F414927

General Info

Members Datasets Scaffolds Average Seq Length
341 193 332 277

Family's Representative Sequence

Representative Sequence 3300049705|Ga0501225_0002117|Ga0501225_0002117_2174_3148
Length 324
Sequence MVQQASLTNRDCILYFTFSVFHHYKTTSWYVQDPRCMVFLLPSAAQLNCMPFTRYLLIVLILTVVYITATSQQKAKLNVLAFYTAKHDQAHISFVHEANRWFAQQAAQYHFQYDSTNDWSLLNTSNLSKYQVIVFLDTRPDDEAQRTAFETYMRNGGAWIGFHFAAFALTPSTYPQNWDWYHNQLLGSGQYVGNTWRPTAAVLRVEHKKHPATRHLPVTFRSAPNEWYKWEKDLRQNPDIEILLAIDSTSFPLGTGPKQHEIWHSGYYPVVWTNKKYKMLYLNMGHNDIDYEHKTSKELSFTFDNKEQGKLIIDGLFWLTGASH

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
7 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
8 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
9 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
10 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
11 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
12 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
16 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
17 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
18 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
19 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
85 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
135 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
136 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
137 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
138 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
139 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
140 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
141 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
142 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
143 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
144 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
145 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
146 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
147 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
148 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
160 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
161 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
162 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
163 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
164 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
169 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
170 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
171 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
172 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
173 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
174 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
175 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
176 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
177 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
180 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
181 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
182 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
189 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
190 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
191 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
192 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.36
Metatranscriptomes 0
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 0
Rhizoplane 0
Rhizosphere 86.22
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1007454 3300002738 Bacteria 1497
2 rootH1_10137592 3300003316 Bacteria 1947
3 rootH2_10001122 3300003320 Bacteria 34823
4 rootH2_10005823 3300003320 Bacteria 10887
5 rootL2_10005207 3300003322 Bacteria 1303
6 rootH1_10006403 3300003323 Bacteria 91171
7 rootH1_10027584 3300003323 Bacteria 7602
8 rootH1_10042710 3300003323 Bacteria 5286
9 rootH1_10076533 3300003323 Bacteria 6367
10 rootH1_10166439 3300003323 Bacteria 3170
11 rootH1_10310914 3300003323 Bacteria 1091
12 Ga0055536_1000001 3300003781 Bacteria 630663
13 Ga0055536_1011371 3300003781 Bacteria 3420
14 Ga0055530_10002341 3300003791 Bacteria 12353
15 Ga0055531_10000102 3300003794 Bacteria 92703
16 Ga0055531_10000118 3300003794 Bacteria 88104
17 Ga0065165_1000169 3300005262 Bacteria 115398
18 Ga0065165_1003050 3300005262 Bacteria 12558
19 Ga0065714_10123915 3300005288 Bacteria 1317
20 Ga0065704_10085633 3300005289 Unclassified 3201
21 Ga0065704_10165771 3300005289 Bacteria 1323
22 Ga0070658_10059735 3300005327 Bacteria 3105
23 Ga0070658_10258774 3300005327 Bacteria 1478
24 Ga0070683_100050106 3300005329 Bacteria 3864
25 Ga0070683_100079345 3300005329 Bacteria 3072
26 Ga0070683_100136298 3300005329 Bacteria 2325
27 Ga0070670_100090117 3300005331 Bacteria 2636
28 Ga0070666_10041958 3300005335 Bacteria 3059
29 Ga0070680_100046872 3300005336 Bacteria 3517
30 Ga0070682_100016629 3300005337 Bacteria 4280
31 Ga0070682_100025413 3300005337 Bacteria 3534
32 Ga0070660_100011259 3300005339 Bacteria 6349
33 Ga0070660_100039288 3300005339 Bacteria 3596
34 Ga0070660_100451582 3300005339 Bacteria 1066
35 Ga0070689_100014598 3300005340 Bacteria 5710
36 Ga0070661_100016911 3300005344 Bacteria 5164
37 Ga0070661_100074504 3300005344 Bacteria 2500
