F414868

General Info

Members Datasets Scaffolds Average Seq Length
341 212 341 340

Family's Representative Sequence

Representative Sequence 3300046514|Ga0495618_0000126|Ga0495618_0000126_34795_35898
Length 367
Sequence MQRKGFGYAGGLSLAAFASTLRAVKALVQTANGGYDVLQVLDRPDPPVGPGEIRIAVKAAGINFADTMARLGLYPDAPKPPCVMGYEVAGTVESVGEGVSEFSVGDRVGAGTRFGGQAELVTVPEAQALPLPERLSFEQGAAFPVNYGTAYAALVLMGSLREGSRVLIHAAAGGVGIAATQIARNAGAEIFGTASPSKHDAIRAQGVEHPIDYRNQDFEAETMRLTGGEGVDLIIDALGPTSFRKDYRLLRPGGRLVMYGLSEATSEGGRDIPAMLKSLAKMPLATIPWWKSLALMNENKGIFGLNMLKWWDREGSLDRVTEPLMADLEAGRLEPVVAEAFPFERAGEAHKFIAERRNVGKVVLLPE

Samples

Sample ID Description Type Environment
1 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
60 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
93 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
94 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
95 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
117 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
122 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
123 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
142 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
143 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
144 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
147 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
166 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
167 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
168 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
195 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
196 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
197 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
198 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
207 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
209 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
210 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
211 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 13.49
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25407J50210_10016450 3300003373 Bacteria 1916
2 JGI25404J52841_10002203 3300003659 Bacteria 3648
3 Ga0070683_100004551 3300005329 Bacteria 11445
4 Ga0070683_100025146 3300005329 Bacteria 5344
5 Ga0070677_10000222 3300005333 Bacteria 19600
6 Ga0070680_100017005 3300005336 Bacteria 5727
7 Ga0070680_100210703 3300005336 Bacteria 1639
8 Ga0070682_100000030 3300005337 Bacteria 182768
9 Ga0068868_100000633 3300005338 Bacteria 23661
10 Ga0068868_100096634 3300005338 Bacteria 2386
11 Ga0070689_100515432 3300005340 Bacteria 1026
12 Ga0070691_10000362 3300005341 Bacteria 16367
13 Ga0070691_10009792 3300005341 Bacteria 4371
14 Ga0070674_100000004 3300005356 Bacteria 169446
15 Ga0070674_100000012 3300005356 Bacteria 130773
16 Ga0070673_100000474 3300005364 Bacteria 21373
17 Ga0070667_100078840 3300005367 Bacteria 2815
18 Ga0070711_100055179 3300005439 Bacteria 2744
19 Ga0070711_100086100 3300005439 Bacteria 2252
20 Ga0070694_100003958 3300005444 Bacteria 8864
21 Ga0070678_100322788 3300005456 Bacteria 1319
22 Ga0070662_100000006 3300005457 Bacteria 169366
23 Ga0070681_10003891 3300005458 Bacteria 14065
24 Ga0068867_100002668 3300005459 Bacteria 12591
25 Ga0068867_100415037 3300005459 Bacteria 1139
26 Ga0070679_100000844 3300005530 Bacteria 26718
27 Ga0070684_100018589 3300005535 Bacteria 5730
28 Ga0068853_100002382 3300005539 Bacteria 14050
29 Ga0070695_100108106 3300005545 Unclassified 1883
30 Ga0070693_100030989 3300005547 Bacteria 2928
31 Ga0070665_100000040 3300005548 Bacteria 305480
32 Ga0070704_100008522 3300005549 Bacteria 6153
33 Ga0068854_100015068 3300005578 Bacteria 5111
34 Ga0068856_100012946 3300005614 Bacteria 8076
35 Ga0068856_100212664 3300005614 Unclassified 1949
36 Ga0070702_100073151 3300005615 Bacteria 2030
37 Ga0068864_100328750 3300005618 Bacteria 1437
38 Ga0068866_10000004 3300005718 Bacteria 202810
39 Ga0068866_10000062 3300005718 Bacteria 42082
40 Ga0068861_100244433 3300005719 Bacteria 1528
41 Ga0068863_100000107 3300005841 Bacteria 88879
42 Ga0068863_100196794 3300005841 Bacteria 1937
43 Ga0068858_100000075 3300005842 Bacteria 104349
44 Ga0068858_100001009 3300005842 Bacteria 29022
45 Ga0068860_100010512 3300005843 Bacteria 9150
46 Ga0081455_10139603 3300005937 Bacteria 1884
47 Ga0081455_10142550 3300005937 Bacteria 1859
48 Ga0081455_10179284 3300005937 Bacteria 1606
49 Ga0081538_10000584 3300005981 Bacteria 40455
50 Ga0081538_10001245 3300005981 Bacteria 26602
51 Ga0081540_1000041 3300005983 Bacteria 136874
52 Ga0081540_1002177 3300005983 Bacteria 16228
53 Ga0081539_10005004 3300005985 Bacteria 13998
54 Ga0075365_10000786 3300006038 Bacteria 12956
55 Ga0075365_10003681 3300006038 Bacteria 7958
56 Ga0070715_10000014 3300006163 Bacteria 154272
57 Ga0070712_100035933 3300006175 Bacteria 3367
58 Ga0068871_100050788 3300006358 Bacteria 3355
59 Ga0075433_10000244 3300006852 Bacteria 31446
60 Ga0075433_10102490 3300006852 Bacteria 2535
61 Ga0075435_100025365 3300007076 Bacteria 4615
62 Ga0111539_10078936 3300009094 Bacteria 3871
63 Ga0105245_10000212 3300009098 Bacteria 55133
64 Ga0105245_10008471 3300009098 Bacteria 8975
65 Ga0105245_10025031 3300009098 Bacteria 5246
66 Ga0105247_10001338 3300009101 Bacteria 17979
67 Ga0114129_10061004 3300009147 Bacteria 5271
68 Ga0114129_10856145 3300009147 Unclassified 1155
69 Ga0105242_10000085 3300009176 Bacteria 64353
70 Ga0105242_10043690 3300009176 Bacteria 3625
71 Ga0105248_10360378 3300009177 Bacteria 1637
72 Ga0105238_10000048 3300009551 Bacteria 146322
73 Ga0105249_10000070 3300009553 Bacteria 147277
74 Ga0105249_10073278 3300009553 Bacteria 3168
75 Ga0157374_10001900 3300013296 Bacteria 17502
76 Ga0157374_10206690 3300013296 Bacteria 1924
77 Ga0157375_10000130 3300013308 Bacteria 74968
78 Ga0157375_10008154 3300013308 Bacteria 9167
79 Ga0157375_10108582 3300013308 Bacteria 2870
80 Ga0157375_10124587 3300013308 Bacteria 2690
81 Ga0163163_10011513 3300014325 Bacteria 8031
82 Ga0157379_10000776 3300014968 Bacteria 25935
83 Ga0157379_10014841 3300014968 Bacteria 6832
84 Ga0157379_10059842 3300014968 Bacteria 3406
85 Ga0157379_10111289 3300014968 Bacteria 2460
