484
85 3300017792 Ga0163161_10010826 Ga0163161_100108264 484
86 3300025909 Ga0207705_10021648 Ga0207705_100216486 484
87 3300025913 Ga0207695_10122354 Ga0207695_101223543 484
88 3300025920 Ga0207649_10019488 Ga0207649_100194883 484
89 3300025920 Ga0207649_10039964 Ga0207649_100399642 484
90 3300025929 Ga0207664_10125510 Ga0207664_101255102 484
91 3300025940 Ga0207691_10023804 Ga0207691_100238045 484
92 3300025945 Ga0207679_10009818 Ga0207679_100098184 484
93 3300025949 Ga0207667_10016269 Ga0207667_100162695 484
94 3300025949 Ga0207667_10043801 Ga0207667_100438012 484
95 3300025949 Ga0207667_10044096 Ga0207667_100440964 484
96 3300025981 Ga0207640_10012902 Ga0207640_100129026 484
97 3300026041 Ga0207639_10042669 Ga0207639_100426692 484
98 3300026041 Ga0207639_10130060 Ga0207639_101300602 484
99 3300026067 Ga0207678_10005029 Ga0207678_1000502910 484
100 3300026078 Ga0207702_10009481 Ga0207702_100094815 484
101 3300026078 Ga0207702_10118250 Ga0207702_101182502 484
102 3300026142 Ga0207698_10001848 Ga0207698_100018482 484
103 3300026142 Ga0207698_10003636 Ga0207698_100036364 484
104 3300026142 Ga0207698_10184599 Ga0207698_101845992 484
105 3300031824 Ga0307413_10002068 Ga0307413_100020687 484
106 3300031852 Ga0307410_10009418 Ga0307410_100094186 484
107 3300031852 Ga0307410_10025628 Ga0307410_100256282 484
108 3300031852 Ga0307410_10079442 Ga0307410_100794422 484
109 3300031852 Ga0307410_10113054 Ga0307410_101130542 484
110 3300031903 Ga0307407_10032570 Ga0307407_100325702 484
111 3300031911 Ga0307412_10047211 Ga0307412_100472112 484
112 3300031995 Ga0307409_100003263 Ga0307409_1000032635 484
113 3300031995 Ga0307409_100019445 Ga0307409_1000194452 484
114 3300031995 Ga0307409_100045024 Ga0307409_1000450243 484
115 3300031995 Ga0307409_100064832 Ga0307409_1000648322 484
116 3300032002 Ga0307416_100012611 Ga0307416_1000126112 484
117 3300032002 Ga0307416_100123127 Ga0307416_1001231271 484
118 3300032004 Ga0307414_10008461 Ga0307414_100084614 484
119 3300032004 Ga0307414_10014825 Ga0307414_100148254 484
120 3300032005 Ga0307411_10000215 Ga0307411_1000021510 484
121 3300032005 Ga0307411_10000971 Ga0307411_100009715 484
122 3300032126 Ga0307415_100002303 Ga0307415_1000023035 484
123 3300037312 Ga0395899_0003164 Ga0395899_0003164_9505_11067 484
124 3300037312 Ga0395899_0040877 Ga0395899_0040877_1912_3417 484
125 3300037466 Ga0395898_0020443 Ga0395898_0020443_992_2554 484
126 3300037466 Ga0395898_0154070 Ga0395898_0154070_60_1622 484
127 3300037466 Ga0395898_0261336 Ga0395898_0261336_99_1604 484
128 3300037471 Ga0395905_0009061 Ga0395905_0009061_5531_7036 484
129 3300037471 Ga0395905_0103538 Ga0395905_0103538_789_2294 484
130 3300037471 Ga0395905_0151236 Ga0395905_0151236_60_1622 484
131 3300038443 Ga0395901_0032196 Ga0395901_0032196_1032_2594 484
132 3300038443 Ga0395901_0053930 Ga0395901_0053930_85_1590 484
133 3300048913 Ga0496110_0094004 Ga0496110_0094004_1091_2656 484
134 3300005331 Ga0070670_100005677 Ga0070670_1000056772 485
135 3300005333 Ga0070677_10013321 Ga0070677_100133212 485
136 3300005353 Ga0070669_100031751 Ga0070669_1000317513 485