38 Ga0070675_100023600 3300005354 Bacteria 4920
39 Ga0070675_100037707 3300005354 Bacteria 3939
40 Ga0070675_100047950 3300005354 Bacteria 3502
41 Ga0070675_100391419 3300005354 Bacteria 1238
42 Ga0070671_100055508 3300005355 Bacteria 3295
43 Ga0070673_100127974 3300005364 Bacteria 2127
44 Ga0070673_100128559 3300005364 Bacteria 2122
45 Ga0070688_100035206 3300005365 Bacteria 3040
46 Ga0070659_100018470 3300005366 Bacteria 5262
47 Ga0070659_100025524 3300005366 Bacteria 4540
48 Ga0070667_100010467 3300005367 Bacteria 7659
49 Ga0070678_100306228 3300005456 Bacteria 1352
50 Ga0070662_100026289 3300005457 Bacteria 4029
51 Ga0070685_10191362 3300005466 Bacteria 1324
52 Ga0070679_100007276 3300005530 Bacteria 10334
53 Ga0070679_100074055 3300005530 Bacteria 3396
54 Ga0070679_100307000 3300005530 Bacteria 1537
55 Ga0070684_100016960 3300005535 Bacteria 5968
56 Ga0070684_100132442 3300005535 Bacteria 2249
57 Ga0070684_100431256 3300005535 Bacteria 1217
58 Ga0068853_100042556 3300005539 Bacteria 3884
59 Ga0068853_100069166 3300005539 Bacteria 3071
60 Ga0068853_100089456 3300005539 Bacteria 2704
61 Ga0070693_100072165 3300005547 Bacteria 2036
62 Ga0070665_100000066 3300005548 Bacteria 212791
63 Ga0068855_100018704 3300005563 Bacteria 8330
64 Ga0068855_100091790 3300005563 Bacteria 3503
65 Ga0068855_100099807 3300005563 Bacteria 3343
66 Ga0068855_100133306 3300005563 Bacteria 2835
67 Ga0070664_100017050 3300005564 Bacteria 5963
68 Ga0070664_100118103 3300005564 Bacteria 2320
69 Ga0068857_100002107 3300005577 Bacteria 16167
70 Ga0068857_100042669 3300005577 Bacteria 4024
71 Ga0068857_100110181 3300005577 Unclassified 2474
72 Ga0068854_100172444 3300005578 Unclassified 1684
73 Ga0068856_100044707 3300005614 Bacteria 4359
74 Ga0068856_100048598 3300005614 Bacteria 4182
75 Ga0068856_100071449 3300005614 Bacteria 3436
76 Ga0068856_100253941 3300005614 Bacteria 1773
77 Ga0070702_100212694 3300005615 Bacteria 1288
78 Ga0068852_100004016 3300005616 Bacteria 10346
79 Ga0068852_100131110 3300005616 Bacteria 2308
80 Ga0068852_100165116 3300005616 Bacteria 2071
81 Ga0068852_100557058 3300005616 Bacteria 1147
82 Ga0068859_100000018 3300005617 Bacteria 248813
83 Ga0068859_100338234 3300005617 Unclassified 1599
84 Ga0068864_100037518 3300005618 Bacteria 4135
85 Ga0068863_100006638 3300005841 Bacteria 11355
86 Ga0068858_100061442 3300005842 Bacteria 3473
87 Ga0068860_100000041 3300005843 Bacteria 227790
88 Ga0068860_100016612 3300005843 Bacteria 7178
89 Ga0068862_100034398 3300005844 Bacteria 4287
90 Ga0068862_100165556 3300005844 Unclassified 1976
91 Ga0075366_10009752 3300006195 Bacteria 5369
92 Ga0097621_100025600 3300006237 Bacteria 4618
93 Ga0097621_100053801 3300006237 Bacteria 3281
94 Ga0068871_100014736 3300006358 Bacteria 5835
95 Ga0068871_100067855 3300006358 Bacteria 2927
96 Ga0097620_100000018 3300006931 Bacteria 248813
97 Ga0097620_100338219 3300006931 Unclassified 1599
98 Ga0105240_10004288 3300009093 Bacteria 21788
99 Ga0105240_10033858 3300009093 Bacteria 6598
100 Ga0111539_10263689 3300009094 Bacteria 2005
101 Ga0105247_10096393 3300009101 Bacteria 1885
102 Ga0105243_10165331 3300009148 Bacteria 1912
103 Ga0105241_10000245 3300009174 Bacteria 41232
104 Ga0105241_10001853 3300009174 Bacteria 16036
105 Ga0105241_10083025 3300009174 Unclassified 2513
106 Ga0105241_10438030 3300009174 Bacteria 1154
107 Ga0105237_10000326 3300009545 Bacteria 67087
108 Ga0105237_10007487 3300009545 Bacteria 11940
109 Ga0105237_10007949 3300009545 Bacteria 11556
110 Ga0105237_10374303 3300009545 Bacteria 1429
111 Ga0105238_10028024 3300009551 Bacteria 5739
112 Ga0105249_10120313 3300009553 Bacteria 2494
113 Ga0105249_10176513 3300009553 Bacteria 2075
114 Ga0105249_10829753 3300009553 Bacteria 989
115 Ga0105239_10002198 3300010375 Bacteria 25092
116 Ga0105239_10009584 3300010375 Bacteria 10893
117 Ga0105239_10009914 3300010375 Bacteria 10697
118 Ga0105239_10042029 3300010375 Bacteria 5008
119 Ga0157373_10004162 3300013100 Bacteria 10908
120 Ga0157371_10001959 3300013102 Bacteria 20458
121 Ga0157371_10002354 3300013102 Bacteria 18085
122 Ga0157371_10016277 3300013102 Bacteria 5555
123 Ga0157371_10032874 3300013102 Bacteria 3730
124 Ga0157370_10004268 3300013104 Bacteria 16462
125 Ga0157370_10010860 3300013104 Bacteria 9565
126 Ga0157370_10012290 3300013104 Bacteria 8886
127 Ga0157370_10013222 3300013104 Bacteria 8508
128 Ga0157370_10030786 3300013104 Bacteria 5256
129 Ga0157370_10039140 3300013104 Bacteria 4582
130 Ga0157370_10045811 3300013104 Bacteria 4196
131 Ga0157369_10077375 3300013105 Bacteria 3566
132 Ga0157369_10108622 3300013105 Bacteria 2950
133 Ga0157369_10115319 3300013105 Bacteria 2853
134 Ga0157369_10263468 3300013105 Bacteria 1797
135 Ga0157374_10001536 3300013296 Bacteria 19448
136 Ga0157374_10052434 3300013296 Bacteria 3799
137 Ga0157374_10199821 3300013296 Bacteria 1957
138 Ga0157378_10057309 3300013297 Bacteria 3472
139 Ga0157378_10096829 3300013297 Bacteria 2689
140 Ga0157378_10455050 3300013297 Unclassified 1271
141 Ga0163162_10000686 3300013306 Bacteria 31389
142 Ga0163162_10089120 3300013306 Bacteria 3165
143 Ga0163162_10155596 3300013306 Bacteria 2406