86 Ga0157379_10164062 3300014968 Bacteria 2005
87 Ga0157376_10037762 3300014969 Bacteria 3925
88 Ga0163161_10000160 3300017792 Bacteria 62228
89 Ga0213876_10111526 3300021384 Bacteria 1451
90 Ga0207682_10000140 3300025893 Bacteria 32624
91 Ga0207642_10000005 3300025899 Bacteria 401934
92 Ga0207642_10000104 3300025899 Bacteria 22584
93 Ga0207710_10000243 3300025900 Bacteria 46286
94 Ga0207710_10116145 3300025900 Bacteria 1274
95 Ga0207685_10000025 3300025905 Bacteria 110358
96 Ga0207699_10199448 3300025906 Bacteria 1355
97 Ga0207707_10003475 3300025912 Bacteria 13956
98 Ga0207695_10520673 3300025913 Bacteria 1071
99 Ga0207663_10000748 3300025916 Bacteria 14481
100 Ga0207663_10195145 3300025916 Unclassified 1456
101 Ga0207660_10004619 3300025917 Bacteria 8975
102 Ga0207660_10011123 3300025917 Bacteria 5851
103 Ga0207652_10001209 3300025921 Bacteria 23169
104 Ga0207681_10272907 3300025923 Unclassified 1328
105 Ga0207694_10000056 3300025924 Bacteria 146908
106 Ga0207687_10000020 3300025927 Bacteria 228407
107 Ga0207687_10001900 3300025927 Bacteria 14372
108 Ga0207700_10060329 3300025928 Bacteria 2872
109 Ga0207664_10002248 3300025929 Bacteria 12708
110 Ga0207664_10193727 3300025929 Bacteria 1751
111 Ga0207706_10000017 3300025933 Bacteria 169589
112 Ga0207686_10000199 3300025934 Bacteria 46373
113 Ga0207686_10022555 3300025934 Bacteria 3627
114 Ga0207669_10000017 3300025937 Bacteria 119878
115 Ga0207669_10000131 3300025937 Bacteria 37319
116 Ga0207661_10016784 3300025944 Bacteria 5405
117 Ga0207651_10000664 3300025960 Bacteria 14678
118 Ga0207712_10000019 3300025961 Bacteria 317060
119 Ga0207640_10005255 3300025981 Bacteria 7047
120 Ga0207658_10192774 3300025986 Bacteria 1695
121 Ga0207658_10223299 3300025986 Bacteria 1586
122 Ga0207703_10000088 3300026035 Bacteria 106080
123 Ga0207703_10000166 3300026035 Bacteria 76553
124 Ga0207703_10431404 3300026035 Bacteria 1228
125 Ga0207639_10002098 3300026041 Bacteria 13422
126 Ga0207678_10229174 3300026067 Bacteria 1591
127 Ga0207702_10004436 3300026078 Bacteria 12465
128 Ga0207702_10310618 3300026078 Bacteria 1499
129 Ga0207702_10436851 3300026078 Bacteria 1268
130 Ga0207641_10000077 3300026088 Bacteria 144978
131 Ga0207641_10078401 3300026088 Bacteria 2861
132 Ga0207648_10001799 3300026089 Bacteria 23490
133 Ga0207675_100255823 3300026118 Bacteria 1696
134 Ga0268266_10000045 3300028379 Bacteria 312955
135 Ga0268266_10051791 3300028379 Bacteria 3525
136 Ga0268264_10012409 3300028381 Bacteria 7013
137 Ga0265337_1000805 3300028556 Bacteria 16508
138 Ga0265326_10000084 3300028558 Bacteria 50129
139 Ga0265319_1000110 3300028563 Bacteria 63277
140 Ga0265322_10000198 3300028654 Bacteria 26588
141 Ga0265336_10008191 3300028666 Bacteria 3679
142 Ga0265336_10028123 3300028666 Unclassified 1757
143 Ga0265338_10000578 3300028800 Bacteria 64450
144 Ga0265324_10014111 3300029957 Bacteria 2965
145 Ga0307511_10078837 3300030521 Bacteria 2333
146 Ga0265328_10019228 3300031239 Bacteria 2626
147 Ga0265320_10000035 3300031240 Bacteria 137855
148 Ga0265325_10007176 3300031241 Bacteria 6702
149 Ga0265331_10007831 3300031250 Bacteria 6130
150 Ga0265327_10000015 3300031251 Bacteria 496677
151 Ga0265314_10000690 3300031711 Bacteria 40955
152 Ga0265342_10097381 3300031712 Bacteria 1680
153 Ga0307410_10016448 3300031852 Bacteria 4413
154 Ga0307415_100006852 3300032126 Bacteria 6183
155 Ga0316574_0001485 3300035398 Bacteria 11177
156 Ga0373947_0007908 3300035725 Bacteria 6131
157 Ga0373937_0027510 3300036401 Bacteria 5142
158 Ga0395900_0181036 3300037418 Bacteria 2142
159 Ga0395898_0388719 3300037466 Bacteria 1330
160 Ga0395905_0187403 3300037471 Bacteria 1942
161 Ga0395905_0374815 3300037471 Bacteria 1317
162 Ga0395901_0159927 3300038443 Bacteria 2366
163 Ga0395901_0225504 3300038443 Bacteria 1958
164 Ga0395901_0519605 3300038443 Bacteria 1210
165 Ga0436365_1273335 3300039437 Bacteria 3726
166 Ga0451807_0074477 3300041486 Bacteria 1667
167 Ga0451853_0543742 3300041512 Bacteria 6997
168 Ga0466969_0066147 3300044656 Bacteria 1746
169 Ga0466966_0036370 3300044684 Bacteria 3179
170 Ga0466961_0017152 3300044693 Bacteria 4651
171 Ga0466963_0000022 3300044694 Bacteria 52600
172 Ga0466963_0015057 3300044694 Bacteria 4781
173 Ga0466963_0212556 3300044694 Bacteria 1354
174 Ga0453684_0008015 3300044712 Bacteria 19121
175 Ga0466957_0002188 3300044842 Bacteria 10477
176 Ga0466960_0030915 3300044901 Bacteria 2467
177 Ga0466960_0062517 3300044901 Bacteria 1830
178 Ga0466959_0026004 3300045049 Bacteria 4340
179 Ga0466958_0014398 3300045836 Bacteria 4517
180 Ga0466958_0016729 3300045836 Bacteria 4228
181 Ga0466958_0183722 3300045836 Unclassified 1327
182 Ga0466967_0423693 3300045976 Bacteria 1298
183 Ga0495592_0000912 3300046454 Bacteria 20489
184 Ga0495592_0029322 3300046454 Bacteria 4168
185 Ga0495603_0000471 3300046455 Bacteria 22167
186 Ga0495603_0000594 3300046455 Bacteria 20327
187 Ga0495603_0005958 3300046455 Bacteria 7289
188 Ga0495641_0000027 3300046461 Bacteria 100420
189 Ga0495651_0083452 3300046462 Bacteria 2409
190 Ga0495653_0028868 3300046463 Bacteria 4435
191 Ga0495653_0057966 3300046463 Bacteria 2945
192 Ga0495653_0062354 3300046463 Bacteria 2817
193 Ga0495582_0000001 3300046473 Bacteria 252434
194 Ga0495662_0000133 3300046476 Bacteria 28271
195 Ga0495664_0027111 3300046477 Bacteria 3340
196 Ga0495608_0001821 3300046511 Bacteria 15219
197 Ga0495608_0055193 3300046511 Bacteria 2625
198 Ga0495618_0000126 3300046514 Bacteria 55293
199 Ga0495620_0002158 3300046515 Bacteria 11431
200 Ga0495628_0001493 3300046516 Bacteria 21416
201 Ga0495628_0007112 3300046516 Bacteria 9694
202 Ga0495628_0034880 3300046516 Bacteria 4045
203 Ga0495628_0047754 3300046516 Bacteria 3394
204 Ga0495628_0080344 3300046516 Unclassified 2535
205 Ga0495628_0139172 3300046516 Bacteria 1853
206 Ga0495628_0271674 3300046516 Bacteria 1261
207 Ga0495630_0003163 3300046517 Bacteria 11429
208 Ga0495630_0004451 3300046517 Bacteria 9827
209 Ga0495630_0126815 3300046517 Bacteria 1937
210 Ga0495644_0004551 3300046523 Bacteria 5451
211 Ga0495640_0162131 3300046533 Bacteria 1432
212 Ga0495586_0008633 3300046535 Bacteria 5424
213 Ga0495587_0034683 3300046536 Bacteria 3042