137 3300005354 Ga0070675_100006030 Ga0070675_1000060307 485
138 3300005355 Ga0070671_100001018 Ga0070671_10000101819 485
139 3300005355 Ga0070671_100017215 Ga0070671_1000172155 485
140 3300005364 Ga0070673_100078725 Ga0070673_1000787252 485
141 3300005434 Ga0070709_10033181 Ga0070709_100331812 485
142 3300005435 Ga0070714_100094031 Ga0070714_1000940312 485
143 3300005436 Ga0070713_100006979 Ga0070713_1000069796 485
144 3300005456 Ga0070678_100085709 Ga0070678_1000857092 485
145 3300005457 Ga0070662_100024525 Ga0070662_1000245253 485
146 3300005543 Ga0070672_100181676 Ga0070672_1001816762 485
147 3300005548 Ga0070665_100067591 Ga0070665_1000675914 485
148 3300005564 Ga0070664_100000817 Ga0070664_1000008178 485
149 3300009177 Ga0105248_10006733 Ga0105248_100067333 485
150 3300013308 Ga0157375_10002415 Ga0157375_1000241511 485
151 3300025893 Ga0207682_10011792 Ga0207682_100117923 485
152 3300025909 Ga0207705_10040464 Ga0207705_100404642 485
153 3300025919 Ga0207657_10027057 Ga0207657_100270573 485
154 3300025919 Ga0207657_10086991 Ga0207657_100869912 485
155 3300025919 Ga0207657_10126793 Ga0207657_101267932 485
156 3300025920 Ga0207649_10042734 Ga0207649_100427342 485
157 3300025923 Ga0207681_10041230 Ga0207681_100412303 485
158 3300025925 Ga0207650_10002654 Ga0207650_1000265410 485
159 3300025926 Ga0207659_10005950 Ga0207659_100059504 485
160 3300025929 Ga0207664_10020756 Ga0207664_100207562 485
161 3300025931 Ga0207644_10002422 Ga0207644_100024225 485
162 3300025931 Ga0207644_10178868 Ga0207644_101788682 485
163 3300025933 Ga0207706_10013139 Ga0207706_100131392 485
164 3300025933 Ga0207706_10018590 Ga0207706_100185902 485
165 3300025933 Ga0207706_10027576 Ga0207706_100275764 485
166 3300025945 Ga0207679_10003123 Ga0207679_100031231 485
167 3300025945 Ga0207679_10170765 Ga0207679_101707651 485
168 3300025960 Ga0207651_10003293 Ga0207651_100032937 485
169 3300025986 Ga0207658_10015034 Ga0207658_100150343 485
170 3300026078 Ga0207702_10059341 Ga0207702_100593412 485
171 3300026121 Ga0207683_10098374 Ga0207683_100983742 485
172 3300031824 Ga0307413_10026103 Ga0307413_100261032 485
173 3300031852 Ga0307410_10026435 Ga0307410_100264352 485
174 3300031903 Ga0307407_10021253 Ga0307407_100212532 485
175 3300032002 Ga0307416_100062449 Ga0307416_1000624493 485
176 3300032004 Ga0307414_10038826 Ga0307414_100388263 485
177 3300032126 Ga0307415_100124889 Ga0307415_1001248892 485
178 3300046684 Ga0495669_0003864 Ga0495669_0003864_1623_3131 485
179 3300048911 Ga0496108_0141459 Ga0496108_0141459_517_2025 485
180 3300048912 Ga0496109_0053562 Ga0496109_0053562_387_1895 485
181 3300048913 Ga0496110_0002542 Ga0496110_0002542_8990_10498 485
182 3300002075 JGI24738J21930_10000519 JGI24738J21930_1000051911 486
183 3300005331 Ga0070670_100048761 Ga0070670_1000487613 486
184 3300005331 Ga0070670_100132105 Ga0070670_1001321052 486
185 3300005334 Ga0068869_100035811 Ga0068869_1000358113 486
186 3300005335 Ga0070666_10003943 Ga0070666_100039436 486
187 3300005336 Ga0070680_100029910 Ga0070680_1000299104 486