144 Ga0163162_10405789 3300013306 Bacteria 1495
145 Ga0157372_10003776 3300013307 Bacteria 16262
146 Ga0157372_10047554 3300013307 Bacteria 4768
147 Ga0157372_10868244 3300013307 Bacteria 1047
148 Ga0157375_11134802 3300013308 Bacteria 916
149 Ga0163163_10000218 3300014325 Bacteria 59659
150 Ga0157377_10006866 3300014745 Bacteria 5458
151 Ga0157376_10029728 3300014969 Bacteria 4355
152 Ga0157376_10123868 3300014969 Bacteria 2295
153 Ga0157376_10230631 3300014969 Bacteria 1720
154 Ga0157376_10317137 3300014969 Bacteria 1481
155 Ga0182006_1000301 3300015261 Bacteria 43124
156 Ga0163161_10043708 3300017792 Bacteria 3226
157 Ga0209646_1001524 3300025246 Bacteria 6127
158 Ga0209130_1002251 3300025284 Bacteria 10019
159 Ga0209676_1000008 3300025292 Bacteria 991778
160 Ga0209676_1000329 3300025292 Bacteria 91571
161 Ga0209050_1000045 3300025298 Bacteria 388022
162 Ga0207426_1000009 3300025302 Bacteria 797229
163 Ga0207426_1000234 3300025302 Bacteria 126926
164 Ga0209257_1000004 3300025304 Bacteria 1678347
165 Ga0209257_1000007 3300025304 Bacteria 1564415
166 Ga0207710_10067288 3300025900 Bacteria 1636
167 Ga0207647_10015976 3300025904 Bacteria 5131
168 Ga0207647_10029836 3300025904 Bacteria 3524
169 Ga0207647_10079350 3300025904 Unclassified 1971
170 Ga0207705_10072137 3300025909 Bacteria 2504
171 Ga0207705_10289205 3300025909 Bacteria 1255
172 Ga0207654_10000877 3300025911 Bacteria 16695
173 Ga0207654_10002223 3300025911 Bacteria 9956
174 Ga0207654_10017977 3300025911 Bacteria 3706
175 Ga0207654_10056869 3300025911 Unclassified 2271
176 Ga0207707_10007628 3300025912 Bacteria 9428
177 Ga0207695_10000013 3300025913 Bacteria 821265
178 Ga0207695_10038211 3300025913 Bacteria 5171
179 Ga0207695_10058011 3300025913 Unclassified 4020
180 Ga0207671_10000875 3300025914 Bacteria 38151
181 Ga0207671_10001520 3300025914 Bacteria 26605
182 Ga0207671_10050290 3300025914 Bacteria 3086
183 Ga0207660_10428093 3300025917 Bacteria 1068
184 Ga0207657_10019741 3300025919 Bacteria 6389
185 Ga0207657_10022799 3300025919 Bacteria 5846
186 Ga0207649_10041893 3300025920 Bacteria 2790
187 Ga0207649_10064241 3300025920 Bacteria 2320
188 Ga0207649_10370803 3300025920 Bacteria 1065
189 Ga0207652_10084578 3300025921 Bacteria 2779
190 Ga0207652_10096821 3300025921 Bacteria 2600
191 Ga0207652_10150500 3300025921 Bacteria 2084
192 Ga0207681_10057970 3300025923 Bacteria 2650
193 Ga0207681_10261904 3300025923 Unclassified 1354
194 Ga0207694_10077020 3300025924 Unclassified 2613
195 Ga0207694_10180688 3300025924 Bacteria 1711
196 Ga0207650_10068353 3300025925 Bacteria 2668
197 Ga0207659_10075201 3300025926 Bacteria 2478
198 Ga0207659_10309316 3300025926 Bacteria 1300
199 Ga0207700_10270226 3300025928 Bacteria 1459
200 Ga0207690_10015947 3300025932 Bacteria 4563
201 Ga0207690_10299172 3300025932 Bacteria 1258
202 Ga0207706_10006509 3300025933 Bacteria 10836
203 Ga0207670_10027021 3300025936 Bacteria 3624
204 Ga0207691_10037684 3300025940 Bacteria 4476
205 Ga0207691_10124706 3300025940 Unclassified 2279
206 Ga0207691_10195716 3300025940 Bacteria 1761
207 Ga0207689_10001369 3300025942 Bacteria 23381
208 Ga0207661_10254046 3300025944 Bacteria 1563
209 Ga0207679_10004327 3300025945 Bacteria 8834
210 Ga0207679_10127127 3300025945 Bacteria 2039
211 Ga0207667_10000431 3300025949 Bacteria 56406
212 Ga0207667_10223281 3300025949 Unclassified 1930
213 Ga0207667_10243146 3300025949 Bacteria 1841
214 Ga0207668_10060548 3300025972 Bacteria 2658
215 Ga0207658_10149612 3300025986 Bacteria 1900
216 Ga0207703_10163491 3300026035 Bacteria 1951
217 Ga0207703_10606080 3300026035 Bacteria 1036
218 Ga0207639_10002956 3300026041 Bacteria 11428
219 Ga0207639_10038049 3300026041 Bacteria 3577
220 Ga0207639_10120158 3300026041 Bacteria 2158
221 Ga0207641_10000167 3300026088 Bacteria 92790
222 Ga0207676_10083357 3300026095 Bacteria 2603
223 Ga0207676_10324770 3300026095 Bacteria 1414
224 Ga0207674_10000549 3300026116 Bacteria 49221
225 Ga0207674_10052996 3300026116 Bacteria 4135
226 Ga0207674_10125672 3300026116 Bacteria 2531
227 Ga0207674_10179275 3300026116 Bacteria 2070
228 Ga0207683_10248095 3300026121 Bacteria 1624
229 Ga0207698_10002843 3300026142 Bacteria 10352
230 Ga0207698_10077901 3300026142 Bacteria 2659
231 Ga0207698_10138236 3300026142 Bacteria 2094
232 Ga0207698_10152574 3300026142 Bacteria 2007
233 Ga0207428_10068479 3300027907 Bacteria 2791
234 Ga0268266_10000010 3300028379 Bacteria 1030233
235 Ga0268264_10000252 3300028381 Bacteria 99533
236 Ga0268264_10001260 3300028381 Bacteria 24073
237 Ga0265327_10000296 3300031251 Bacteria 96658
238 Ga0265327_10000395 3300031251 Bacteria 81944
239 Ga0307513_10174504 3300031456 Bacteria 2022
240 Ga0307513_10207993 3300031456 Unclassified 1791
241 Ga0307516_10001231 3300031730 Bacteria 35640
242 Ga0307414_10000001 3300032004 Bacteria 1352954
243 Ga0307414_10176968 3300032004 Bacteria 1712
244 Ga0307414_10186144 3300032004 Bacteria 1675
245 Ga0307414_10294432 3300032004 Bacteria 1370
246 Ga0373937_0073508 3300036401 Bacteria 3154
247 Ga0395899_0066988 3300037312 Bacteria 2635
248 Ga0395899_0211409 3300037312 Bacteria 1348