214 Ga0495587_0214573 3300046536 Bacteria 1086
215 Ga0495598_0007390 3300046537 Bacteria 2519
216 Ga0495621_0036303 3300046539 Bacteria 1710
217 Ga0495645_0001215 3300046543 Bacteria 17592
218 Ga0495667_0000034 3300046559 Bacteria 141464
219 Ga0495656_0000935 3300046615 Bacteria 9447
220 Ga0495634_0000028 3300046642 Bacteria 114075
221 Ga0495634_0001510 3300046642 Bacteria 20589
222 Ga0495634_0024040 3300046642 Bacteria 4279
223 Ga0495634_0088115 3300046642 Bacteria 2019
224 Ga0495625_0000506 3300046660 Bacteria 57832
225 Ga0495635_0000005 3300046663 Bacteria 302178
226 Ga0495657_0006985 3300046675 Bacteria 8756
227 Ga0495657_0051196 3300046675 Bacteria 2773
228 Ga0495599_0033038 3300046678 Bacteria 3250
229 Ga0495647_0000043 3300046681 Bacteria 36874
230 Ga0495647_0001875 3300046681 Bacteria 6537
231 Ga0495647_0052499 3300046681 Bacteria 1588
232 Ga0495658_0000193 3300046683 Bacteria 35142
233 Ga0495669_0000102 3300046684 Bacteria 53777
234 Ga0495613_0000282 3300046689 Bacteria 47001
235 Ga0495613_0144526 3300046689 Bacteria 1698
236 Ga0495613_0232722 3300046689 Bacteria 1290
237 Ga0495624_0000587 3300046690 Bacteria 28339
238 Ga0495624_0006535 3300046690 Bacteria 8263
239 Ga0495670_0043872 3300046691 Bacteria 2232
240 Ga0495649_0015907 3300046694 Bacteria 4273
241 Ga0495600_0001288 3300046809 Bacteria 13857
242 Ga0495604_0000267 3300047317 Bacteria 46398
243 Ga0495604_0130195 3300047317 Bacteria 1810
244 Ga0495674_0281603 3300047319 Bacteria 1362
245 Ga0495676_0004205 3300047321 Bacteria 13145
246 Ga0495676_0070411 3300047321 Unclassified 2694
247 Ga0495680_0000193 3300047322 Bacteria 65567
248 Ga0495680_0001649 3300047322 Bacteria 23717
249 Ga0495680_0005500 3300047322 Bacteria 11903
250 Ga0495680_0056393 3300047322 Bacteria 3042
251 Ga0495679_029989 3300047446 Bacteria 1769
252 Ga0495602_0001156 3300048088 Bacteria 25832
253 Ga0496100_0000014 3300048903 Bacteria 174991
254 Ga0496101_0000036 3300048904 Bacteria 175595
255 Ga0496102_0000081 3300048905 Bacteria 139266
256 Ga0496102_0609504 3300048905 Bacteria 1015
257 Ga0496103_0000031 3300048906 Bacteria 204016
258 Ga0496104_0000024 3300048907 Bacteria 229913
259 Ga0496104_0000077 3300048907 Bacteria 100848
260 Ga0496104_0001546 3300048907 Bacteria 19843
261 Ga0496104_0013755 3300048907 Bacteria 7298
262 Ga0496104_0050405 3300048907 Bacteria 3928
263 Ga0496105_0000004 3300048908 Bacteria 475798
264 Ga0496105_0000013 3300048908 Bacteria 229894
265 Ga0496105_0000098 3300048908 Bacteria 59301
266 Ga0496105_0021785 3300048908 Bacteria 5188
267 Ga0496106_0000043 3300048909 Bacteria 105477
268 Ga0496106_0001777 3300048909 Bacteria 16096
269 Ga0496106_0001892 3300048909 Bacteria 15675
270 Ga0496107_0000271 3300048910 Bacteria 27463
271 Ga0496107_0005273 3300048910 Bacteria 8829
272 Ga0496107_0034082 3300048910 Bacteria 3645
273 Ga0496107_0094579 3300048910 Bacteria 2186
274 Ga0496108_0000006 3300048911 Bacteria 469473
275 Ga0496108_0001109 3300048911 Bacteria 21079
276 Ga0496108_0507061 3300048911 Bacteria 1054
277 Ga0496109_0000004 3300048912 Bacteria 404818
278 Ga0496109_0150737 3300048912 Bacteria 2177
279 Ga0496109_0461188 3300048912 Bacteria 1200
280 Ga0496109_0499005 3300048912 Bacteria 1149
281 Ga0496110_0020077 3300048913 Bacteria 5636
282 Ga0496110_0035518 3300048913 Bacteria 4324
283 Ga0496111_0013159 3300048914 Bacteria 5623
284 Ga0496111_0019807 3300048914 Bacteria 4678
285 Ga0496111_0045476 3300048914 Bacteria 3159
286 Ga0496111_0142094 3300048914 Bacteria 1779
287 Ga0496112_0000085 3300048915 Bacteria 61255
288 Ga0496113_0005055 3300048916 Bacteria 8186
289 Ga0496113_0024599 3300048916 Bacteria 4283
290 Ga0496113_0032820 3300048916 Bacteria 3774
291 Ga0496113_0058078 3300048916 Bacteria 2910
292 Ga0496114_0000450 3300048917 Bacteria 30262
293 Ga0496114_0001473 3300048917 Bacteria 17863
294 Ga0496114_0018100 3300048917 Bacteria 5693
295 Ga0496115_0000010 3300048918 Bacteria 227112
296 Ga0496115_0000533 3300048918 Bacteria 29638
297 Ga0496115_0001569 3300048918 Bacteria 16428
298 Ga0496119_0030772 3300048922 Bacteria 3612
299 Ga0501034_0198057 3300049571 Bacteria 1968
300 Ga0501039_0354941 3300049575 Bacteria 1152
301 Ga0501040_0065644 3300049576 Bacteria 2500
302 Ga0501042_0238718 3300049578 Bacteria 1311
303 Ga0501070_0103468 3300049586 Bacteria 2355
304 Ga0501072_0087329 3300049588 Bacteria 2475
305 Ga0501072_0286019 3300049588 Bacteria 1311
306 Ga0501075_0003224 3300049591 Bacteria 10913
307 Ga0501076_0158147 3300049592 Bacteria 1845
308 Ga0501076_0177087 3300049592 Bacteria 1738
309 Ga0501209_069876 3300049656 Bacteria 997
310 Ga0501079_0161906 3300049741 Bacteria 1745
311 Ga0501045_0049238 3300049824 Bacteria 3072
312 nmdc:mga00v17_29452_c1 3300050491 Bacteria 3222
313 nmdc:mga0yw44_36129_c1 3300050492 Bacteria 2909
314 nmdc:mga0yw44_5272_c1 3300050492 Bacteria 6069
315 nmdc:mga06r32_197770_c1 3300050510 Bacteria 1997
316 nmdc:mga06r32_21158_c1 3300050510 Bacteria 6002
317 nmdc:mga06r32_5197_c1 3300050510 Bacteria 11698
318 nmdc:mga0rr50_37958_c1 3300050513 Bacteria 3481
319 nmdc:mga08x19_81011_c1 3300050514 Bacteria 2131
320 nmdc:mga0a205_45_c1 3300050515 Bacteria 68070
321 Ga0495601_0000156 3300053077 Bacteria 38350
322 Ga0495601_0002961 3300053077 Bacteria 9660
323 Ga0495601_0004249 3300053077 Bacteria 8273
324 Ga0495601_0022333 3300053077 Bacteria 3883
325 Ga0495601_0177179 3300053077 Bacteria 1394
326 Ga0495612_0001134 3300053078 Bacteria 10926
327 Ga0495612_0003529 3300053078 Bacteria 6484
328 Ga0495612_0006194 3300053078 Bacteria 4924
329 Ga0495612_0044099 3300053078 Bacteria 1824
330 Ga0495612_0052991 3300053078 Bacteria 1670
331 Ga0495655_0000023 3300053083 Bacteria 39507
332 Ga0495595_0000200 3300053084 Bacteria 24133
333 Ga0495619_0000008 3300053085 Bacteria 305999
334 Ga0495619_0000929 3300053085 Bacteria 19273
335 Ga0495619_0003076 3300053085 Bacteria 10833
336 Ga0495619_0006703 3300053085 Bacteria 7285
337 Ga0495619_0023290 3300053085 Bacteria 3969
338 Ga0500614_007238 3300053123 Bacteria 2337
339 Ga0500628_000001 3300053129 Bacteria 564074
340 Ga0466962_0007462 3300061719 Bacteria 5248
341 Ga0530510_0026702 3300061734 Bacteria 4134