188 3300005338 Ga0068868_100073687 Ga0068868_1000736871 486
189 3300005339 Ga0070660_100004042 Ga0070660_1000040426 486
190 3300005339 Ga0070660_100065513 Ga0070660_1000655132 486
191 3300005353 Ga0070669_100000384 Ga0070669_10000038434 486
192 3300005353 Ga0070669_100057236 Ga0070669_1000572363 486
193 3300005353 Ga0070669_100058841 Ga0070669_1000588412 486
194 3300005354 Ga0070675_100057431 Ga0070675_1000574313 486
195 3300005355 Ga0070671_100005846 Ga0070671_1000058468 486
196 3300005355 Ga0070671_100013189 Ga0070671_1000131893 486
197 3300005364 Ga0070673_100000180 Ga0070673_10000018022 486
198 3300005364 Ga0070673_100001134 Ga0070673_10000113410 486
199 3300005366 Ga0070659_100000688 Ga0070659_10000068810 486
200 3300005366 Ga0070659_100018486 Ga0070659_1000184863 486
201 3300005367 Ga0070667_100001415 Ga0070667_10000141520 486
202 3300005367 Ga0070667_100005354 Ga0070667_10000535410 486
203 3300005367 Ga0070667_100018647 Ga0070667_1000186474 486
204 3300005367 Ga0070667_100077404 Ga0070667_1000774041 486
205 3300005455 Ga0070663_100028315 Ga0070663_1000283152 486
206 3300005456 Ga0070678_100001830 Ga0070678_1000018309 486
207 3300005457 Ga0070662_100008505 Ga0070662_1000085055 486
208 3300005459 Ga0068867_100001815 Ga0068867_10000181512 486
209 3300005539 Ga0068853_100000664 Ga0068853_10000066411 486
210 3300005548 Ga0070665_100092605 Ga0070665_1000926051 486
211 3300005563 Ga0068855_100149612 Ga0068855_1001496122 486
212 3300005564 Ga0070664_100002414 Ga0070664_1000024149 486
213 3300005564 Ga0070664_100032465 Ga0070664_1000324654 486
214 3300005577 Ga0068857_100002689 Ga0068857_1000026894 486
215 3300005577 Ga0068857_100076627 Ga0068857_1000766272 486
216 3300005578 Ga0068854_100012325 Ga0068854_1000123255 486
217 3300005614 Ga0068856_100083221 Ga0068856_1000832213 486
218 3300005616 Ga0068852_100135362 Ga0068852_1001353622 486
219 3300005617 Ga0068859_100002250 Ga0068859_10000225011 486
220 3300005617 Ga0068859_100006621 Ga0068859_1000066219 486
221 3300005618 Ga0068864_100000399 Ga0068864_10000039911 486
222 3300005618 Ga0068864_100001958 Ga0068864_1000019584 486
223 3300005618 Ga0068864_100042444 Ga0068864_1000424442 486
224 3300005841 Ga0068863_100002337 Ga0068863_1000023378 486
225 3300005841 Ga0068863_100005049 Ga0068863_1000050499 486
226 3300005842 Ga0068858_100000377 Ga0068858_10000037720 486
227 3300005842 Ga0068858_100031323 Ga0068858_1000313233 486
228 3300005843 Ga0068860_100001953 Ga0068860_1000019534 486
229 3300005843 Ga0068860_100185279 Ga0068860_1001852792 486
230 3300005844 Ga0068862_100018887 Ga0068862_1000188874 486
231 3300006237 Ga0097621_100018861 Ga0097621_1000188615 486
232 3300006358 Ga0068871_100003403 Ga0068871_1000034032 486
233 3300006931 Ga0097620_100002250 Ga0097620_10000225010 486
234 3300006931 Ga0097620_100006620 Ga0097620_1000066209 486
235 3300009174 Ga0105241_10015111 Ga0105241_100151116 486
236 3300009176 Ga0105242_10081310 Ga0105242_100813102 486
237 3300009177 Ga0105248_10000075 Ga0105248_1000007516 486
238 3300009177 Ga0105248_10002385 Ga0105248_100023857 486
