F414927
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 341 | 193 | 332 | 277 |
Family's Representative Sequence
| Representative Sequence | 3300049705|Ga0501225_0002117|Ga0501225_0002117_2174_3148 |
| Length | 324 |
| Sequence | MVQQASLTNRDCILYFTFSVFHHYKTTSWYVQDPRCMVFLLPSAAQLNCMPFTRYLLIVLILTVVYITATSQQKAKLNVLAFYTAKHDQAHISFVHEANRWFAQQAAQYHFQYDSTNDWSLLNTSNLSKYQVIVFLDTRPDDEAQRTAFETYMRNGGAWIGFHFAAFALTPSTYPQNWDWYHNQLLGSGQYVGNTWRPTAAVLRVEHKKHPATRHLPVTFRSAPNEWYKWEKDLRQNPDIEILLAIDSTSFPLGTGPKQHEIWHSGYYPVVWTNKKYKMLYLNMGHNDIDYEHKTSKELSFTFDNKEQGKLIIDGLFWLTGASH |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
| 2 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 3 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 4 | 2896109856 | Chitinophaga sp. SYP-B3965 | Isolate | Rhizosphere |
| 5 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 6 | 2945977869 | Chitinophaga sp. W2I13 | Isolate | Rhizosphere |
| 7 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 8 | 2946013367 | Chitinophaga sp. W3I9 | Isolate | Rhizosphere |
| 9 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 10 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 11 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 12 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 13 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 14 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 15 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 16 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 19 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 58 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 83 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 85 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 127 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 128 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 135 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 136 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 137 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 138 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 139 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 140 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 141 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 142 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 143 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 144 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 145 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 163 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 164 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 165 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 166 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 167 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 169 | 3300049651 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought | Metagenome | Rhizosphere |
| 170 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 171 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 172 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 173 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 174 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 175 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 176 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 177 | 3300049683 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control | Metagenome | Rhizosphere |
| 178 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 179 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 180 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 181 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 182 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 183 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 189 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 191 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 192 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 193 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.36 |
| Metatranscriptomes | 0 |
| Isolates | 2.64 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.21 |
| Nodule | 0 |
| Rhizoplane | 0 |
| Rhizosphere | 86.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1007454 | 3300002738 | Bacteria | 1497 |
| 2 | rootH1_10137592 | 3300003316 | Bacteria | 1947 |
| 3 | rootH2_10001122 | 3300003320 | Bacteria | 34823 |
| 4 | rootH2_10005823 | 3300003320 | Bacteria | 10887 |
| 5 | rootL2_10005207 | 3300003322 | Bacteria | 1303 |
| 6 | rootH1_10006403 | 3300003323 | Bacteria | 91171 |
| 7 | rootH1_10027584 | 3300003323 | Bacteria | 7602 |
| 8 | rootH1_10042710 | 3300003323 | Bacteria | 5286 |
| 9 | rootH1_10076533 | 3300003323 | Bacteria | 6367 |
| 10 | rootH1_10166439 | 3300003323 | Bacteria | 3170 |
| 11 | rootH1_10310914 | 3300003323 | Bacteria | 1091 |
| 12 | Ga0055536_1000001 | 3300003781 | Bacteria | 630663 |
| 13 | Ga0055536_1011371 | 3300003781 | Bacteria | 3420 |
| 14 | Ga0055530_10002341 | 3300003791 | Bacteria | 12353 |
| 15 | Ga0055531_10000102 | 3300003794 | Bacteria | 92703 |
| 16 | Ga0055531_10000118 | 3300003794 | Bacteria | 88104 |
| 17 | Ga0065165_1000169 | 3300005262 | Bacteria | 115398 |
| 18 | Ga0065165_1003050 | 3300005262 | Bacteria | 12558 |
| 19 | Ga0065714_10123915 | 3300005288 | Bacteria | 1317 |
| 20 | Ga0065704_10085633 | 3300005289 | Unclassified | 3201 |
| 21 | Ga0065704_10165771 | 3300005289 | Bacteria | 1323 |