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048905 Ga0496102_0609504 Ga0496102_0609504_24_866 272
2 3300049588 Ga0501072_0286019 Ga0501072_0286019_11_868 284
3 3300046642 Ga0495634_0088115 Ga0495634_0088115_14_871 285
4 3300048911 Ga0496108_0507061 Ga0496108_0507061_34_891 285
5 3300005340 Ga0070689_100515432 Ga0070689_1005154321 292
6 3300053077 Ga0495601_0177179 Ga0495601_0177179_36_938 300
7 3300005618 Ga0068864_100328750 Ga0068864_1003287502 303
8 3300005841 Ga0068863_100196794 Ga0068863_1001967943 303
9 3300025906 Ga0207699_10199448 Ga0207699_101994482 303
10 3300026035 Ga0207703_10431404 Ga0207703_104314042 304
11 3300044901 Ga0466960_0030915 Ga0466960_0030915_45_974 308
12 3300005547 Ga0070693_100030989 Ga0070693_1000309892 311
13 3300025900 Ga0207710_10116145 Ga0207710_101161451 311
14 3300046675 Ga0495657_0051196 Ga0495657_0051196_26_961 311
15 3300049656 Ga0501209_069876 Ga0501209_069876_39_974 311
16 3300009177 Ga0105248_10360378 Ga0105248_103603781 312
17 3300014325 Ga0163163_10011513 Ga0163163_100115131 312
18 3300014968 Ga0157379_10164062 Ga0157379_101640622 312
19 3300026088 Ga0207641_10078401 Ga0207641_100784011 312
20 3300032126 Ga0307415_100006852 Ga0307415_1000068522 312
21 3300048907 Ga0496104_0050405 Ga0496104_0050405_38_1057 312
22 3300048914 Ga0496111_0019807 Ga0496111_0019807_3162_4181 312
23 3300048916 Ga0496113_0005055 Ga0496113_0005055_6546_7565 312
24 3300009147 Ga0114129_10856145 Ga0114129_108561451 314
25 3300037418 Ga0395900_0181036 Ga0395900_0181036_321_1265 314
26 3300046536 Ga0495587_0214573 Ga0495587_0214573_125_1069 314
27 3300048088 Ga0495602_0001156 Ga0495602_0001156_21115_22059 314
28 3300048918 Ga0496115_0000010 Ga0496115_0000010_206442_207386 314
29 3300049741 Ga0501079_0161906 Ga0501079_0161906_16_963 314
30 3300005615 Ga0070702_100073151 Ga0070702_1000731512 315
31 3300013308 Ga0157375_10124587 Ga0157375_101245871 315
32 3300048912 Ga0496109_0499005 Ga0496109_0499005_178_1125 315
33 3300005336 Ga0070680_100210703 Ga0070680_1002107031 317
34 3300005444 Ga0070694_100003958 Ga0070694_1000039581 317
35 3300005549 Ga0070704_100008522 Ga0070704_1000085226 317
36 3300025917 Ga0207660_10004619 Ga0207660_100046192 317
37 3300005356 Ga0070674_100000004 Ga0070674_100000004150 320
38 3300005718 Ga0068866_10000004 Ga0068866_10000004187 320
39 3300025899 Ga0207642_10000005 Ga0207642_1000000521 320
40 3300025937 Ga0207669_10000131 Ga0207669_1000013119 320
41 3300047317 Ga0495604_0130195 Ga0495604_0130195_749_1732 323
42 3300006852 Ga0075433_10102490 Ga0075433_101024902 324
43 3300007076 Ga0075435_100025365 Ga0075435_1000253653 324
44 3300049575 Ga0501039_0354941 Ga0501039_0354941_82_1059 324
45 3300049576 Ga0501040_0065644 Ga0501040_0065644_194_1171 324
46 3300049588 Ga0501072_0087329 Ga0501072_0087329_422_1399 324
47 3300049592 Ga0501076_0158147 Ga0501076_0158147_192_1169 324
48 3300049824 Ga0501045_0049238 Ga0501045_0049238_1349_2326 324
49 3300061734 Ga0530510_0026702 Ga0530510_0026702_1037_2014 324
50 3300006175 Ga0070712_100035933 Ga0070712_1000359333 326
51 3300006358 Ga0068871_100050788 Ga0068871_1000507883 326
52 3300035398 Ga0316574_0001485 Ga0316574_0001485_9857_10837 326
53 3300005457 Ga0070662_100000006 Ga0070662_100000006152 327
54 3300014968 Ga0157379_10000776 Ga0157379_1000077617 327
55 3300025933 Ga0207706_10000017 Ga0207706_10000017152 327
56 3300031852 Ga0307410_10016448 Ga0307410_100164483 327
57 3300035725 Ga0373947_0007908 Ga0373947_0007908_3127_4125 327
58 3300046660 Ga0495625_0000506 Ga0495625_0000506_32543_33526 327
59 3300048912 Ga0496109_0150737 Ga0496109_0150737_831_1865 327
60 3300048916 Ga0496113_0024599 Ga0496113_0024599_2256_3290 327
61 3300005539 Ga0068853_100002382 Ga0068853_10000238210 328
62 3300044712 Ga0453684_0008015 Ga0453684_0008015_13963_15012 328
63 3300050492 nmdc:mga0yw44_36129_c1 nmdc:mga0yw44_36129_c1_877_1863 328
64 3300028666 Ga0265336_10028123 Ga0265336_100281232 329
65 3300046690 Ga0495624_0006535 Ga0495624_0006535_3909_4904 331
66 3300046691 Ga0495670_0043872 Ga0495670_0043872_1202_2197 331
67 3300046516 Ga0495628_0007112 Ga0495628_0007112_4660_5667 335
68 3300005459 Ga0068867_100415037 Ga0068867_1004150371 338
69 3300005937 Ga0081455_10179284 Ga0081455_101792842 338
70 3300005981 Ga0081538_10001245 Ga0081538_1000124510 338
71 3300005983 Ga0081540_1002177 Ga0081540_10021777 338
72 3300037466 Ga0395898_0388719 Ga0395898_0388719_202_1236 338
73 3300037471 Ga0395905_0374815 Ga0395905_0374815_192_1226 338
74 3300041486 Ga0451807_0074477 Ga0451807_0074477_27_1043 338
75 3300049571 Ga0501034_0198057 Ga0501034_0198057_422_1450 338
76 3300050491 nmdc:mga00v17_29452_c1 nmdc:mga00v17_29452_c1_1491_2519 338
77 3300003659 JGI25404J52841_10002203 JGI25404J52841_100022032 339
78 3300005338 Ga0068868_100000633 Ga0068868_10000063314 339
79 3300005338 Ga0068868_100096634 Ga0068868_1000966341 339
80 3300005341 Ga0070691_10000362 Ga0070691_100003622 339
81 3300005367 Ga0070667_100078840 Ga0070667_1000788403 339
82 3300005439 Ga0070711_100055179 Ga0070711_1000551792 339
83 3300005545 Ga0070695_100108106 Ga0070695_1001081061 339
84 3300005719 Ga0068861_100244433 Ga0068861_1002444332 339
85 3300005937 Ga0081455_10139603 Ga0081455_101396031 339
86 3300005937 Ga0081455_10142550 Ga0081455_101425502 339
87 3300005983 Ga0081540_1000041 Ga0081540_1000041125 339