239 3300009177 Ga0105248_10002544 Ga0105248_100025442 486
240 3300009177 Ga0105248_10014828 Ga0105248_100148289 486
241 3300010375 Ga0105239_10035405 Ga0105239_100354052 486
242 3300011119 Ga0105246_10004062 Ga0105246_1000406210 486
243 3300013100 Ga0157373_10018175 Ga0157373_100181754 486
244 3300013102 Ga0157371_10001127 Ga0157371_100011276 486
245 3300013104 Ga0157370_10058430 Ga0157370_100584304 486
246 3300013105 Ga0157369_10042744 Ga0157369_100427444 486
247 3300013296 Ga0157374_10001130 Ga0157374_1000113012 486
248 3300013296 Ga0157374_10003689 Ga0157374_100036891 486
249 3300013297 Ga0157378_10066736 Ga0157378_100667363 486
250 3300013306 Ga0163162_10002867 Ga0163162_1000286710 486
251 3300013308 Ga0157375_10001954 Ga0157375_1000195411 486
252 3300014325 Ga0163163_10000161 Ga0163163_1000016136 486
253 3300014325 Ga0163163_10008545 Ga0163163_100085452 486
254 3300014325 Ga0163163_10043207 Ga0163163_100432075 486
255 3300025315 Ga0207697_10000146 Ga0207697_1000014629 486
256 3300025893 Ga0207682_10006168 Ga0207682_100061682 486
257 3300025901 Ga0207688_10030304 Ga0207688_100303042 486
258 3300025903 Ga0207680_10005331 Ga0207680_100053316 486
259 3300025903 Ga0207680_10091575 Ga0207680_100915751 486
260 3300025904 Ga0207647_10008399 Ga0207647_100083997 486
261 3300025909 Ga0207705_10002962 Ga0207705_100029622 486
262 3300025912 Ga0207707_10009817 Ga0207707_100098175 486
263 3300025917 Ga0207660_10001042 Ga0207660_1000104218 486
264 3300025919 Ga0207657_10003761 Ga0207657_100037616 486
265 3300025919 Ga0207657_10010596 Ga0207657_100105967 486
266 3300025919 Ga0207657_10038237 Ga0207657_100382373 486
267 3300025919 Ga0207657_10052175 Ga0207657_100521752 486
268 3300025923 Ga0207681_10019621 Ga0207681_100196213 486
269 3300025925 Ga0207650_10009139 Ga0207650_100091393 486
270 3300025925 Ga0207650_10029255 Ga0207650_100292552 486
271 3300025925 Ga0207650_10102197 Ga0207650_101021972 486
272 3300025931 Ga0207644_10000494 Ga0207644_1000049417 486
273 3300025931 Ga0207644_10002779 Ga0207644_100027798 486
274 3300025932 Ga0207690_10026469 Ga0207690_100264692 486
275 3300025933 Ga0207706_10000707 Ga0207706_1000070722 486
276 3300025933 Ga0207706_10010906 Ga0207706_100109065 486
277 3300025936 Ga0207670_10049689 Ga0207670_100496891 486
278 3300025940 Ga0207691_10002641 Ga0207691_1000264119 486
279 3300025940 Ga0207691_10007120 Ga0207691_100071208 486
280 3300025941 Ga0207711_10000281 Ga0207711_100002816 486
281 3300025941 Ga0207711_10005667 Ga0207711_100056678 486
282 3300025941 Ga0207711_10060865 Ga0207711_100608652 486
283 3300025942 Ga0207689_10000327 Ga0207689_1000032721 486
284 3300025945 Ga0207679_10004603 Ga0207679_100046035 486
285 3300025949 Ga0207667_10128074 Ga0207667_101280742 486
286 3300025960 Ga0207651_10017953 Ga0207651_100179532 486
287 3300025960 Ga0207651_10100099 Ga0207651_101000992 486
288 3300025961 Ga0207712_10004567 Ga0207712_100045676 486
289 3300025986 Ga0207658_10003940 Ga0207658_100039403 486
290 3300025986 Ga0207658_10020796 Ga0207658_100207963 486
291 3300026035 Ga0207703_10001696 Ga0207703_1000169620 486