| 22 | Ga0070658_10059735 | 3300005327 | Bacteria | 3105 |
| 23 | Ga0070658_10258774 | 3300005327 | Bacteria | 1478 |
| 24 | Ga0070683_100050106 | 3300005329 | Bacteria | 3864 |
| 25 | Ga0070683_100079345 | 3300005329 | Bacteria | 3072 |
| 26 | Ga0070683_100136298 | 3300005329 | Bacteria | 2325 |
| 27 | Ga0070670_100090117 | 3300005331 | Bacteria | 2636 |
| 28 | Ga0070666_10041958 | 3300005335 | Bacteria | 3059 |
| 29 | Ga0070680_100046872 | 3300005336 | Bacteria | 3517 |
| 30 | Ga0070682_100016629 | 3300005337 | Bacteria | 4280 |
| 31 | Ga0070682_100025413 | 3300005337 | Bacteria | 3534 |
| 32 | Ga0070660_100011259 | 3300005339 | Bacteria | 6349 |
| 33 | Ga0070660_100039288 | 3300005339 | Bacteria | 3596 |
| 34 | Ga0070660_100451582 | 3300005339 | Bacteria | 1066 |
| 35 | Ga0070689_100014598 | 3300005340 | Bacteria | 5710 |
| 36 | Ga0070661_100016911 | 3300005344 | Bacteria | 5164 |
| 37 | Ga0070661_100074504 | 3300005344 | Bacteria | 2500 |
| 38 | Ga0070675_100023600 | 3300005354 | Bacteria | 4920 |
| 39 | Ga0070675_100037707 | 3300005354 | Bacteria | 3939 |
| 40 | Ga0070675_100047950 | 3300005354 | Bacteria | 3502 |
| 41 | Ga0070675_100391419 | 3300005354 | Bacteria | 1238 |
| 42 | Ga0070671_100055508 | 3300005355 | Bacteria | 3295 |
| 43 | Ga0070673_100127974 | 3300005364 | Bacteria | 2127 |
| 44 | Ga0070673_100128559 | 3300005364 | Bacteria | 2122 |
| 45 | Ga0070688_100035206 | 3300005365 | Bacteria | 3040 |
| 46 | Ga0070659_100018470 | 3300005366 | Bacteria | 5262 |
| 47 | Ga0070659_100025524 | 3300005366 | Bacteria | 4540 |
| 48 | Ga0070667_100010467 | 3300005367 | Bacteria | 7659 |
| 49 | Ga0070678_100306228 | 3300005456 | Bacteria | 1352 |
| 50 | Ga0070662_100026289 | 3300005457 | Bacteria | 4029 |
| 51 | Ga0070685_10191362 | 3300005466 | Bacteria | 1324 |
| 52 | Ga0070679_100007276 | 3300005530 | Bacteria | 10334 |
| 53 | Ga0070679_100074055 | 3300005530 | Bacteria | 3396 |
| 54 | Ga0070679_100307000 | 3300005530 | Bacteria | 1537 |
| 55 | Ga0070684_100016960 | 3300005535 | Bacteria | 5968 |
| 56 | Ga0070684_100132442 | 3300005535 | Bacteria | 2249 |
| 57 | Ga0070684_100431256 | 3300005535 | Bacteria | 1217 |
| 58 | Ga0068853_100042556 | 3300005539 | Bacteria | 3884 |
| 59 | Ga0068853_100069166 | 3300005539 | Bacteria | 3071 |
| 60 | Ga0068853_100089456 | 3300005539 | Bacteria | 2704 |
| 61 | Ga0070693_100072165 | 3300005547 | Bacteria | 2036 |
| 62 | Ga0070665_100000066 | 3300005548 | Bacteria | 212791 |
| 63 | Ga0068855_100018704 | 3300005563 | Bacteria | 8330 |
| 64 | Ga0068855_100091790 | 3300005563 | Bacteria | 3503 |
| 65 | Ga0068855_100099807 | 3300005563 | Bacteria | 3343 |
| 66 | Ga0068855_100133306 | 3300005563 | Bacteria | 2835 |
| 67 | Ga0070664_100017050 | 3300005564 | Bacteria | 5963 |
| 68 | Ga0070664_100118103 | 3300005564 | Bacteria | 2320 |
| 69 | Ga0068857_100002107 | 3300005577 | Bacteria | 16167 |
| 70 | Ga0068857_100042669 | 3300005577 | Bacteria | 4024 |
| 71 | Ga0068857_100110181 | 3300005577 | Unclassified | 2474 |
| 72 | Ga0068854_100172444 | 3300005578 | Unclassified | 1684 |
| 73 | Ga0068856_100044707 | 3300005614 | Bacteria | 4359 |
| 74 | Ga0068856_100048598 | 3300005614 | Bacteria | 4182 |
| 75 | Ga0068856_100071449 | 3300005614 | Bacteria | 3436 |
| 76 | Ga0068856_100253941 | 3300005614 | Bacteria | 1773 |
| 77 | Ga0070702_100212694 | 3300005615 | Bacteria | 1288 |
| 78 | Ga0068852_100004016 | 3300005616 | Bacteria | 10346 |
| 79 | Ga0068852_100131110 | 3300005616 | Bacteria | 2308 |
| 80 | Ga0068852_100165116 | 3300005616 | Bacteria | 2071 |
| 81 | Ga0068852_100557058 | 3300005616 | Bacteria | 1147 |
| 82 | Ga0068859_100000018 | 3300005617 | Bacteria | 248813 |
| 83 | Ga0068859_100338234 | 3300005617 | Unclassified | 1599 |
| 84 | Ga0068864_100037518 | 3300005618 | Bacteria | 4135 |
| 85 | Ga0068863_100006638 | 3300005841 | Bacteria | 11355 |
| 86 | Ga0068858_100061442 | 3300005842 | Bacteria | 3473 |
| 87 | Ga0068860_100000041 | 3300005843 | Bacteria | 227790 |
| 88 | Ga0068860_100016612 | 3300005843 | Bacteria | 7178 |
| 89 | Ga0068862_100034398 | 3300005844 | Bacteria | 4287 |
| 90 | Ga0068862_100165556 | 3300005844 | Unclassified | 1976 |
| 91 | Ga0075366_10009752 | 3300006195 | Bacteria | 5369 |
| 92 | Ga0097621_100025600 | 3300006237 | Bacteria | 4618 |
| 93 | Ga0097621_100053801 | 3300006237 | Bacteria | 3281 |
| 94 | Ga0068871_100014736 | 3300006358 | Bacteria | 5835 |
| 95 | Ga0068871_100067855 | 3300006358 | Bacteria | 2927 |
| 96 | Ga0097620_100000018 | 3300006931 | Bacteria | 248813 |
| 97 | Ga0097620_100338219 | 3300006931 | Unclassified | 1599 |
| 98 | Ga0105240_10004288 | 3300009093 | Bacteria | 21788 |
| 99 | Ga0105240_10033858 | 3300009093 | Bacteria | 6598 |
| 100 | Ga0111539_10263689 | 3300009094 | Bacteria | 2005 |
| 101 | Ga0105247_10096393 | 3300009101 | Bacteria | 1885 |
| 102 | Ga0105243_10165331 | 3300009148 | Bacteria | 1912 |
| 103 | Ga0105241_10000245 | 3300009174 | Bacteria | 41232 |
| 104 | Ga0105241_10001853 | 3300009174 | Bacteria | 16036 |
| 105 | Ga0105241_10083025 | 3300009174 | Unclassified | 2513 |
| 106 | Ga0105241_10438030 | 3300009174 | Bacteria | 1154 |
| 107 | Ga0105237_10000326 | 3300009545 | Bacteria | 67087 |
| 108 | Ga0105237_10007487 | 3300009545 | Bacteria | 11940 |
| 109 | Ga0105237_10007949 | 3300009545 | Bacteria | 11556 |