249 Ga0395900_0032519 3300037418 Bacteria 5364
250 Ga0395898_0127832 3300037466 Bacteria 2434
251 Ga0395901_0041176 3300038443 Bacteria 4786
252 Ga0439466_0025293 3300041411 Bacteria 2073
253 Ga0451845_0794775 3300041501 Bacteria 1759
254 Ga0439449_0008123 3300042007 Bacteria 3989
255 Ga0451577_0022128 3300042876 Bacteria 5807
256 Ga0451577_0023039 3300042876 Bacteria 5684
257 Ga0451577_0056414 3300042876 Bacteria 3504
258 Ga0451577_0110763 3300042876 Bacteria 2456
259 Ga0466972_0000091 3300044658 Bacteria 81829
260 Ga0466972_0000159 3300044658 Bacteria 54274
261 Ga0466972_0012128 3300044658 Bacteria 4330
262 Ga0466964_0041406 3300044706 Bacteria 1863
263 Ga0453684_0053711 3300044712 Bacteria 5256
264 Ga0453684_0103566 3300044712 Bacteria 3477
265 Ga0453684_0527371 3300044712 Bacteria 1304
266 Ga0453684_0816555 3300044712 Bacteria 1004
267 Ga0466968_0089313 3300044735 Bacteria 1363
268 Ga0466970_0000562 3300044765 Bacteria 18148
269 Ga0451576_0002068 3300045051 Bacteria 31466
270 Ga0451576_0006397 3300045051 Bacteria 14458
271 Ga0451576_0011670 3300045051 Bacteria 9954
272 Ga0451576_0062892 3300045051 Bacteria 3869
273 Ga0451576_0185464 3300045051 Bacteria 2173
274 Ga0451576_0297115 3300045051 Bacteria 1689
275 Ga0495638_0142003 3300046460 Bacteria 1400
276 Ga0495662_0036703 3300046476 Bacteria 2365
277 Ga0495585_0000062 3300046492 Bacteria 109539
278 Ga0495606_0028112 3300046507 Bacteria 3972
279 Ga0495630_0268945 3300046517 Unclassified 1302
280 Ga0495648_0001413 3300046524 Bacteria 23465
281 Ga0495665_0049322 3300046531 Bacteria 2233
282 Ga0495634_0106076 3300046642 Bacteria 1811
283 Ga0495611_0085473 3300046648 Bacteria 1455
284 Ga0495635_0049682 3300046663 Bacteria 2891
285 Ga0495661_0000707 3300046665 Bacteria 33018
286 Ga0495658_0017414 3300046683 Unclassified 3711
287 Ga0495600_0307967 3300046809 Unclassified 998
288 Ga0495674_0054543 3300047319 Bacteria 3510
289 Ga0495676_0098244 3300047321 Bacteria 2173
290 Ga0495687_000035 3300047443 Bacteria 255949
291 Ga0495687_016713 3300047443 Bacteria 3682
292 Ga0495686_0091027 3300047472 Bacteria 1852
293 Ga0496125_0000026 3300048928 Bacteria 397380
294 Ga0496126_0026329 3300048929 Bacteria 5579
295 Ga0501033_0092628 3300049570 Bacteria 2210
296 Ga0501034_0003157 3300049571 Bacteria 18950
297 Ga0501034_0025773 3300049571 Bacteria 5988
298 Ga0501039_0052394 3300049575 Unclassified 3158
299 Ga0501043_0256184 3300049579 Bacteria 1347
300 Ga0501198_006232 3300049649 Bacteria 1692
301 Ga0501201_004692 3300049651 Bacteria 1270
302 Ga0501202_000285 3300049652 Bacteria 6899
303 Ga0501217_060641 3300049661 Bacteria 1010
304 Ga0501223_002037 3300049663 Unclassified 4534
305 Ga0501224_004640 3300049664 Bacteria 1954
306 Ga0501235_002156 3300049669 Unclassified 4224
307 Ga0501243_000127 3300049675 Bacteria 8464
308 Ga0501252_001723 3300049682 Bacteria 2078
309 Ga0501253_004305 3300049683 Bacteria 1786
310 Ga0501257_027665 3300049686 Bacteria 1357
311 Ga0501259_000228 3300049688 Bacteria 8706
312 Ga0501261_000833 3300049690 Bacteria 3836
313 Ga0501225_0001191 3300049705 Bacteria 8117
314 Ga0501225_0002117 3300049705 Bacteria 6159
315 Ga0501234_010504 3300049707 Bacteria 1443
316 Ga0501080_0239912 3300049742 Bacteria 1655
317 Ga0501035_0305824 3300049822 Bacteria 1339
318 Ga0501044_0070753 3300049823 Bacteria 3548
319 Ga0501044_0293052 3300049823 Unclassified 1558
320 nmdc:mga0k408_13171_c1 3300050493 Bacteria 4530
321 nmdc:mga0k408_89860_c1 3300050493 Bacteria 1804
322 nmdc:mga08y16_260534_c1 3300050511 Bacteria 1791
323 Ga0500578_0000029 3300053086 Bacteria 140078
324 Ga0500578_0030964 3300053086 Bacteria 3438
325 Ga0500644_0002862 3300053088 Bacteria 4284
326 Ga0500644_0120001 3300053088 Bacteria 1023
327 Ga0500583_0000002 3300053092 Bacteria 232826
328 Ga0500583_0002891 3300053092 Bacteria 5279
329 Ga0500583_0004168 3300053092 Bacteria 4670
330 Ga0500555_046292 3300053103 Bacteria 1200
331 Ga0500608_000986 3300053122 Bacteria 10227
332 Ga0500622_0049142 3300053156 Bacteria 2175

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009545 Ga0105237_10374303 Ga0105237_103743031 253
2 3300010375 Ga0105239_10009584 Ga0105239_100095844 253
3 3300013307 Ga0157372_10868244 Ga0157372_108682441 253
4 3300044712 Ga0453684_0816555 Ga0453684_0816555_41_850 253
5 3300045051 Ga0451576_0297115 Ga0451576_0297115_555_1421 253
6 3300003323 rootH1_10310914 rootH1_103109141 254
7 3300005366 Ga0070659_100025524 Ga0070659_1000255244 254
8 3300005530 Ga0070679_100307000 Ga0070679_1003070002 254
9 3300005563 Ga0068855_100018704 Ga0068855_1000187043 254
10 3300013102 Ga0157371_10001959 Ga0157371_100019596 254
11 3300013104 Ga0157370_10004268 Ga0157370_100042686 254
12 3300013307 Ga0157372_10047554 Ga0157372_100475545 254
13 3300025921 Ga0207652_10096821 Ga0207652_100968212 254
14 3300025932 Ga0207690_10015947 Ga0207690_100159474 254
15 3300025949 Ga0207667_10223281 Ga0207667_102232812 254
16 3300037312 Ga0395899_0066988 Ga0395899_0066988_1416_2261 254
17 3300037418 Ga0395900_0032519 Ga0395900_0032519_133_978 254
18 3300037466 Ga0395898_0127832 Ga0395898_0127832_1288_2133 254
19 3300038443 Ga0395901_0041176 Ga0395901_0041176_282_1127 254