292 3300026035 Ga0207703_10004890 Ga0207703_100048908 486
293 3300026041 Ga0207639_10055468 Ga0207639_100554682 486
294 3300026088 Ga0207641_10000140 Ga0207641_100001408 486
295 3300026088 Ga0207641_10002968 Ga0207641_100029688 486
296 3300026089 Ga0207648_10001988 Ga0207648_1000198822 486
297 3300026095 Ga0207676_10000630 Ga0207676_1000063013 486
298 3300026095 Ga0207676_10007347 Ga0207676_100073475 486
299 3300026116 Ga0207674_10000139 Ga0207674_1000013962 486
300 3300026116 Ga0207674_10001813 Ga0207674_1000181310 486
301 3300026116 Ga0207674_10051721 Ga0207674_100517212 486
302 3300026118 Ga0207675_100143143 Ga0207675_1001431432 486
303 3300026121 Ga0207683_10003619 Ga0207683_100036196 486
304 3300026142 Ga0207698_10103975 Ga0207698_101039752 486
305 3300028380 Ga0268265_10005214 Ga0268265_100052142 486
306 3300031548 Ga0307408_100037399 Ga0307408_1000373993 486
307 3300031852 Ga0307410_10013890 Ga0307410_100138903 486
308 3300031901 Ga0307406_10016926 Ga0307406_100169263 486
309 3300031995 Ga0307409_100002226 Ga0307409_1000022268 486
310 3300031995 Ga0307409_100014162 Ga0307409_1000141624 486
311 3300032005 Ga0307411_10027367 Ga0307411_100273673 486
312 3300032005 Ga0307411_10060592 Ga0307411_100605922 486
313 3300037418 Ga0395900_0006436 Ga0395900_0006436_2092_3603 486
314 3300037418 Ga0395900_0006857 Ga0395900_0006857_98_1666 486
315 3300037418 Ga0395900_0269656 Ga0395900_0269656_93_1604 486
316 3300037466 Ga0395898_0223875 Ga0395898_0223875_147_1715 486
317 3300037471 Ga0395905_0007179 Ga0395905_0007179_2244_3755 486
318 3300037471 Ga0395905_0088715 Ga0395905_0088715_1040_2608 486
319 3300037471 Ga0395905_0172316 Ga0395905_0172316_470_1981 486
320 3300038443 Ga0395901_0216375 Ga0395901_0216375_101_1612 486
321 3300039437 Ga0436365_0118374 Ga0436365_0118374_119_1630 486
322 3300044684 Ga0466966_0035886 Ga0466966_0035886_1376_2944 486
323 3300044694 Ga0466963_0023781 Ga0466963_0023781_2300_3811 486
324 3300044694 Ga0466963_0062204 Ga0466963_0062204_315_1826 486
325 3300045976 Ga0466967_0161270 Ga0466967_0161270_10_1590 486
326 3300048910 Ga0496107_0030547 Ga0496107_0030547_2110_3624 486
327 3300048911 Ga0496108_0000918 Ga0496108_0000918_8739_10313 486
328 3300048912 Ga0496109_0004342 Ga0496109_0004342_7075_8649 486
329 3300048913 Ga0496110_0002254 Ga0496110_0002254_1268_2842 486
330 3300048914 Ga0496111_0043777 Ga0496111_0043777_20_1534 486
331 3300048915 Ga0496112_0002859 Ga0496112_0002859_8684_10258 486
332 3300048915 Ga0496112_0005464 Ga0496112_0005464_5615_7126 486
333 3300048915 Ga0496112_0010416 Ga0496112_0010416_2987_4561 486
334 3300048916 Ga0496113_0001331 Ga0496113_0001331_8303_9877 486
335 3300001990 JGI24737J22298_10003831 JGI24737J22298_100038315 487
336 3300005366 Ga0070659_100001983 Ga0070659_10000198310 487
337 3300025904 Ga0207647_10000793 Ga0207647_100007934 487
338 3300025932 Ga0207690_10000593 Ga0207690_100005938 487
339 3300032002 Ga0307416_100006729 Ga0307416_1000067292 487
340 3300032126 Ga0307415_100007055 Ga0307415_1000070553 487
341 3300037471 Ga0395905_0010792 Ga0395905_0010792_6950_8464 487