| 110 | Ga0105237_10374303 | 3300009545 | Bacteria | 1429 |
| 111 | Ga0105238_10028024 | 3300009551 | Bacteria | 5739 |
| 112 | Ga0105249_10120313 | 3300009553 | Bacteria | 2494 |
| 113 | Ga0105249_10176513 | 3300009553 | Bacteria | 2075 |
| 114 | Ga0105249_10829753 | 3300009553 | Bacteria | 989 |
| 115 | Ga0105239_10002198 | 3300010375 | Bacteria | 25092 |
| 116 | Ga0105239_10009584 | 3300010375 | Bacteria | 10893 |
| 117 | Ga0105239_10009914 | 3300010375 | Bacteria | 10697 |
| 118 | Ga0105239_10042029 | 3300010375 | Bacteria | 5008 |
| 119 | Ga0157373_10004162 | 3300013100 | Bacteria | 10908 |
| 120 | Ga0157371_10001959 | 3300013102 | Bacteria | 20458 |
| 121 | Ga0157371_10002354 | 3300013102 | Bacteria | 18085 |
| 122 | Ga0157371_10016277 | 3300013102 | Bacteria | 5555 |
| 123 | Ga0157371_10032874 | 3300013102 | Bacteria | 3730 |
| 124 | Ga0157370_10004268 | 3300013104 | Bacteria | 16462 |
| 125 | Ga0157370_10010860 | 3300013104 | Bacteria | 9565 |
| 126 | Ga0157370_10012290 | 3300013104 | Bacteria | 8886 |
| 127 | Ga0157370_10013222 | 3300013104 | Bacteria | 8508 |
| 128 | Ga0157370_10030786 | 3300013104 | Bacteria | 5256 |
| 129 | Ga0157370_10039140 | 3300013104 | Bacteria | 4582 |
| 130 | Ga0157370_10045811 | 3300013104 | Bacteria | 4196 |
| 131 | Ga0157369_10077375 | 3300013105 | Bacteria | 3566 |
| 132 | Ga0157369_10108622 | 3300013105 | Bacteria | 2950 |
| 133 | Ga0157369_10115319 | 3300013105 | Bacteria | 2853 |
| 134 | Ga0157369_10263468 | 3300013105 | Bacteria | 1797 |
| 135 | Ga0157374_10001536 | 3300013296 | Bacteria | 19448 |
| 136 | Ga0157374_10052434 | 3300013296 | Bacteria | 3799 |
| 137 | Ga0157374_10199821 | 3300013296 | Bacteria | 1957 |
| 138 | Ga0157378_10057309 | 3300013297 | Bacteria | 3472 |
| 139 | Ga0157378_10096829 | 3300013297 | Bacteria | 2689 |
| 140 | Ga0157378_10455050 | 3300013297 | Unclassified | 1271 |
| 141 | Ga0163162_10000686 | 3300013306 | Bacteria | 31389 |
| 142 | Ga0163162_10089120 | 3300013306 | Bacteria | 3165 |
| 143 | Ga0163162_10155596 | 3300013306 | Bacteria | 2406 |
| 144 | Ga0163162_10405789 | 3300013306 | Bacteria | 1495 |
| 145 | Ga0157372_10003776 | 3300013307 | Bacteria | 16262 |
| 146 | Ga0157372_10047554 | 3300013307 | Bacteria | 4768 |
| 147 | Ga0157372_10868244 | 3300013307 | Bacteria | 1047 |
| 148 | Ga0157375_11134802 | 3300013308 | Bacteria | 916 |
| 149 | Ga0163163_10000218 | 3300014325 | Bacteria | 59659 |
| 150 | Ga0157377_10006866 | 3300014745 | Bacteria | 5458 |
| 151 | Ga0157376_10029728 | 3300014969 | Bacteria | 4355 |
| 152 | Ga0157376_10123868 | 3300014969 | Bacteria | 2295 |
| 153 | Ga0157376_10230631 | 3300014969 | Bacteria | 1720 |
| 154 | Ga0157376_10317137 | 3300014969 | Bacteria | 1481 |
| 155 | Ga0182006_1000301 | 3300015261 | Bacteria | 43124 |
| 156 | Ga0163161_10043708 | 3300017792 | Bacteria | 3226 |
| 157 | Ga0209646_1001524 | 3300025246 | Bacteria | 6127 |
| 158 | Ga0209130_1002251 | 3300025284 | Bacteria | 10019 |
| 159 | Ga0209676_1000008 | 3300025292 | Bacteria | 991778 |
| 160 | Ga0209676_1000329 | 3300025292 | Bacteria | 91571 |
| 161 | Ga0209050_1000045 | 3300025298 | Bacteria | 388022 |
| 162 | Ga0207426_1000009 | 3300025302 | Bacteria | 797229 |
| 163 | Ga0207426_1000234 | 3300025302 | Bacteria | 126926 |
| 164 | Ga0209257_1000004 | 3300025304 | Bacteria | 1678347 |
| 165 | Ga0209257_1000007 | 3300025304 | Bacteria | 1564415 |
| 166 | Ga0207710_10067288 | 3300025900 | Bacteria | 1636 |
| 167 | Ga0207647_10015976 | 3300025904 | Bacteria | 5131 |
| 168 | Ga0207647_10029836 | 3300025904 | Bacteria | 3524 |
| 169 | Ga0207647_10079350 | 3300025904 | Unclassified | 1971 |
| 170 | Ga0207705_10072137 | 3300025909 | Bacteria | 2504 |
| 171 | Ga0207705_10289205 | 3300025909 | Bacteria | 1255 |
| 172 | Ga0207654_10000877 | 3300025911 | Bacteria | 16695 |
| 173 | Ga0207654_10002223 | 3300025911 | Bacteria | 9956 |
| 174 | Ga0207654_10017977 | 3300025911 | Bacteria | 3706 |
| 175 | Ga0207654_10056869 | 3300025911 | Unclassified | 2271 |
| 176 | Ga0207707_10007628 | 3300025912 | Bacteria | 9428 |
| 177 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 178 | Ga0207695_10038211 | 3300025913 | Bacteria | 5171 |
| 179 | Ga0207695_10058011 | 3300025913 | Unclassified | 4020 |
| 180 | Ga0207671_10000875 | 3300025914 | Bacteria | 38151 |
| 181 | Ga0207671_10001520 | 3300025914 | Bacteria | 26605 |
| 182 | Ga0207671_10050290 | 3300025914 | Bacteria | 3086 |
| 183 | Ga0207660_10428093 | 3300025917 | Bacteria | 1068 |
| 184 | Ga0207657_10019741 | 3300025919 | Bacteria | 6389 |
| 185 | Ga0207657_10022799 | 3300025919 | Bacteria | 5846 |
| 186 | Ga0207649_10041893 | 3300025920 | Bacteria | 2790 |
| 187 | Ga0207649_10064241 | 3300025920 | Bacteria | 2320 |
| 188 | Ga0207649_10370803 | 3300025920 | Bacteria | 1065 |
| 189 | Ga0207652_10084578 | 3300025921 | Bacteria | 2779 |
| 190 | Ga0207652_10096821 | 3300025921 | Bacteria | 2600 |
| 191 | Ga0207652_10150500 | 3300025921 | Bacteria | 2084 |
| 192 | Ga0207681_10057970 | 3300025923 | Bacteria | 2650 |
| 193 | Ga0207681_10261904 | 3300025923 | Unclassified | 1354 |
| 194 | Ga0207694_10077020 | 3300025924 | Unclassified | 2613 |
| 195 | Ga0207694_10180688 | 3300025924 | Bacteria | 1711 |
| 196 | Ga0207650_10068353 | 3300025925 | Bacteria | 2668 |
| 197 | Ga0207659_10075201 | 3300025926 | Bacteria | 2478 |
| 198 | Ga0207659_10309316 | 3300025926 | Bacteria | 1300 |