88 3300005985 Ga0081539_10005004 Ga0081539_100050045 339
89 3300006038 Ga0075365_10000786 Ga0075365_1000078611 339
90 3300006038 Ga0075365_10003681 Ga0075365_100036814 339
91 3300009094 Ga0111539_10078936 Ga0111539_100789362 339
92 3300009098 Ga0105245_10000212 Ga0105245_1000021251 339
93 3300009098 Ga0105245_10008471 Ga0105245_100084719 339
94 3300009147 Ga0114129_10061004 Ga0114129_100610045 339
95 3300009176 Ga0105242_10000085 Ga0105242_1000008519 339
96 3300013308 Ga0157375_10008154 Ga0157375_100081546 339
97 3300013308 Ga0157375_10108582 Ga0157375_101085823 339
98 3300014968 Ga0157379_10111289 Ga0157379_101112892 339
99 3300014969 Ga0157376_10037762 Ga0157376_100377624 339
100 3300021384 Ga0213876_10111526 Ga0213876_101115262 339
101 3300025916 Ga0207663_10195145 Ga0207663_101951452 339
102 3300025927 Ga0207687_10000020 Ga0207687_1000002018 339
103 3300025928 Ga0207700_10060329 Ga0207700_100603292 339
104 3300025929 Ga0207664_10002248 Ga0207664_100022486 339
105 3300025929 Ga0207664_10193727 Ga0207664_101937272 339
106 3300025934 Ga0207686_10000199 Ga0207686_1000019919 339
107 3300025986 Ga0207658_10192774 Ga0207658_101927742 339
108 3300025986 Ga0207658_10223299 Ga0207658_102232992 339
109 3300026067 Ga0207678_10229174 Ga0207678_102291742 339
110 3300026078 Ga0207702_10310618 Ga0207702_103106181 339
111 3300026118 Ga0207675_100255823 Ga0207675_1002558231 339
112 3300028379 Ga0268266_10051791 Ga0268266_100517914 339
113 3300037471 Ga0395905_0187403 Ga0395905_0187403_787_1818 339
114 3300038443 Ga0395901_0159927 Ga0395901_0159927_1241_2272 339
115 3300038443 Ga0395901_0225504 Ga0395901_0225504_344_1378 339
116 3300038443 Ga0395901_0519605 Ga0395901_0519605_80_1111 339
117 3300039437 Ga0436365_1273335 Ga0436365_1273335_1918_2937 339
118 3300044656 Ga0466969_0066147 Ga0466969_0066147_695_1726 339
119 3300044684 Ga0466966_0036370 Ga0466966_0036370_1303_2334 339
120 3300044693 Ga0466961_0017152 Ga0466961_0017152_2258_3289 339
121 3300044694 Ga0466963_0015057 Ga0466963_0015057_2546_3577 339
122 3300044694 Ga0466963_0212556 Ga0466963_0212556_205_1236 339
123 3300044842 Ga0466957_0002188 Ga0466957_0002188_2033_3064 339
124 3300044901 Ga0466960_0062517 Ga0466960_0062517_177_1208 339
125 3300045049 Ga0466959_0026004 Ga0466959_0026004_405_1436 339
126 3300045836 Ga0466958_0014398 Ga0466958_0014398_1445_2476 339
127 3300045836 Ga0466958_0016729 Ga0466958_0016729_1031_2062 339
128 3300045836 Ga0466958_0183722 Ga0466958_0183722_233_1264 339
129 3300045976 Ga0466967_0423693 Ga0466967_0423693_217_1248 339
130 3300046477 Ga0495664_0027111 Ga0495664_0027111_1799_2830 339
131 3300046516 Ga0495628_0034880 Ga0495628_0034880_885_1916 339
132 3300047319 Ga0495674_0281603 Ga0495674_0281603_214_1245 339
133 3300047446 Ga0495679_029989 Ga0495679_029989_533_1564 339
134 3300048905 Ga0496102_0000081 Ga0496102_0000081_116503_117534 339
135 3300048906 Ga0496103_0000031 Ga0496103_0000031_20810_21841 339
136 3300048907 Ga0496104_0013755 Ga0496104_0013755_6090_7124 339
137 3300048908 Ga0496105_0021785 Ga0496105_0021785_1625_2659 339
138 3300048909 Ga0496106_0001777 Ga0496106_0001777_12342_13376 339
139 3300048910 Ga0496107_0005273 Ga0496107_0005273_1094_2128 339
140 3300048910 Ga0496107_0094579 Ga0496107_0094579_676_1710 339
141 3300048912 Ga0496109_0461188 Ga0496109_0461188_142_1173 339
142 3300048913 Ga0496110_0035518 Ga0496110_0035518_188_1222 339
143 3300048914 Ga0496111_0013159 Ga0496111_0013159_694_1728 339
144 3300048914 Ga0496111_0045476 Ga0496111_0045476_276_1307 339
145 3300048915 Ga0496112_0000085 Ga0496112_0000085_19147_20184 339
146 3300048916 Ga0496113_0032820 Ga0496113_0032820_711_1745 339
147 3300048917 Ga0496114_0000450 Ga0496114_0000450_8450_9481 339
148 3300048917 Ga0496114_0001473 Ga0496114_0001473_10635_11669 339
149 3300048918 Ga0496115_0000533 Ga0496115_0000533_8439_9470 339
150 3300049592 Ga0501076_0177087 Ga0501076_0177087_677_1708 339
151 3300050492 nmdc:mga0yw44_5272_c1 nmdc:mga0yw44_5272_c1_477_1511 339
152 3300050510 nmdc:mga06r32_197770_c1 nmdc:mga06r32_197770_c1_749_1783 339
153 3300050510 nmdc:mga06r32_5197_c1 nmdc:mga06r32_5197_c1_2321_3361 339
154 3300050513 nmdc:mga0rr50_37958_c1 nmdc:mga0rr50_37958_c1_2222_3256 339
155 3300050514 nmdc:mga08x19_81011_c1 nmdc:mga08x19_81011_c1_777_1811 339
156 3300053078 Ga0495612_0001134 Ga0495612_0001134_4089_5120 339
157 3300053078 Ga0495612_0044099 Ga0495612_0044099_568_1599 339
158 3300053083 Ga0495655_0000023 Ga0495655_0000023_16355_17386 339
159 3300053085 Ga0495619_0023290 Ga0495619_0023290_2460_3494 339
160 3300053129 Ga0500628_000001 Ga0500628_000001_425081_426112 339
161 3300061719 Ga0466962_0007462 Ga0466962_0007462_896_1927 339
162 3300003373 JGI25407J50210_10016450 JGI25407J50210_100164502 340
163 3300005329 Ga0070683_100004551 Ga0070683_1000045513 340
164 3300005329 Ga0070683_100025146 Ga0070683_1000251465 340
165 3300005333 Ga0070677_10000222 Ga0070677_100002227 340
166 3300005336 Ga0070680_100017005 Ga0070680_1000170052 340
167 3300005337 Ga0070682_100000030 Ga0070682_100000030164 340
168 3300005341 Ga0070691_10009792 Ga0070691_100097921 340
169 3300005356 Ga0070674_100000012 Ga0070674_100000012110 340
170 3300005364 Ga0070673_100000474 Ga0070673_1000004743 340
171 3300005439 Ga0070711_100086100 Ga0070711_1000861002 340
172 3300005456 Ga0070678_100322788 Ga0070678_1003227882 340