20 3300041411 Ga0439466_0025293 Ga0439466_0025293_794_1651 254
21 3300009553 Ga0105249_10176513 Ga0105249_101765132 255
22 3300013296 Ga0157374_10001536 Ga0157374_1000153612 256
23 3300013306 Ga0163162_10155596 Ga0163162_101555963 256
24 3300014325 Ga0163163_10000218 Ga0163163_1000021838 256
25 3300044712 Ga0453684_0053711 Ga0453684_0053711_4091_4924 256
26 3300013104 Ga0157370_10012290 Ga0157370_100122904 257
27 3300005364 Ga0070673_100128559 Ga0070673_1001285593 258
28 3300046507 Ga0495606_0028112 Ga0495606_0028112_2412_3215 258
29 3300003781 Ga0055536_1000001 Ga0055536_1000001369 259
30 3300003791 Ga0055530_10002341 Ga0055530_1000234112 259
31 3300025292 Ga0209676_1000008 Ga0209676_1000008494 259
32 3300025298 Ga0209050_1000045 Ga0209050_1000045291 259
33 3300005614 Ga0068856_100253941 Ga0068856_1002539412 260
34 3300005616 Ga0068852_100557058 Ga0068852_1005570581 260
35 3300006237 Ga0097621_100025600 Ga0097621_1000256001 260
36 3300006358 Ga0068871_100067855 Ga0068871_1000678553 260
37 3300014969 Ga0157376_10029728 Ga0157376_100297284 260
38 3300044712 Ga0453684_0527371 Ga0453684_0527371_162_1022 260
39 3300045051 Ga0451576_0185464 Ga0451576_0185464_11_811 260
40 3300005355 Ga0070671_100055508 Ga0070671_1000555081 261
41 3300005367 Ga0070667_100010467 Ga0070667_1000104676 261
42 3300005616 Ga0068852_100165116 Ga0068852_1001651162 261
43 3300005617 Ga0068859_100000018 Ga0068859_100000018194 261
44 3300005841 Ga0068863_100006638 Ga0068863_1000066383 261
45 3300005842 Ga0068858_100061442 Ga0068858_1000614422 261
46 3300005843 Ga0068860_100016612 Ga0068860_1000166122 261
47 3300006931 Ga0097620_100000018 Ga0097620_100000018194 261
48 3300009094 Ga0111539_10263689 Ga0111539_102636892 261
49 3300009101 Ga0105247_10096393 Ga0105247_100963933 261
50 3300009148 Ga0105243_10165331 Ga0105243_101653312 261
51 3300009174 Ga0105241_10001853 Ga0105241_1000185313 261
52 3300009545 Ga0105237_10007949 Ga0105237_100079499 261
53 3300009553 Ga0105249_10120313 Ga0105249_101203131 261
54 3300013297 Ga0157378_10455050 Ga0157378_104550501 261
55 3300025900 Ga0207710_10067288 Ga0207710_100672881 261
56 3300025911 Ga0207654_10002223 Ga0207654_1000222313 261
57 3300025914 Ga0207671_10001520 Ga0207671_1000152018 261
58 3300025923 Ga0207681_10261904 Ga0207681_102619042 261
59 3300025972 Ga0207668_10060548 Ga0207668_100605483 261
60 3300025986 Ga0207658_10149612 Ga0207658_101496121 261
61 3300026035 Ga0207703_10163491 Ga0207703_101634912 261
62 3300026088 Ga0207641_10000167 Ga0207641_1000016769 261
63 3300026095 Ga0207676_10083357 Ga0207676_100833573 261
64 3300026142 Ga0207698_10138236 Ga0207698_101382362 261
65 3300028381 Ga0268264_10001260 Ga0268264_1000126016 261
66 3300050511 nmdc:mga08y16_260534_c1 nmdc:mga08y16_260534_c1_156_941 261
67 iso_pu_bacteria 2896109856 2896109889 261
68 3300003320 rootH2_10001122 rootH2_1000112223 263
69 3300005548 Ga0070665_100000066 Ga0070665_10000006691 263
70 3300005843 Ga0068860_100000041 Ga0068860_10000004151 263
71 3300013306 Ga0163162_10000686 Ga0163162_1000068616 263
72 3300028379 Ga0268266_10000010 Ga0268266_1000001013 263
73 3300028381 Ga0268264_10000252 Ga0268264_1000025229 263
74 3300046460 Ga0495638_0142003 Ga0495638_0142003_525_1340 263
75 3300046524 Ga0495648_0001413 Ga0495648_0001413_5206_6021 263
76 3300046648 Ga0495611_0085473 Ga0495611_0085473_561_1376 263
77 3300047443 Ga0495687_000035 Ga0495687_000035_25695_26510 263
78 3300053088 Ga0500644_0120001 Ga0500644_0120001_152_967 263
79 3300053092 Ga0500583_0004168 Ga0500583_0004168_43_858 263
80 3300003323 rootH1_10166439 rootH1_101664391 264
81 3300005577 Ga0068857_100110181 Ga0068857_1001101812 264
82 3300045051 Ga0451576_0006397 Ga0451576_0006397_11452_12306 264
83 3300046492 Ga0495585_0000062 Ga0495585_0000062_82050_82898 264
84 3300046665 Ga0495661_0000707 Ga0495661_0000707_25702_26532 264
85 3300053088 Ga0500644_0002862 Ga0500644_0002862_694_1527 264
86 iso_pu_bacteria 2945977869 2945982310 264
87 iso_pu_bacteria 2946013367 2946018303 264
88 3300003323 rootH1_10027584 rootH1_100275847 265
89 3300003794 Ga0055531_10000118 Ga0055531_1000011815 265
90 3300009174 Ga0105241_10438030 Ga0105241_104380301 265
91 3300009545 Ga0105237_10007487 Ga0105237_1000748710 265
92 3300013307 Ga0157372_10003776 Ga0157372_100037763 265
93 3300025304 Ga0209257_1000007 Ga0209257_1000007176 265
94 3300025904 Ga0207647_10029836 Ga0207647_100298362 265
95 3300025914 Ga0207671_10050290 Ga0207671_100502902 265
96 3300025924 Ga0207694_10180688 Ga0207694_101806881 265
97 3300003794 Ga0055531_10000102 Ga0055531_1000010219 266
98 3300005289 Ga0065704_10085633 Ga0065704_100856333 266
99 3300025304 Ga0209257_1000004 Ga0209257_10000041330 266
100 3300037312 Ga0395899_0211409 Ga0395899_0211409_302_1126 266
101 3300048929 Ga0496126_0026329 Ga0496126_0026329_3210_4031 266
102 3300050493 nmdc:mga0k408_89860_c1 nmdc:mga0k408_89860_c1_894_1712 266
103 3300003323 rootH1_10042710 rootH1_100427104 267
104 3300013104 Ga0157370_10010860 Ga0157370_100108605 267
105 3300042876 Ga0451577_0056414 Ga0451577_0056414_129_1115 267
106 3300042876 Ga0451577_0110763 Ga0451577_0110763_420_1244 267