| 199 | Ga0207700_10270226 | 3300025928 | Bacteria | 1459 |
| 200 | Ga0207690_10015947 | 3300025932 | Bacteria | 4563 |
| 201 | Ga0207690_10299172 | 3300025932 | Bacteria | 1258 |
| 202 | Ga0207706_10006509 | 3300025933 | Bacteria | 10836 |
| 203 | Ga0207670_10027021 | 3300025936 | Bacteria | 3624 |
| 204 | Ga0207691_10037684 | 3300025940 | Bacteria | 4476 |
| 205 | Ga0207691_10124706 | 3300025940 | Unclassified | 2279 |
| 206 | Ga0207691_10195716 | 3300025940 | Bacteria | 1761 |
| 207 | Ga0207689_10001369 | 3300025942 | Bacteria | 23381 |
| 208 | Ga0207661_10254046 | 3300025944 | Bacteria | 1563 |
| 209 | Ga0207679_10004327 | 3300025945 | Bacteria | 8834 |
| 210 | Ga0207679_10127127 | 3300025945 | Bacteria | 2039 |
| 211 | Ga0207667_10000431 | 3300025949 | Bacteria | 56406 |
| 212 | Ga0207667_10223281 | 3300025949 | Unclassified | 1930 |
| 213 | Ga0207667_10243146 | 3300025949 | Bacteria | 1841 |
| 214 | Ga0207668_10060548 | 3300025972 | Bacteria | 2658 |
| 215 | Ga0207658_10149612 | 3300025986 | Bacteria | 1900 |
| 216 | Ga0207703_10163491 | 3300026035 | Bacteria | 1951 |
| 217 | Ga0207703_10606080 | 3300026035 | Bacteria | 1036 |
| 218 | Ga0207639_10002956 | 3300026041 | Bacteria | 11428 |
| 219 | Ga0207639_10038049 | 3300026041 | Bacteria | 3577 |
| 220 | Ga0207639_10120158 | 3300026041 | Bacteria | 2158 |
| 221 | Ga0207641_10000167 | 3300026088 | Bacteria | 92790 |
| 222 | Ga0207676_10083357 | 3300026095 | Bacteria | 2603 |
| 223 | Ga0207676_10324770 | 3300026095 | Bacteria | 1414 |
| 224 | Ga0207674_10000549 | 3300026116 | Bacteria | 49221 |
| 225 | Ga0207674_10052996 | 3300026116 | Bacteria | 4135 |
| 226 | Ga0207674_10125672 | 3300026116 | Bacteria | 2531 |
| 227 | Ga0207674_10179275 | 3300026116 | Bacteria | 2070 |
| 228 | Ga0207683_10248095 | 3300026121 | Bacteria | 1624 |
| 229 | Ga0207698_10002843 | 3300026142 | Bacteria | 10352 |
| 230 | Ga0207698_10077901 | 3300026142 | Bacteria | 2659 |
| 231 | Ga0207698_10138236 | 3300026142 | Bacteria | 2094 |
| 232 | Ga0207698_10152574 | 3300026142 | Bacteria | 2007 |
| 233 | Ga0207428_10068479 | 3300027907 | Bacteria | 2791 |
| 234 | Ga0268266_10000010 | 3300028379 | Bacteria | 1030233 |
| 235 | Ga0268264_10000252 | 3300028381 | Bacteria | 99533 |
| 236 | Ga0268264_10001260 | 3300028381 | Bacteria | 24073 |
| 237 | Ga0265327_10000296 | 3300031251 | Bacteria | 96658 |
| 238 | Ga0265327_10000395 | 3300031251 | Bacteria | 81944 |
| 239 | Ga0307513_10174504 | 3300031456 | Bacteria | 2022 |
| 240 | Ga0307513_10207993 | 3300031456 | Unclassified | 1791 |
| 241 | Ga0307516_10001231 | 3300031730 | Bacteria | 35640 |
| 242 | Ga0307414_10000001 | 3300032004 | Bacteria | 1352954 |
| 243 | Ga0307414_10176968 | 3300032004 | Bacteria | 1712 |
| 244 | Ga0307414_10186144 | 3300032004 | Bacteria | 1675 |
| 245 | Ga0307414_10294432 | 3300032004 | Bacteria | 1370 |
| 246 | Ga0373937_0073508 | 3300036401 | Bacteria | 3154 |
| 247 | Ga0395899_0066988 | 3300037312 | Bacteria | 2635 |
| 248 | Ga0395899_0211409 | 3300037312 | Bacteria | 1348 |
| 249 | Ga0395900_0032519 | 3300037418 | Bacteria | 5364 |
| 250 | Ga0395898_0127832 | 3300037466 | Bacteria | 2434 |
| 251 | Ga0395901_0041176 | 3300038443 | Bacteria | 4786 |
| 252 | Ga0439466_0025293 | 3300041411 | Bacteria | 2073 |
| 253 | Ga0451845_0794775 | 3300041501 | Bacteria | 1759 |
| 254 | Ga0439449_0008123 | 3300042007 | Bacteria | 3989 |
| 255 | Ga0451577_0022128 | 3300042876 | Bacteria | 5807 |
| 256 | Ga0451577_0023039 | 3300042876 | Bacteria | 5684 |
| 257 | Ga0451577_0056414 | 3300042876 | Bacteria | 3504 |
| 258 | Ga0451577_0110763 | 3300042876 | Bacteria | 2456 |
| 259 | Ga0466972_0000091 | 3300044658 | Bacteria | 81829 |
| 260 | Ga0466972_0000159 | 3300044658 | Bacteria | 54274 |
| 261 | Ga0466972_0012128 | 3300044658 | Bacteria | 4330 |
| 262 | Ga0466964_0041406 | 3300044706 | Bacteria | 1863 |
| 263 | Ga0453684_0053711 | 3300044712 | Bacteria | 5256 |
| 264 | Ga0453684_0103566 | 3300044712 | Bacteria | 3477 |
| 265 | Ga0453684_0527371 | 3300044712 | Bacteria | 1304 |
| 266 | Ga0453684_0816555 | 3300044712 | Bacteria | 1004 |
| 267 | Ga0466968_0089313 | 3300044735 | Bacteria | 1363 |
| 268 | Ga0466970_0000562 | 3300044765 | Bacteria | 18148 |
| 269 | Ga0451576_0002068 | 3300045051 | Bacteria | 31466 |
| 270 | Ga0451576_0006397 | 3300045051 | Bacteria | 14458 |
| 271 | Ga0451576_0011670 | 3300045051 | Bacteria | 9954 |
| 272 | Ga0451576_0062892 | 3300045051 | Bacteria | 3869 |
| 273 | Ga0451576_0185464 | 3300045051 | Bacteria | 2173 |
| 274 | Ga0451576_0297115 | 3300045051 | Bacteria | 1689 |
| 275 | Ga0495638_0142003 | 3300046460 | Bacteria | 1400 |
| 276 | Ga0495662_0036703 | 3300046476 | Bacteria | 2365 |
| 277 | Ga0495585_0000062 | 3300046492 | Bacteria | 109539 |
| 278 | Ga0495606_0028112 | 3300046507 | Bacteria | 3972 |
| 279 | Ga0495630_0268945 | 3300046517 | Unclassified | 1302 |
| 280 | Ga0495648_0001413 | 3300046524 | Bacteria | 23465 |
| 281 | Ga0495665_0049322 | 3300046531 | Bacteria | 2233 |
| 282 | Ga0495634_0106076 | 3300046642 | Bacteria | 1811 |
| 283 | Ga0495611_0085473 | 3300046648 | Bacteria | 1455 |
| 284 | Ga0495635_0049682 | 3300046663 | Bacteria | 2891 |
| 285 | Ga0495661_0000707 | 3300046665 | Bacteria | 33018 |
| 286 | Ga0495658_0017414 | 3300046683 | Unclassified | 3711 |
| 287 | Ga0495600_0307967 | 3300046809 | Unclassified | 998 |