173 3300005458 Ga0070681_10003891 Ga0070681_100038917 340
174 3300005459 Ga0068867_100002668 Ga0068867_1000026683 340
175 3300005530 Ga0070679_100000844 Ga0070679_10000084415 340
176 3300005535 Ga0070684_100018589 Ga0070684_1000185893 340
177 3300005548 Ga0070665_100000040 Ga0070665_10000004018 340
178 3300005578 Ga0068854_100015068 Ga0068854_1000150683 340
179 3300005614 Ga0068856_100012946 Ga0068856_1000129465 340
180 3300005614 Ga0068856_100212664 Ga0068856_1002126642 340
181 3300005718 Ga0068866_10000062 Ga0068866_100000627 340
182 3300005841 Ga0068863_100000107 Ga0068863_10000010779 340
183 3300005842 Ga0068858_100000075 Ga0068858_10000007579 340
184 3300005842 Ga0068858_100001009 Ga0068858_10000100913 340
185 3300005843 Ga0068860_100010512 Ga0068860_1000105122 340
186 3300005981 Ga0081538_10000584 Ga0081538_1000058419 340
187 3300006163 Ga0070715_10000014 Ga0070715_10000014148 340
188 3300006852 Ga0075433_10000244 Ga0075433_1000024415 340
189 3300009098 Ga0105245_10025031 Ga0105245_100250312 340
190 3300009101 Ga0105247_10001338 Ga0105247_1000133811 340
191 3300009176 Ga0105242_10043690 Ga0105242_100436902 340
192 3300009551 Ga0105238_10000048 Ga0105238_10000048122 340
193 3300009553 Ga0105249_10000070 Ga0105249_1000007020 340
194 3300009553 Ga0105249_10073278 Ga0105249_100732783 340
195 3300013296 Ga0157374_10001900 Ga0157374_100019003 340
196 3300013296 Ga0157374_10206690 Ga0157374_102066902 340
197 3300013308 Ga0157375_10000130 Ga0157375_1000013048 340
198 3300014968 Ga0157379_10014841 Ga0157379_100148412 340
199 3300014968 Ga0157379_10059842 Ga0157379_100598423 340
200 3300017792 Ga0163161_10000160 Ga0163161_1000016041 340
201 3300025893 Ga0207682_10000140 Ga0207682_1000014011 340
202 3300025899 Ga0207642_10000104 Ga0207642_100001047 340
203 3300025900 Ga0207710_10000243 Ga0207710_1000024322 340
204 3300025905 Ga0207685_10000025 Ga0207685_1000002519 340
205 3300025912 Ga0207707_10003475 Ga0207707_100034753 340
206 3300025913 Ga0207695_10520673 Ga0207695_105206731 340
207 3300025916 Ga0207663_10000748 Ga0207663_100007489 340
208 3300025917 Ga0207660_10011123 Ga0207660_100111234 340
209 3300025921 Ga0207652_10001209 Ga0207652_1000120919 340
210 3300025923 Ga0207681_10272907 Ga0207681_102729071 340
211 3300025924 Ga0207694_10000056 Ga0207694_10000056122 340
212 3300025927 Ga0207687_10001900 Ga0207687_1000190011 340
213 3300025934 Ga0207686_10022555 Ga0207686_100225553 340
214 3300025937 Ga0207669_10000017 Ga0207669_1000001795 340
215 3300025944 Ga0207661_10016784 Ga0207661_100167844 340
216 3300025960 Ga0207651_10000664 Ga0207651_100006643 340
217 3300025961 Ga0207712_10000019 Ga0207712_10000019291 340
218 3300025981 Ga0207640_10005255 Ga0207640_100052555 340
219 3300026035 Ga0207703_10000088 Ga0207703_1000008879 340
220 3300026035 Ga0207703_10000166 Ga0207703_1000016660 340
221 3300026041 Ga0207639_10002098 Ga0207639_100020987 340
222 3300026078 Ga0207702_10004436 Ga0207702_100044367 340
223 3300026078 Ga0207702_10436851 Ga0207702_104368512 340
224 3300026088 Ga0207641_10000077 Ga0207641_10000077106 340
225 3300026089 Ga0207648_10001799 Ga0207648_1000179923 340
226 3300028379 Ga0268266_10000045 Ga0268266_1000004521 340
227 3300028381 Ga0268264_10012409 Ga0268264_100124096 340
228 3300028556 Ga0265337_1000805 Ga0265337_10008058 340
229 3300028558 Ga0265326_10000084 Ga0265326_1000008420 340
230 3300028563 Ga0265319_1000110 Ga0265319_100011043 340
231 3300028654 Ga0265322_10000198 Ga0265322_1000019820 340
232 3300028666 Ga0265336_10008191 Ga0265336_100081913 340
233 3300028800 Ga0265338_10000578 Ga0265338_1000057844 340
234 3300029957 Ga0265324_10014111 Ga0265324_100141112 340
235 3300030521 Ga0307511_10078837 Ga0307511_100788372 340
236 3300031239 Ga0265328_10019228 Ga0265328_100192282 340
237 3300031240 Ga0265320_10000035 Ga0265320_10000035101 340
238 3300031241 Ga0265325_10007176 Ga0265325_100071764 340
239 3300031250 Ga0265331_10007831 Ga0265331_100078314 340
240 3300031251 Ga0265327_10000015 Ga0265327_10000015397 340
241 3300031711 Ga0265314_10000690 Ga0265314_1000069018 340
242 3300031712 Ga0265342_10097381 Ga0265342_100973812 340
243 3300036401 Ga0373937_0027510 Ga0373937_0027510_1814_2836 340
244 3300041512 Ga0451853_0543742 Ga0451853_0543742_420_1454 340
245 3300044694 Ga0466963_0000022 Ga0466963_0000022_22289_23326 340
246 3300046454 Ga0495592_0000912 Ga0495592_0000912_15914_16975 340
247 3300046454 Ga0495592_0029322 Ga0495592_0029322_2164_3198 340
248 3300046455 Ga0495603_0000471 Ga0495603_0000471_9336_10370 340
249 3300046455 Ga0495603_0000594 Ga0495603_0000594_174_1208 340
250 3300046455 Ga0495603_0005958 Ga0495603_0005958_6187_7254 340
251 3300046461 Ga0495641_0000027 Ga0495641_0000027_24884_25918 340
252 3300046462 Ga0495651_0083452 Ga0495651_0083452_1109_2143 340
253 3300046463 Ga0495653_0028868 Ga0495653_0028868_1485_2519 340
254 3300046463 Ga0495653_0057966 Ga0495653_0057966_1878_2900 340
255 3300046463 Ga0495653_0062354 Ga0495653_0062354_1623_2657 340
256 3300046473 Ga0495582_0000001 Ga0495582_0000001_207372_208412 340
257 3300046476 Ga0495662_0000133 Ga0495662_0000133_8097_9140 340
258 3300046511 Ga0495608_0001821 Ga0495608_0001821_86_1129 340
259 3300046511 Ga0495608_0055193 Ga0495608_0055193_1480_2514 340
260 3300046514 Ga0495618_0000126 Ga0495618_0000126_34795_35898 340