107 3300044706 Ga0466964_0041406 Ga0466964_0041406_777_1625 267
108 3300044735 Ga0466968_0089313 Ga0466968_0089313_441_1289 267
109 3300045051 Ga0451576_0011670 Ga0451576_0011670_6416_7240 267
110 3300049570 Ga0501033_0092628 Ga0501033_0092628_166_981 267
111 3300049571 Ga0501034_0003157 Ga0501034_0003157_16358_17173 267
112 3300049571 Ga0501034_0025773 Ga0501034_0025773_1151_1966 267
113 3300049742 Ga0501080_0239912 Ga0501080_0239912_394_1209 267
114 3300049823 Ga0501044_0070753 Ga0501044_0070753_2498_3313 267
115 3300049823 Ga0501044_0293052 Ga0501044_0293052_720_1535 267
116 3300003320 rootH2_10005823 rootH2_100058236 268
117 3300005339 Ga0070660_100451582 Ga0070660_1004515821 268
118 3300005539 Ga0068853_100069166 Ga0068853_1000691663 268
119 3300005563 Ga0068855_100099807 Ga0068855_1000998072 268
120 3300005577 Ga0068857_100002107 Ga0068857_1000021079 268
121 3300005614 Ga0068856_100048598 Ga0068856_1000485982 268
122 3300005614 Ga0068856_100071449 Ga0068856_1000714495 268
123 3300005616 Ga0068852_100004016 Ga0068852_10000401610 268
124 3300009093 Ga0105240_10033858 Ga0105240_100338587 268
125 3300009174 Ga0105241_10083025 Ga0105241_100830252 268
126 3300013105 Ga0157369_10108622 Ga0157369_101086222 268
127 3300025904 Ga0207647_10079350 Ga0207647_100793501 268
128 3300025911 Ga0207654_10056869 Ga0207654_100568693 268
129 3300025924 Ga0207694_10077020 Ga0207694_100770202 268
130 3300025949 Ga0207667_10000431 Ga0207667_100004312 268
131 3300026041 Ga0207639_10002956 Ga0207639_100029562 268
132 3300026041 Ga0207639_10038049 Ga0207639_100380492 268
133 3300026116 Ga0207674_10000549 Ga0207674_1000054926 268
134 3300026116 Ga0207674_10052996 Ga0207674_100529966 268
135 3300026142 Ga0207698_10002843 Ga0207698_100028436 268
136 3300032004 Ga0307414_10176968 Ga0307414_101769682 268
137 3300041501 Ga0451845_0794775 Ga0451845_0794775_626_1459 268
138 iso_pu_bacteria 2954016120 2954018927 268
139 3300005329 Ga0070683_100079345 Ga0070683_1000793454 269
140 3300005331 Ga0070670_100090117 Ga0070670_1000901174 269
141 3300005340 Ga0070689_100014598 Ga0070689_1000145986 269
142 3300005344 Ga0070661_100016911 Ga0070661_1000169112 269
143 3300005354 Ga0070675_100047950 Ga0070675_1000479502 269
144 3300005365 Ga0070688_100035206 Ga0070688_1000352062 269
145 3300005535 Ga0070684_100132442 Ga0070684_1001324423 269
146 3300005535 Ga0070684_100431256 Ga0070684_1004312562 269
147 3300005539 Ga0068853_100089456 Ga0068853_1000894562 269
148 3300005617 Ga0068859_100338234 Ga0068859_1003382341 269
149 3300005618 Ga0068864_100037518 Ga0068864_1000375183 269
150 3300006931 Ga0097620_100338219 Ga0097620_1003382192 269
151 3300010375 Ga0105239_10042029 Ga0105239_100420292 269
152 3300017792 Ga0163161_10043708 Ga0163161_100437084 269
153 3300025904 Ga0207647_10015976 Ga0207647_100159764 269
154 3300025920 Ga0207649_10064241 Ga0207649_100642412 269
155 3300025923 Ga0207681_10057970 Ga0207681_100579702 269
156 3300025925 Ga0207650_10068353 Ga0207650_100683532 269
157 3300025932 Ga0207690_10299172 Ga0207690_102991722 269
158 3300025936 Ga0207670_10027021 Ga0207670_100270215 269
159 3300025940 Ga0207691_10037684 Ga0207691_100376845 269
160 3300025942 Ga0207689_10001369 Ga0207689_100013697 269
161 3300025944 Ga0207661_10254046 Ga0207661_102540462 269
162 3300025945 Ga0207679_10004327 Ga0207679_100043277 269
163 3300026116 Ga0207674_10125672 Ga0207674_101256721 269
164 3300026142 Ga0207698_10152574 Ga0207698_101525742 269
165 iso_pu_bacteria 2945997725 2946002033 269
166 3300005339 Ga0070660_100011259 Ga0070660_1000112594 270
167 3300005364 Ga0070673_100127974 Ga0070673_1001279742 270
168 3300005456 Ga0070678_100306228 Ga0070678_1003062282 270
169 3300005564 Ga0070664_100118103 Ga0070664_1001181032 270
170 3300005615 Ga0070702_100212694 Ga0070702_1002126941 270
171 3300013102 Ga0157371_10002354 Ga0157371_100023544 270
172 3300013297 Ga0157378_10096829 Ga0157378_100968291 270
173 3300013306 Ga0163162_10405789 Ga0163162_104057891 270
174 3300025913 Ga0207695_10058011 Ga0207695_100580113 270
175 3300025919 Ga0207657_10019741 Ga0207657_100197412 270
176 3300025920 Ga0207649_10370803 Ga0207649_103708031 270
177 3300025926 Ga0207659_10075201 Ga0207659_100752013 270
178 3300025940 Ga0207691_10124706 Ga0207691_101247063 270
179 3300025945 Ga0207679_10127127 Ga0207679_101271271 270
180 3300026035 Ga0207703_10606080 Ga0207703_106060801 270
181 3300026041 Ga0207639_10120158 Ga0207639_101201582 270
182 3300026121 Ga0207683_10248095 Ga0207683_102480951 270
183 3300049661 Ga0501217_060641 Ga0501217_060641_79_918 270
184 iso_pu_bacteria 2738541278 2738728345 270
185 iso_pu_bacteria 2852623160 2852624975 270
186 iso_pu_bacteria 2884933994 2884935999 270
187 3300005564 Ga0070664_100017050 Ga0070664_1000170501 271
188 3300009093 Ga0105240_10004288 Ga0105240_100042889 271
189 3300009174 Ga0105241_10000245 Ga0105241_100002459 271
190 3300049575 Ga0501039_0052394 Ga0501039_0052394_1942_2760 271
191 3300049649 Ga0501198_006232 Ga0501198_006232_355_1212 271
192 3300049651 Ga0501201_004692 Ga0501201_004692_344_1201 271
193 3300049652 Ga0501202_000285 Ga0501202_000285_2357_3214 271