| 288 | Ga0495674_0054543 | 3300047319 | Bacteria | 3510 |
| 289 | Ga0495676_0098244 | 3300047321 | Bacteria | 2173 |
| 290 | Ga0495687_000035 | 3300047443 | Bacteria | 255949 |
| 291 | Ga0495687_016713 | 3300047443 | Bacteria | 3682 |
| 292 | Ga0495686_0091027 | 3300047472 | Bacteria | 1852 |
| 293 | Ga0496125_0000026 | 3300048928 | Bacteria | 397380 |
| 294 | Ga0496126_0026329 | 3300048929 | Bacteria | 5579 |
| 295 | Ga0501033_0092628 | 3300049570 | Bacteria | 2210 |
| 296 | Ga0501034_0003157 | 3300049571 | Bacteria | 18950 |
| 297 | Ga0501034_0025773 | 3300049571 | Bacteria | 5988 |
| 298 | Ga0501039_0052394 | 3300049575 | Unclassified | 3158 |
| 299 | Ga0501043_0256184 | 3300049579 | Bacteria | 1347 |
| 300 | Ga0501198_006232 | 3300049649 | Bacteria | 1692 |
| 301 | Ga0501201_004692 | 3300049651 | Bacteria | 1270 |
| 302 | Ga0501202_000285 | 3300049652 | Bacteria | 6899 |
| 303 | Ga0501217_060641 | 3300049661 | Bacteria | 1010 |
| 304 | Ga0501223_002037 | 3300049663 | Unclassified | 4534 |
| 305 | Ga0501224_004640 | 3300049664 | Bacteria | 1954 |
| 306 | Ga0501235_002156 | 3300049669 | Unclassified | 4224 |
| 307 | Ga0501243_000127 | 3300049675 | Bacteria | 8464 |
| 308 | Ga0501252_001723 | 3300049682 | Bacteria | 2078 |
| 309 | Ga0501253_004305 | 3300049683 | Bacteria | 1786 |
| 310 | Ga0501257_027665 | 3300049686 | Bacteria | 1357 |
| 311 | Ga0501259_000228 | 3300049688 | Bacteria | 8706 |
| 312 | Ga0501261_000833 | 3300049690 | Bacteria | 3836 |
| 313 | Ga0501225_0001191 | 3300049705 | Bacteria | 8117 |
| 314 | Ga0501225_0002117 | 3300049705 | Bacteria | 6159 |
| 315 | Ga0501234_010504 | 3300049707 | Bacteria | 1443 |
| 316 | Ga0501080_0239912 | 3300049742 | Bacteria | 1655 |
| 317 | Ga0501035_0305824 | 3300049822 | Bacteria | 1339 |
| 318 | Ga0501044_0070753 | 3300049823 | Bacteria | 3548 |
| 319 | Ga0501044_0293052 | 3300049823 | Unclassified | 1558 |
| 320 | nmdc:mga0k408_13171_c1 | 3300050493 | Bacteria | 4530 |
| 321 | nmdc:mga0k408_89860_c1 | 3300050493 | Bacteria | 1804 |
| 322 | nmdc:mga08y16_260534_c1 | 3300050511 | Bacteria | 1791 |
| 323 | Ga0500578_0000029 | 3300053086 | Bacteria | 140078 |
| 324 | Ga0500578_0030964 | 3300053086 | Bacteria | 3438 |
| 325 | Ga0500644_0002862 | 3300053088 | Bacteria | 4284 |
| 326 | Ga0500644_0120001 | 3300053088 | Bacteria | 1023 |
| 327 | Ga0500583_0000002 | 3300053092 | Bacteria | 232826 |
| 328 | Ga0500583_0002891 | 3300053092 | Bacteria | 5279 |
| 329 | Ga0500583_0004168 | 3300053092 | Bacteria | 4670 |
| 330 | Ga0500555_046292 | 3300053103 | Bacteria | 1200 |
| 331 | Ga0500608_000986 | 3300053122 | Bacteria | 10227 |
| 332 | Ga0500622_0049142 | 3300053156 | Bacteria | 2175 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009545 | Ga0105237_10374303 | Ga0105237_103743031 | 253 |
| 2 | 3300010375 | Ga0105239_10009584 | Ga0105239_100095844 | 253 |
| 3 | 3300013307 | Ga0157372_10868244 | Ga0157372_108682441 | 253 |
| 4 | 3300044712 | Ga0453684_0816555 | Ga0453684_0816555_41_850 | 253 |
| 5 | 3300045051 | Ga0451576_0297115 | Ga0451576_0297115_555_1421 | 253 |
| 6 | 3300003323 | rootH1_10310914 | rootH1_103109141 | 254 |
| 7 | 3300005366 | Ga0070659_100025524 | Ga0070659_1000255244 | 254 |
| 8 | 3300005530 | Ga0070679_100307000 | Ga0070679_1003070002 | 254 |
| 9 | 3300005563 | Ga0068855_100018704 | Ga0068855_1000187043 | 254 |
| 10 | 3300013102 | Ga0157371_10001959 | Ga0157371_100019596 | 254 |
| 11 | 3300013104 | Ga0157370_10004268 | Ga0157370_100042686 | 254 |
| 12 | 3300013307 | Ga0157372_10047554 | Ga0157372_100475545 | 254 |
| 13 | 3300025921 | Ga0207652_10096821 | Ga0207652_100968212 | 254 |
| 14 | 3300025932 | Ga0207690_10015947 | Ga0207690_100159474 | 254 |
| 15 | 3300025949 | Ga0207667_10223281 | Ga0207667_102232812 | 254 |
| 16 | 3300037312 | Ga0395899_0066988 | Ga0395899_0066988_1416_2261 | 254 |
| 17 | 3300037418 | Ga0395900_0032519 | Ga0395900_0032519_133_978 | 254 |
| 18 | 3300037466 | Ga0395898_0127832 | Ga0395898_0127832_1288_2133 | 254 |
| 19 | 3300038443 | Ga0395901_0041176 | Ga0395901_0041176_282_1127 | 254 |
| 20 | 3300041411 | Ga0439466_0025293 | Ga0439466_0025293_794_1651 | 254 |
| 21 | 3300009553 | Ga0105249_10176513 | Ga0105249_101765132 | 255 |
| 22 | 3300013296 | Ga0157374_10001536 | Ga0157374_1000153612 | 256 |
| 23 | 3300013306 | Ga0163162_10155596 | Ga0163162_101555963 | 256 |
| 24 | 3300014325 | Ga0163163_10000218 | Ga0163163_1000021838 | 256 |
| 25 | 3300044712 | Ga0453684_0053711 | Ga0453684_0053711_4091_4924 | 256 |
| 26 | 3300013104 | Ga0157370_10012290 | Ga0157370_100122904 | 257 |
| 27 | 3300005364 | Ga0070673_100128559 | Ga0070673_1001285593 | 258 |
| 28 | 3300046507 | Ga0495606_0028112 | Ga0495606_0028112_2412_3215 | 258 |
| 29 | 3300003781 | Ga0055536_1000001 | Ga0055536_1000001369 | 259 |
| 30 | 3300003791 | Ga0055530_10002341 | Ga0055530_1000234112 | 259 |
| 31 | 3300025292 | Ga0209676_1000008 | Ga0209676_1000008494 | 259 |
| 32 | 3300025298 | Ga0209050_1000045 | Ga0209050_1000045291 | 259 |
| 33 | 3300005614 | Ga0068856_100253941 | Ga0068856_1002539412 | 260 |
| 34 | 3300005616 | Ga0068852_100557058 | Ga0068852_1005570581 | 260 |
| 35 | 3300006237 | Ga0097621_100025600 | Ga0097621_1000256001 | 260 |
| 36 | 3300006358 | Ga0068871_100067855 | Ga0068871_1000678553 | 260 |
| 37 | 3300014969 | Ga0157376_10029728 | Ga0157376_100297284 | 260 |
| 38 | 3300044712 | Ga0453684_0527371 | Ga0453684_0527371_162_1022 | 260 |