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09334

tRNA-synt_1g

tRNA synthetases class I (M)

5

352

0.94

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

220

328

0.87

PF19303

Anticodon_3

Anticodon binding domain of methionyl tRNA ligase

376

502

0.87

PF00133

tRNA-synt_1

tRNA synthetases class I (I, L, M and V)

2

224

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
4py2-assembly3.cif.gz_C crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-thiophen-3-ylurea 0.9443 3 475
6ax8-assembly1.cif.gz_A mycobacterium tuberculosis methionyl-trna synthetase in complex with methionyl-adenylate 0.9431 3 475
4dlp-assembly1.cif.gz_A crystal structure of methionyl-trna synthetase metrs from brucella melitensis bound to selenomethionine 0.9402 3 477
5xet-assembly1.cif.gz_C crystal structure of mycobacterium tuberculosis methionyl-trna synthetase bound by methionyl-adenylate (met-amp) 0.939 3 474
4py2-assembly2.cif.gz_B crystal structure of methionyl-trna synthetase metrs from brucella melitensis in complex with inhibitor 1-{3-[(3,5-dichlorobenzyl)amino]propyl}-3-thiophen-3-ylurea 0.934 3 478
ID Description Score Start End Superfamily
2x1lB02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9895 160 227 2.170.220.10
2ct8B02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9768 160 227 2.170.220.10
2csxB02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9642 161 227 2.170.220.10
4py2B02 Mainly Beta;Beta Complex;Methionyl-trna Synthetase; domain 2; 0.9343 116 227 2.170.220.10
4lneB03 Mainly Alpha;Orthogonal Bundle;Isoleucyl-tRNA Synthetase; Domain 1;Isoleucyl-tRNA Synthetase; Domain 1 0.9294 322 478 1.10.730.10
ID Description Score Start End GO Terms
AF-A0A0G1VK72-F1-model_v4 Methionyl/Leucyl tRNA synthetase domain-containing protein 0.9873 3 98 GO:0004825
GO:0005524
GO:0006431
GO:0016020
AF-A0A0L7QKV6-F1-model_v4 Methionine--tRNA ligase, mitochondrial 0.9829 1 108 GO:0004825
GO:0005524
GO:0006431
AF-A0A7C5JP00-F1-model_v4 Methionine--tRNA ligase 0.9759 1 115 GO:0004825
GO:0005524
GO:0006431
AF-A0A0G1FJC4-F1-model_v4 Methionyl-tRNA synthetase 0.9758 1 122 GO:0004825
GO:0005524
GO:0006431
AF-A0A2T6EW57-F1-model_v4 deleted 0.9739 4 115

Feature Viewer

pLDDT pTM Quality
86.29 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map