194 3300049663 Ga0501223_002037 Ga0501223_002037_2821_3678 271
195 3300049664 Ga0501224_004640 Ga0501224_004640_224_1081 271
196 3300049669 Ga0501235_002156 Ga0501235_002156_2598_3455 271
197 3300049675 Ga0501243_000127 Ga0501243_000127_5320_6177 271
198 3300049682 Ga0501252_001723 Ga0501252_001723_403_1260 271
199 3300049683 Ga0501253_004305 Ga0501253_004305_471_1328 271
200 3300049688 Ga0501259_000228 Ga0501259_000228_7177_8034 271
201 3300049690 Ga0501261_000833 Ga0501261_000833_856_1713 271
202 3300049705 Ga0501225_0001191 Ga0501225_0001191_463_1320 271
203 3300049707 Ga0501234_010504 Ga0501234_010504_498_1355 271
204 3300003781 Ga0055536_1011371 Ga0055536_10113712 272
205 3300005262 Ga0065165_1000169 Ga0065165_100016914 272
206 3300005262 Ga0065165_1003050 Ga0065165_10030506 272
207 3300005288 Ga0065714_10123915 Ga0065714_101239151 272
208 3300005289 Ga0065704_10165771 Ga0065704_101657712 272
209 3300025284 Ga0209130_1002251 Ga0209130_10022516 272
210 3300025292 Ga0209676_1000329 Ga0209676_100032927 272
211 3300025302 Ga0207426_1000234 Ga0207426_100023495 272
212 3300032004 Ga0307414_10186144 Ga0307414_101861442 272
213 3300042876 Ga0451577_0022128 Ga0451577_0022128_725_1561 272
214 3300042876 Ga0451577_0023039 Ga0451577_0023039_3373_4221 272
215 3300044712 Ga0453684_0103566 Ga0453684_0103566_2377_3213 272
216 3300045051 Ga0451576_0002068 Ga0451576_0002068_10115_10939 272
217 3300003322 rootL2_10005207 rootL2_100052071 273
218 3300005327 Ga0070658_10059735 Ga0070658_100597352 273
219 3300005329 Ga0070683_100050106 Ga0070683_1000501063 273
220 3300005329 Ga0070683_100136298 Ga0070683_1001362982 273
221 3300005335 Ga0070666_10041958 Ga0070666_100419583 273
222 3300005336 Ga0070680_100046872 Ga0070680_1000468721 273
223 3300005337 Ga0070682_100016629 Ga0070682_1000166297 273
224 3300005337 Ga0070682_100025413 Ga0070682_1000254132 273
225 3300005339 Ga0070660_100039288 Ga0070660_1000392883 273
226 3300005344 Ga0070661_100074504 Ga0070661_1000745043 273
227 3300005354 Ga0070675_100023600 Ga0070675_1000236001 273
228 3300005354 Ga0070675_100037707 Ga0070675_1000377074 273
229 3300005366 Ga0070659_100018470 Ga0070659_1000184703 273
230 3300005457 Ga0070662_100026289 Ga0070662_1000262894 273
231 3300005466 Ga0070685_10191362 Ga0070685_101913622 273
232 3300005530 Ga0070679_100007276 Ga0070679_1000072765 273
233 3300005530 Ga0070679_100074055 Ga0070679_1000740552 273
234 3300005535 Ga0070684_100016960 Ga0070684_1000169603 273
235 3300005539 Ga0068853_100042556 Ga0068853_1000425564 273
236 3300005547 Ga0070693_100072165 Ga0070693_1000721653 273
237 3300005563 Ga0068855_100091790 Ga0068855_1000917902 273
238 3300005563 Ga0068855_100133306 Ga0068855_1001333063 273
239 3300005577 Ga0068857_100042669 Ga0068857_1000426693 273
240 3300005578 Ga0068854_100172444 Ga0068854_1001724442 273
241 3300005614 Ga0068856_100044707 Ga0068856_1000447073 273
242 3300005616 Ga0068852_100131110 Ga0068852_1001311103 273
243 3300005844 Ga0068862_100165556 Ga0068862_1001655562 273
244 3300006237 Ga0097621_100053801 Ga0097621_1000538012 273
245 3300006358 Ga0068871_100014736 Ga0068871_1000147364 273
246 3300013100 Ga0157373_10004162 Ga0157373_100041629 273
247 3300013102 Ga0157371_10032874 Ga0157371_100328743 273
248 3300013104 Ga0157370_10039140 Ga0157370_100391405 273
249 3300013105 Ga0157369_10077375 Ga0157369_100773752 273
250 3300013296 Ga0157374_10052434 Ga0157374_100524343 273
251 3300013297 Ga0157378_10057309 Ga0157378_100573092 273
252 3300013308 Ga0157375_11134802 Ga0157375_111348021 273
253 3300014745 Ga0157377_10006866 Ga0157377_100068663 273
254 3300014969 Ga0157376_10230631 Ga0157376_102306312 273
255 3300015261 Ga0182006_1000301 Ga0182006_10003017 273
256 3300025909 Ga0207705_10289205 Ga0207705_102892051 273
257 3300025912 Ga0207707_10007628 Ga0207707_100076285 273
258 3300025917 Ga0207660_10428093 Ga0207660_104280931 273
259 3300025919 Ga0207657_10022799 Ga0207657_100227993 273
260 3300025920 Ga0207649_10041893 Ga0207649_100418934 273
261 3300025921 Ga0207652_10084578 Ga0207652_100845783 273
262 3300025921 Ga0207652_10150500 Ga0207652_101505003 273
263 3300025926 Ga0207659_10309316 Ga0207659_103093162 273
264 3300025933 Ga0207706_10006509 Ga0207706_100065095 273
265 3300025949 Ga0207667_10243146 Ga0207667_102431461 273
266 3300026116 Ga0207674_10179275 Ga0207674_101792752 273
267 3300026142 Ga0207698_10077901 Ga0207698_100779012 273
268 3300027907 Ga0207428_10068479 Ga0207428_100684793 273
269 3300031456 Ga0307513_10174504 Ga0307513_101745042 273
270 3300031456 Ga0307513_10207993 Ga0307513_102079932 273
271 3300032004 Ga0307414_10000001 Ga0307414_10000001580 273
272 3300032004 Ga0307414_10294432 Ga0307414_102944322 273
273 3300044658 Ga0466972_0000159 Ga0466972_0000159_43646_44521 273
274 3300044765 Ga0466970_0000562 Ga0466970_0000562_4855_5730 273
275 3300045051 Ga0451576_0062892 Ga0451576_0062892_292_1134 273
276 3300049705 Ga0501225_0002117 Ga0501225_0002117_2174_3148 273
277 3300053092 Ga0500583_0002891 Ga0500583_0002891_2014_2835 273
278 3300053156 Ga0500622_0049142 Ga0500622_0049142_514_1335 273
279 3300003323 rootH1_10006403 rootH1_100064039 274