| 39 | 3300045051 | Ga0451576_0185464 | Ga0451576_0185464_11_811 | 260 |
| 40 | 3300005355 | Ga0070671_100055508 | Ga0070671_1000555081 | 261 |
| 41 | 3300005367 | Ga0070667_100010467 | Ga0070667_1000104676 | 261 |
| 42 | 3300005616 | Ga0068852_100165116 | Ga0068852_1001651162 | 261 |
| 43 | 3300005617 | Ga0068859_100000018 | Ga0068859_100000018194 | 261 |
| 44 | 3300005841 | Ga0068863_100006638 | Ga0068863_1000066383 | 261 |
| 45 | 3300005842 | Ga0068858_100061442 | Ga0068858_1000614422 | 261 |
| 46 | 3300005843 | Ga0068860_100016612 | Ga0068860_1000166122 | 261 |
| 47 | 3300006931 | Ga0097620_100000018 | Ga0097620_100000018194 | 261 |
| 48 | 3300009094 | Ga0111539_10263689 | Ga0111539_102636892 | 261 |
| 49 | 3300009101 | Ga0105247_10096393 | Ga0105247_100963933 | 261 |
| 50 | 3300009148 | Ga0105243_10165331 | Ga0105243_101653312 | 261 |
| 51 | 3300009174 | Ga0105241_10001853 | Ga0105241_1000185313 | 261 |
| 52 | 3300009545 | Ga0105237_10007949 | Ga0105237_100079499 | 261 |
| 53 | 3300009553 | Ga0105249_10120313 | Ga0105249_101203131 | 261 |
| 54 | 3300013297 | Ga0157378_10455050 | Ga0157378_104550501 | 261 |
| 55 | 3300025900 | Ga0207710_10067288 | Ga0207710_100672881 | 261 |
| 56 | 3300025911 | Ga0207654_10002223 | Ga0207654_1000222313 | 261 |
| 57 | 3300025914 | Ga0207671_10001520 | Ga0207671_1000152018 | 261 |
| 58 | 3300025923 | Ga0207681_10261904 | Ga0207681_102619042 | 261 |
| 59 | 3300025972 | Ga0207668_10060548 | Ga0207668_100605483 | 261 |
| 60 | 3300025986 | Ga0207658_10149612 | Ga0207658_101496121 | 261 |
| 61 | 3300026035 | Ga0207703_10163491 | Ga0207703_101634912 | 261 |
| 62 | 3300026088 | Ga0207641_10000167 | Ga0207641_1000016769 | 261 |
| 63 | 3300026095 | Ga0207676_10083357 | Ga0207676_100833573 | 261 |
| 64 | 3300026142 | Ga0207698_10138236 | Ga0207698_101382362 | 261 |
| 65 | 3300028381 | Ga0268264_10001260 | Ga0268264_1000126016 | 261 |
| 66 | 3300050511 | nmdc:mga08y16_260534_c1 | nmdc:mga08y16_260534_c1_156_941 | 261 |
| 67 | iso_pu_bacteria | 2896109856 | 2896109889 | 261 |
| 68 | 3300003320 | rootH2_10001122 | rootH2_1000112223 | 263 |
| 69 | 3300005548 | Ga0070665_100000066 | Ga0070665_10000006691 | 263 |
| 70 | 3300005843 | Ga0068860_100000041 | Ga0068860_10000004151 | 263 |
| 71 | 3300013306 | Ga0163162_10000686 | Ga0163162_1000068616 | 263 |
| 72 | 3300028379 | Ga0268266_10000010 | Ga0268266_1000001013 | 263 |
| 73 | 3300028381 | Ga0268264_10000252 | Ga0268264_1000025229 | 263 |
| 74 | 3300046460 | Ga0495638_0142003 | Ga0495638_0142003_525_1340 | 263 |
| 75 | 3300046524 | Ga0495648_0001413 | Ga0495648_0001413_5206_6021 | 263 |
| 76 | 3300046648 | Ga0495611_0085473 | Ga0495611_0085473_561_1376 | 263 |
| 77 | 3300047443 | Ga0495687_000035 | Ga0495687_000035_25695_26510 | 263 |
| 78 | 3300053088 | Ga0500644_0120001 | Ga0500644_0120001_152_967 | 263 |
| 79 | 3300053092 | Ga0500583_0004168 | Ga0500583_0004168_43_858 | 263 |
| 80 | 3300003323 | rootH1_10166439 | rootH1_101664391 | 264 |
| 81 | 3300005577 | Ga0068857_100110181 | Ga0068857_1001101812 | 264 |
| 82 | 3300045051 | Ga0451576_0006397 | Ga0451576_0006397_11452_12306 | 264 |
| 83 | 3300046492 | Ga0495585_0000062 | Ga0495585_0000062_82050_82898 | 264 |
| 84 | 3300046665 | Ga0495661_0000707 | Ga0495661_0000707_25702_26532 | 264 |
| 85 | 3300053088 | Ga0500644_0002862 | Ga0500644_0002862_694_1527 | 264 |
| 86 | iso_pu_bacteria | 2945977869 | 2945982310 | 264 |
| 87 | iso_pu_bacteria | 2946013367 | 2946018303 | 264 |
| 88 | 3300003323 | rootH1_10027584 | rootH1_100275847 | 265 |
| 89 | 3300003794 | Ga0055531_10000118 | Ga0055531_1000011815 | 265 |
| 90 | 3300009174 | Ga0105241_10438030 | Ga0105241_104380301 | 265 |
| 91 | 3300009545 | Ga0105237_10007487 | Ga0105237_1000748710 | 265 |
| 92 | 3300013307 | Ga0157372_10003776 | Ga0157372_100037763 | 265 |
| 93 | 3300025304 | Ga0209257_1000007 | Ga0209257_1000007176 | 265 |
| 94 | 3300025904 | Ga0207647_10029836 | Ga0207647_100298362 | 265 |
| 95 | 3300025914 | Ga0207671_10050290 | Ga0207671_100502902 | 265 |
| 96 | 3300025924 | Ga0207694_10180688 | Ga0207694_101806881 | 265 |
| 97 | 3300003794 | Ga0055531_10000102 | Ga0055531_1000010219 | 266 |
| 98 | 3300005289 | Ga0065704_10085633 | Ga0065704_100856333 | 266 |
| 99 | 3300025304 | Ga0209257_1000004 | Ga0209257_10000041330 | 266 |
| 100 | 3300037312 | Ga0395899_0211409 | Ga0395899_0211409_302_1126 | 266 |
| 101 | 3300048929 | Ga0496126_0026329 | Ga0496126_0026329_3210_4031 | 266 |
| 102 | 3300050493 | nmdc:mga0k408_89860_c1 | nmdc:mga0k408_89860_c1_894_1712 | 266 |
| 103 | 3300003323 | rootH1_10042710 | rootH1_100427104 | 267 |
| 104 | 3300013104 | Ga0157370_10010860 | Ga0157370_100108605 | 267 |
| 105 | 3300042876 | Ga0451577_0056414 | Ga0451577_0056414_129_1115 | 267 |
| 106 | 3300042876 | Ga0451577_0110763 | Ga0451577_0110763_420_1244 | 267 |
| 107 | 3300044706 | Ga0466964_0041406 | Ga0466964_0041406_777_1625 | 267 |
| 108 | 3300044735 | Ga0466968_0089313 | Ga0466968_0089313_441_1289 | 267 |
| 109 | 3300045051 | Ga0451576_0011670 | Ga0451576_0011670_6416_7240 | 267 |
| 110 | 3300049570 | Ga0501033_0092628 | Ga0501033_0092628_166_981 | 267 |
| 111 | 3300049571 | Ga0501034_0003157 | Ga0501034_0003157_16358_17173 | 267 |
| 112 | 3300049571 | Ga0501034_0025773 | Ga0501034_0025773_1151_1966 | 267 |
| 113 | 3300049742 | Ga0501080_0239912 | Ga0501080_0239912_394_1209 | 267 |