261 3300046515 Ga0495620_0002158 Ga0495620_0002158_3481_4518 340
262 3300046516 Ga0495628_0001493 Ga0495628_0001493_18923_19966 340
263 3300046516 Ga0495628_0047754 Ga0495628_0047754_297_1331 340
264 3300046516 Ga0495628_0080344 Ga0495628_0080344_96_1133 340
265 3300046516 Ga0495628_0139172 Ga0495628_0139172_15_1049 340
266 3300046516 Ga0495628_0271674 Ga0495628_0271674_120_1154 340
267 3300046517 Ga0495630_0003163 Ga0495630_0003163_3630_4664 340
268 3300046517 Ga0495630_0004451 Ga0495630_0004451_8028_9062 340
269 3300046517 Ga0495630_0126815 Ga0495630_0126815_22_1056 340
270 3300046523 Ga0495644_0004551 Ga0495644_0004551_851_1885 340
271 3300046533 Ga0495640_0162131 Ga0495640_0162131_228_1262 340
272 3300046535 Ga0495586_0008633 Ga0495586_0008633_1306_2340 340
273 3300046536 Ga0495587_0034683 Ga0495587_0034683_499_1533 340
274 3300046537 Ga0495598_0007390 Ga0495598_0007390_362_1396 340
275 3300046539 Ga0495621_0036303 Ga0495621_0036303_438_1472 340
276 3300046543 Ga0495645_0001215 Ga0495645_0001215_794_1828 340
277 3300046559 Ga0495667_0000034 Ga0495667_0000034_116736_117773 340
278 3300046615 Ga0495656_0000935 Ga0495656_0000935_967_2001 340
279 3300046642 Ga0495634_0000028 Ga0495634_0000028_94092_95126 340
280 3300046642 Ga0495634_0001510 Ga0495634_0001510_17564_18598 340
281 3300046642 Ga0495634_0024040 Ga0495634_0024040_3126_4160 340
282 3300046663 Ga0495635_0000005 Ga0495635_0000005_281229_282263 340
283 3300046675 Ga0495657_0006985 Ga0495657_0006985_3707_4741 340
284 3300046678 Ga0495599_0033038 Ga0495599_0033038_980_2014 340
285 3300046681 Ga0495647_0000043 Ga0495647_0000043_16100_17134 340
286 3300046681 Ga0495647_0001875 Ga0495647_0001875_42_1076 340
287 3300046681 Ga0495647_0052499 Ga0495647_0052499_371_1405 340
288 3300046683 Ga0495658_0000193 Ga0495658_0000193_16208_17248 340
289 3300046684 Ga0495669_0000102 Ga0495669_0000102_32496_33533 340
290 3300046689 Ga0495613_0000282 Ga0495613_0000282_25416_26450 340
291 3300046689 Ga0495613_0144526 Ga0495613_0144526_356_1390 340
292 3300046689 Ga0495613_0232722 Ga0495613_0232722_204_1238 340
293 3300046690 Ga0495624_0000587 Ga0495624_0000587_20116_21150 340
294 3300046694 Ga0495649_0015907 Ga0495649_0015907_1020_2054 340
295 3300046809 Ga0495600_0001288 Ga0495600_0001288_9064_10167 340
296 3300047317 Ga0495604_0000267 Ga0495604_0000267_18218_19252 340
297 3300047321 Ga0495676_0004205 Ga0495676_0004205_152_1186 340
298 3300047321 Ga0495676_0070411 Ga0495676_0070411_1070_2113 340
299 3300047322 Ga0495680_0000193 Ga0495680_0000193_19030_20052 340
300 3300047322 Ga0495680_0001649 Ga0495680_0001649_2572_3609 340
301 3300047322 Ga0495680_0005500 Ga0495680_0005500_2375_3409 340
302 3300047322 Ga0495680_0056393 Ga0495680_0056393_820_1857 340
303 3300048903 Ga0496100_0000014 Ga0496100_0000014_23819_24856 340
304 3300048904 Ga0496101_0000036 Ga0496101_0000036_24423_25460 340
305 3300048907 Ga0496104_0000024 Ga0496104_0000024_22094_23131 340
306 3300048907 Ga0496104_0000077 Ga0496104_0000077_23453_24487 340
307 3300048907 Ga0496104_0001546 Ga0496104_0001546_11011_12045 340
308 3300048908 Ga0496105_0000004 Ga0496105_0000004_76362_77396 340
309 3300048908 Ga0496105_0000013 Ga0496105_0000013_206783_207820 340
310 3300048908 Ga0496105_0000098 Ga0496105_0000098_43587_44621 340
311 3300048909 Ga0496106_0000043 Ga0496106_0000043_84575_85612 340
312 3300048909 Ga0496106_0001892 Ga0496106_0001892_3730_4764 340
313 3300048910 Ga0496107_0000271 Ga0496107_0000271_20240_21277 340
314 3300048910 Ga0496107_0034082 Ga0496107_0034082_915_1949 340
315 3300048911 Ga0496108_0000006 Ga0496108_0000006_207570_208607 340
316 3300048911 Ga0496108_0001109 Ga0496108_0001109_5535_6569 340
317 3300048912 Ga0496109_0000004 Ga0496109_0000004_380313_381350 340
318 3300048913 Ga0496110_0020077 Ga0496110_0020077_3692_4726 340
319 3300048914 Ga0496111_0142094 Ga0496111_0142094_732_1766 340
320 3300048916 Ga0496113_0058078 Ga0496113_0058078_477_1511 340
321 3300048917 Ga0496114_0018100 Ga0496114_0018100_3792_4826 340
322 3300048918 Ga0496115_0001569 Ga0496115_0001569_7008_8045 340
323 3300048922 Ga0496119_0030772 Ga0496119_0030772_2078_3112 340
324 3300049578 Ga0501042_0238718 Ga0501042_0238718_18_1052 340
325 3300049586 Ga0501070_0103468 Ga0501070_0103468_193_1227 340
326 3300049591 Ga0501075_0003224 Ga0501075_0003224_5608_6642 340
327 3300050510 nmdc:mga06r32_21158_c1 nmdc:mga06r32_21158_c1_3999_5033 340
328 3300050515 nmdc:mga0a205_45_c1 nmdc:mga0a205_45_c1_18029_19063 340
329 3300053077 Ga0495601_0000156 Ga0495601_0000156_19119_20153 340
330 3300053077 Ga0495601_0002961 Ga0495601_0002961_5499_6533 340
331 3300053077 Ga0495601_0004249 Ga0495601_0004249_6492_7526 340
332 3300053077 Ga0495601_0022333 Ga0495601_0022333_2068_3102 340
333 3300053078 Ga0495612_0003529 Ga0495612_0003529_1605_2639 340
334 3300053078 Ga0495612_0006194 Ga0495612_0006194_1648_2682 340
335 3300053078 Ga0495612_0052991 Ga0495612_0052991_166_1200 340
336 3300053084 Ga0495595_0000200 Ga0495595_0000200_19086_20108 340
337 3300053085 Ga0495619_0000008 Ga0495619_0000008_285689_286723 340
338 3300053085 Ga0495619_0000929 Ga0495619_0000929_17388_18425 340
339 3300053085 Ga0495619_0003076 Ga0495619_0003076_5598_6632 340
340 3300053085 Ga0495619_0006703 Ga0495619_0006703_1502_2536 340
341 3300053123 Ga0500614_007238 Ga0500614_007238_161_1195 340