280 3300013105 Ga0157369_10263468 Ga0157369_102634682 274
281 3300025911 Ga0207654_10000877 Ga0207654_100008773 274
282 3300031251 Ga0265327_10000395 Ga0265327_1000039521 274
283 3300042007 Ga0439449_0008123 Ga0439449_0008123_270_1100 274
284 3300047443 Ga0495687_016713 Ga0495687_016713_2006_2836 274
285 3300053103 Ga0500555_046292 Ga0500555_046292_114_983 274
286 3300053122 Ga0500608_000986 Ga0500608_000986_3401_4249 274
287 3300005327 Ga0070658_10258774 Ga0070658_102587742 275
288 3300006195 Ga0075366_10009752 Ga0075366_100097522 275
289 3300009545 Ga0105237_10000326 Ga0105237_1000032637 275
290 3300009551 Ga0105238_10028024 Ga0105238_100280246 275
291 3300010375 Ga0105239_10002198 Ga0105239_1000219810 275
292 3300013104 Ga0157370_10030786 Ga0157370_100307862 275
293 3300025909 Ga0207705_10072137 Ga0207705_100721373 275
294 3300025911 Ga0207654_10017977 Ga0207654_100179774 275
295 3300025913 Ga0207695_10000013 Ga0207695_10000013701 275
296 3300025914 Ga0207671_10000875 Ga0207671_1000087519 275
297 3300031251 Ga0265327_10000296 Ga0265327_1000029613 275
298 3300036401 Ga0373937_0073508 Ga0373937_0073508_2241_3080 275
299 3300046476 Ga0495662_0036703 Ga0495662_0036703_859_1698 275
300 3300046517 Ga0495630_0268945 Ga0495630_0268945_265_1104 275
301 3300046531 Ga0495665_0049322 Ga0495665_0049322_990_1829 275
302 3300046642 Ga0495634_0106076 Ga0495634_0106076_171_1010 275
303 3300046663 Ga0495635_0049682 Ga0495635_0049682_818_1657 275
304 3300046683 Ga0495658_0017414 Ga0495658_0017414_476_1315 275
305 3300046809 Ga0495600_0307967 Ga0495600_0307967_27_866 275
306 3300047319 Ga0495674_0054543 Ga0495674_0054543_513_1352 275
307 3300047321 Ga0495676_0098244 Ga0495676_0098244_635_1474 275
308 3300047472 Ga0495686_0091027 Ga0495686_0091027_793_1635 275
309 3300050493 nmdc:mga0k408_13171_c1 nmdc:mga0k408_13171_c1_2030_2875 275
310 iso_pu_bacteria 2919437846 2919442575 275
311 3300025302 Ga0207426_1000009 Ga0207426_1000009380 276
312 3300003323 rootH1_10076533 rootH1_100765333 277
313 3300013104 Ga0157370_10013222 Ga0157370_100132224 277
314 3300031730 Ga0307516_10001231 Ga0307516_1000123121 277
315 3300048928 Ga0496125_0000026 Ga0496125_0000026_230104_230961 277
316 3300049686 Ga0501257_027665 Ga0501257_027665_427_1341 277
317 3300003316 rootH1_10137592 rootH1_101375922 278
318 3300005354 Ga0070675_100391419 Ga0070675_1003914191 278
319 3300005844 Ga0068862_100034398 Ga0068862_1000343985 278
320 3300009553 Ga0105249_10829753 Ga0105249_108297531 278
321 3300010375 Ga0105239_10009914 Ga0105239_100099149 278
322 3300013306 Ga0163162_10089120 Ga0163162_100891203 278
323 3300025913 Ga0207695_10038211 Ga0207695_100382112 278
324 3300025940 Ga0207691_10195716 Ga0207691_101957162 278
325 3300026095 Ga0207676_10324770 Ga0207676_103247702 278
326 3300049579 Ga0501043_0256184 Ga0501043_0256184_111_959 279
327 3300049822 Ga0501035_0305824 Ga0501035_0305824_323_1171 279
328 3300013102 Ga0157371_10016277 Ga0157371_100162774 280
329 3300013104 Ga0157370_10045811 Ga0157370_100458112 280
330 3300013105 Ga0157369_10115319 Ga0157369_101153192 280
331 3300014969 Ga0157376_10123868 Ga0157376_101238682 280
332 3300014969 Ga0157376_10317137 Ga0157376_103171372 281
333 3300053092 Ga0500583_0000002 Ga0500583_0000002_200342_201199 282
334 3300025928 Ga0207700_10270226 Ga0207700_102702261 287
335 3300044658 Ga0466972_0000091 Ga0466972_0000091_25738_26607 289
336 3300013296 Ga0157374_10199821 Ga0157374_101998211 290
337 3300044658 Ga0466972_0012128 Ga0466972_0012128_896_1768 290
338 3300053086 Ga0500578_0000029 Ga0500578_0000029_60340_61212 290
339 3300053086 Ga0500578_0030964 Ga0500578_0030964_1108_1980 290
340 3300002738 JGI25154J39366_1007454 JGI25154J39366_10074542 300
341 3300025246 Ga0209646_1001524 Ga0209646_10015242 300

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

78

301

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.9465 29 278
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.8868 29 278
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.7016 35 279
2d7j-assembly1.cif.gz_A crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 0.6952 35 279
2b4y-assembly4.cif.gz_D crystal structure of human sirtuin homolog 5 0.6909 81 118
ID Description Score Start End Superfamily
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9452 29 278 3.40.50.880
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.8846 29 278 3.40.50.880
3cs3A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.733 34 118 3.40.50.2300
af_Q20481_13_287_3.40.50.1220 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain 0.7248 80 118 3.40.50.1220
1t0bA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6962 31 287 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A4R8DGN2-F1-model_v4 Trehalose utilization protein 0.9882 30 280
AF-A0A4Q3SNT1-F1-model_v4 ThuA domain-containing protein 0.9877 30 279
AF-A0A4Q3PAI9-F1-model_v4 deleted 0.9848 74 276
AF-A0A5B0FSI8-F1-model_v4 ThuA domain-containing protein 0.9791 21 279
AF-A0A7Y0FLB7-F1-model_v4 ThuA domain-containing protein 0.9777 21 279

Feature Viewer

pLDDT pTM Quality
87.78 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map