| 114 | 3300049823 | Ga0501044_0070753 | Ga0501044_0070753_2498_3313 | 267 |
| 115 | 3300049823 | Ga0501044_0293052 | Ga0501044_0293052_720_1535 | 267 |
| 116 | 3300003320 | rootH2_10005823 | rootH2_100058236 | 268 |
| 117 | 3300005339 | Ga0070660_100451582 | Ga0070660_1004515821 | 268 |
| 118 | 3300005539 | Ga0068853_100069166 | Ga0068853_1000691663 | 268 |
| 119 | 3300005563 | Ga0068855_100099807 | Ga0068855_1000998072 | 268 |
| 120 | 3300005577 | Ga0068857_100002107 | Ga0068857_1000021079 | 268 |
| 121 | 3300005614 | Ga0068856_100048598 | Ga0068856_1000485982 | 268 |
| 122 | 3300005614 | Ga0068856_100071449 | Ga0068856_1000714495 | 268 |
| 123 | 3300005616 | Ga0068852_100004016 | Ga0068852_10000401610 | 268 |
| 124 | 3300009093 | Ga0105240_10033858 | Ga0105240_100338587 | 268 |
| 125 | 3300009174 | Ga0105241_10083025 | Ga0105241_100830252 | 268 |
| 126 | 3300013105 | Ga0157369_10108622 | Ga0157369_101086222 | 268 |
| 127 | 3300025904 | Ga0207647_10079350 | Ga0207647_100793501 | 268 |
| 128 | 3300025911 | Ga0207654_10056869 | Ga0207654_100568693 | 268 |
| 129 | 3300025924 | Ga0207694_10077020 | Ga0207694_100770202 | 268 |
| 130 | 3300025949 | Ga0207667_10000431 | Ga0207667_100004312 | 268 |
| 131 | 3300026041 | Ga0207639_10002956 | Ga0207639_100029562 | 268 |
| 132 | 3300026041 | Ga0207639_10038049 | Ga0207639_100380492 | 268 |
| 133 | 3300026116 | Ga0207674_10000549 | Ga0207674_1000054926 | 268 |
| 134 | 3300026116 | Ga0207674_10052996 | Ga0207674_100529966 | 268 |
| 135 | 3300026142 | Ga0207698_10002843 | Ga0207698_100028436 | 268 |
| 136 | 3300032004 | Ga0307414_10176968 | Ga0307414_101769682 | 268 |
| 137 | 3300041501 | Ga0451845_0794775 | Ga0451845_0794775_626_1459 | 268 |
| 138 | iso_pu_bacteria | 2954016120 | 2954018927 | 268 |
| 139 | 3300005329 | Ga0070683_100079345 | Ga0070683_1000793454 | 269 |
| 140 | 3300005331 | Ga0070670_100090117 | Ga0070670_1000901174 | 269 |
| 141 | 3300005340 | Ga0070689_100014598 | Ga0070689_1000145986 | 269 |
| 142 | 3300005344 | Ga0070661_100016911 | Ga0070661_1000169112 | 269 |
| 143 | 3300005354 | Ga0070675_100047950 | Ga0070675_1000479502 | 269 |
| 144 | 3300005365 | Ga0070688_100035206 | Ga0070688_1000352062 | 269 |
| 145 | 3300005535 | Ga0070684_100132442 | Ga0070684_1001324423 | 269 |
| 146 | 3300005535 | Ga0070684_100431256 | Ga0070684_1004312562 | 269 |
| 147 | 3300005539 | Ga0068853_100089456 | Ga0068853_1000894562 | 269 |
| 148 | 3300005617 | Ga0068859_100338234 | Ga0068859_1003382341 | 269 |
| 149 | 3300005618 | Ga0068864_100037518 | Ga0068864_1000375183 | 269 |
| 150 | 3300006931 | Ga0097620_100338219 | Ga0097620_1003382192 | 269 |
| 151 | 3300010375 | Ga0105239_10042029 | Ga0105239_100420292 | 269 |
| 152 | 3300017792 | Ga0163161_10043708 | Ga0163161_100437084 | 269 |
| 153 | 3300025904 | Ga0207647_10015976 | Ga0207647_100159764 | 269 |
| 154 | 3300025920 | Ga0207649_10064241 | Ga0207649_100642412 | 269 |
| 155 | 3300025923 | Ga0207681_10057970 | Ga0207681_100579702 | 269 |
| 156 | 3300025925 | Ga0207650_10068353 | Ga0207650_100683532 | 269 |
| 157 | 3300025932 | Ga0207690_10299172 | Ga0207690_102991722 | 269 |
| 158 | 3300025936 | Ga0207670_10027021 | Ga0207670_100270215 | 269 |
| 159 | 3300025940 | Ga0207691_10037684 | Ga0207691_100376845 | 269 |
| 160 | 3300025942 | Ga0207689_10001369 | Ga0207689_100013697 | 269 |
| 161 | 3300025944 | Ga0207661_10254046 | Ga0207661_102540462 | 269 |
| 162 | 3300025945 | Ga0207679_10004327 | Ga0207679_100043277 | 269 |
| 163 | 3300026116 | Ga0207674_10125672 | Ga0207674_101256721 | 269 |
| 164 | 3300026142 | Ga0207698_10152574 | Ga0207698_101525742 | 269 |
| 165 | iso_pu_bacteria | 2945997725 | 2946002033 | 269 |
| 166 | 3300005339 | Ga0070660_100011259 | Ga0070660_1000112594 | 270 |
| 167 | 3300005364 | Ga0070673_100127974 | Ga0070673_1001279742 | 270 |
| 168 | 3300005456 | Ga0070678_100306228 | Ga0070678_1003062282 | 270 |
| 169 | 3300005564 | Ga0070664_100118103 | Ga0070664_1001181032 | 270 |
| 170 | 3300005615 | Ga0070702_100212694 | Ga0070702_1002126941 | 270 |
| 171 | 3300013102 | Ga0157371_10002354 | Ga0157371_100023544 | 270 |
| 172 | 3300013297 | Ga0157378_10096829 | Ga0157378_100968291 | 270 |
| 173 | 3300013306 | Ga0163162_10405789 | Ga0163162_104057891 | 270 |
| 174 | 3300025913 | Ga0207695_10058011 | Ga0207695_100580113 | 270 |
| 175 | 3300025919 | Ga0207657_10019741 | Ga0207657_100197412 | 270 |
| 176 | 3300025920 | Ga0207649_10370803 | Ga0207649_103708031 | 270 |
| 177 | 3300025926 | Ga0207659_10075201 | Ga0207659_100752013 | 270 |
| 178 | 3300025940 | Ga0207691_10124706 | Ga0207691_101247063 | 270 |
| 179 | 3300025945 | Ga0207679_10127127 | Ga0207679_101271271 | 270 |
| 180 | 3300026035 | Ga0207703_10606080 | Ga0207703_106060801 | 270 |
| 181 | 3300026041 | Ga0207639_10120158 | Ga0207639_101201582 | 270 |
| 182 | 3300026121 | Ga0207683_10248095 | Ga0207683_102480951 | 270 |
| 183 | 3300049661 | Ga0501217_060641 | Ga0501217_060641_79_918 | 270 |
| 184 | iso_pu_bacteria | 2738541278 | 2738728345 | 270 |
| 185 | iso_pu_bacteria | 2852623160 | 2852624975 | 270 |
| 186 | iso_pu_bacteria | 2884933994 | 2884935999 | 270 |
| 187 | 3300005564 | Ga0070664_100017050 | Ga0070664_1000170501 | 271 |
| 188 | 3300009093 | Ga0105240_10004288 | Ga0105240_100042889 | 271 |
| 189 | 3300009174 | Ga0105241_10000245 | Ga0105241_100002459 | 271 |