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

49

133

0.94

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

174

283

0.9

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

205

364

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lhr-assembly2.cif.gz_C crystal structure of the complex between vesicle amine transport-1 and nadp 0.947 2 340
4a27-assembly1.cif.gz_B crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.9384 2 340
4a27-assembly1.cif.gz_A crystal structure of human synaptic vesicle membrane protein vat-1 homolog-like protein 0.9383 2 338
6lhr-assembly2.cif.gz_C crystal structure of the complex between vesicle amine transport-1 and nadp 0.9335 2 340
6k9y-assembly2.cif.gz_C crystal structure of human vat-1 0.9305 2 339
ID Description Score Start End Superfamily
af_M0R3N4_1_117_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9735 2 111 3.90.180.10
af_O07721_1_120_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9691 2 114 3.90.180.10
af_O07721_2_333_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9666 2 338 3.40.50.1000
af_O45496_9_126_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9625 2 114 3.90.180.10
af_Q3UNZ8_26_154_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9573 12 123 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A7J8CMU9-F1-model_v4 Vesicle amine transport 1 like 0.9766 2 113
AF-A0A5E6MFL2-F1-model_v4 Partial enoyl reductase 0.9711 2 158 GO:0003730
GO:0003960
GO:0005829
GO:0070402
AF-A0A2E4KUR3-F1-model_v4 Alcohol dehydrogenase 0.9689 2 237 GO:0008270
GO:0016491
AF-A0A2E5U0V2-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9673 2 338 GO:0016491
AF-A0A7J8BEY9-F1-model_v4 Enoyl reductase (ER) domain-containing protein 0.9663 14 163 GO:0005739
GO:0016491

Feature Viewer

pLDDT pTM Quality
89.49 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map