| 190 | 3300049575 | Ga0501039_0052394 | Ga0501039_0052394_1942_2760 | 271 |
| 191 | 3300049649 | Ga0501198_006232 | Ga0501198_006232_355_1212 | 271 |
| 192 | 3300049651 | Ga0501201_004692 | Ga0501201_004692_344_1201 | 271 |
| 193 | 3300049652 | Ga0501202_000285 | Ga0501202_000285_2357_3214 | 271 |
| 194 | 3300049663 | Ga0501223_002037 | Ga0501223_002037_2821_3678 | 271 |
| 195 | 3300049664 | Ga0501224_004640 | Ga0501224_004640_224_1081 | 271 |
| 196 | 3300049669 | Ga0501235_002156 | Ga0501235_002156_2598_3455 | 271 |
| 197 | 3300049675 | Ga0501243_000127 | Ga0501243_000127_5320_6177 | 271 |
| 198 | 3300049682 | Ga0501252_001723 | Ga0501252_001723_403_1260 | 271 |
| 199 | 3300049683 | Ga0501253_004305 | Ga0501253_004305_471_1328 | 271 |
| 200 | 3300049688 | Ga0501259_000228 | Ga0501259_000228_7177_8034 | 271 |
| 201 | 3300049690 | Ga0501261_000833 | Ga0501261_000833_856_1713 | 271 |
| 202 | 3300049705 | Ga0501225_0001191 | Ga0501225_0001191_463_1320 | 271 |
| 203 | 3300049707 | Ga0501234_010504 | Ga0501234_010504_498_1355 | 271 |
| 204 | 3300003781 | Ga0055536_1011371 | Ga0055536_10113712 | 272 |
| 205 | 3300005262 | Ga0065165_1000169 | Ga0065165_100016914 | 272 |
| 206 | 3300005262 | Ga0065165_1003050 | Ga0065165_10030506 | 272 |
| 207 | 3300005288 | Ga0065714_10123915 | Ga0065714_101239151 | 272 |
| 208 | 3300005289 | Ga0065704_10165771 | Ga0065704_101657712 | 272 |
| 209 | 3300025284 | Ga0209130_1002251 | Ga0209130_10022516 | 272 |
| 210 | 3300025292 | Ga0209676_1000329 | Ga0209676_100032927 | 272 |
| 211 | 3300025302 | Ga0207426_1000234 | Ga0207426_100023495 | 272 |
| 212 | 3300032004 | Ga0307414_10186144 | Ga0307414_101861442 | 272 |
| 213 | 3300042876 | Ga0451577_0022128 | Ga0451577_0022128_725_1561 | 272 |
| 214 | 3300042876 | Ga0451577_0023039 | Ga0451577_0023039_3373_4221 | 272 |
| 215 | 3300044712 | Ga0453684_0103566 | Ga0453684_0103566_2377_3213 | 272 |
| 216 | 3300045051 | Ga0451576_0002068 | Ga0451576_0002068_10115_10939 | 272 |
| 217 | 3300003322 | rootL2_10005207 | rootL2_100052071 | 273 |
| 218 | 3300005327 | Ga0070658_10059735 | Ga0070658_100597352 | 273 |
| 219 | 3300005329 | Ga0070683_100050106 | Ga0070683_1000501063 | 273 |
| 220 | 3300005329 | Ga0070683_100136298 | Ga0070683_1001362982 | 273 |
| 221 | 3300005335 | Ga0070666_10041958 | Ga0070666_100419583 | 273 |
| 222 | 3300005336 | Ga0070680_100046872 | Ga0070680_1000468721 | 273 |
| 223 | 3300005337 | Ga0070682_100016629 | Ga0070682_1000166297 | 273 |
| 224 | 3300005337 | Ga0070682_100025413 | Ga0070682_1000254132 | 273 |
| 225 | 3300005339 | Ga0070660_100039288 | Ga0070660_1000392883 | 273 |
| 226 | 3300005344 | Ga0070661_100074504 | Ga0070661_1000745043 | 273 |
| 227 | 3300005354 | Ga0070675_100023600 | Ga0070675_1000236001 | 273 |
| 228 | 3300005354 | Ga0070675_100037707 | Ga0070675_1000377074 | 273 |
| 229 | 3300005366 | Ga0070659_100018470 | Ga0070659_1000184703 | 273 |
| 230 | 3300005457 | Ga0070662_100026289 | Ga0070662_1000262894 | 273 |
| 231 | 3300005466 | Ga0070685_10191362 | Ga0070685_101913622 | 273 |
| 232 | 3300005530 | Ga0070679_100007276 | Ga0070679_1000072765 | 273 |
| 233 | 3300005530 | Ga0070679_100074055 | Ga0070679_1000740552 | 273 |
| 234 | 3300005535 | Ga0070684_100016960 | Ga0070684_1000169603 | 273 |
| 235 | 3300005539 | Ga0068853_100042556 | Ga0068853_1000425564 | 273 |
| 236 | 3300005547 | Ga0070693_100072165 | Ga0070693_1000721653 | 273 |
| 237 | 3300005563 | Ga0068855_100091790 | Ga0068855_1000917902 | 273 |
| 238 | 3300005563 | Ga0068855_100133306 | Ga0068855_1001333063 | 273 |
| 239 | 3300005577 | Ga0068857_100042669 | Ga0068857_1000426693 | 273 |
| 240 | 3300005578 | Ga0068854_100172444 | Ga0068854_1001724442 | 273 |
| 241 | 3300005614 | Ga0068856_100044707 | Ga0068856_1000447073 | 273 |
| 242 | 3300005616 | Ga0068852_100131110 | Ga0068852_1001311103 | 273 |
| 243 | 3300005844 | Ga0068862_100165556 | Ga0068862_1001655562 | 273 |
| 244 | 3300006237 | Ga0097621_100053801 | Ga0097621_1000538012 | 273 |
| 245 | 3300006358 | Ga0068871_100014736 | Ga0068871_1000147364 | 273 |
| 246 | 3300013100 | Ga0157373_10004162 | Ga0157373_100041629 | 273 |
| 247 | 3300013102 | Ga0157371_10032874 | Ga0157371_100328743 | 273 |
| 248 | 3300013104 | Ga0157370_10039140 | Ga0157370_100391405 | 273 |
| 249 | 3300013105 | Ga0157369_10077375 | Ga0157369_100773752 | 273 |
| 250 | 3300013296 | Ga0157374_10052434 | Ga0157374_100524343 | 273 |
| 251 | 3300013297 | Ga0157378_10057309 | Ga0157378_100573092 | 273 |
| 252 | 3300013308 | Ga0157375_11134802 | Ga0157375_111348021 | 273 |
| 253 | 3300014745 | Ga0157377_10006866 | Ga0157377_100068663 | 273 |
| 254 | 3300014969 | Ga0157376_10230631 | Ga0157376_102306312 | 273 |
| 255 | 3300015261 | Ga0182006_1000301 | Ga0182006_10003017 | 273 |
| 256 | 3300025909 | Ga0207705_10289205 | Ga0207705_102892051 | 273 |
| 257 | 3300025912 | Ga0207707_10007628 | Ga0207707_100076285 | 273 |
| 258 | 3300025917 | Ga0207660_10428093 | Ga0207660_104280931 | 273 |
| 259 | 3300025919 | Ga0207657_10022799 | Ga0207657_100227993 | 273 |
| 260 | 3300025920 | Ga0207649_10041893 | Ga0207649_100418934 | 273 |
| 261 | 3300025921 | Ga0207652_10084578 | Ga0207652_100845783 | 273 |
| 262 | 3300025921 | Ga0207652_10150500 | Ga0207652_101505003 | 273 |
| 263 | 3300025926 | Ga0207659_10309316 | Ga0207659_103093162 | 273 |
| 264 | 3300025933 | Ga0207706_10006509 | Ga0207706_100065095 | 273 |
| 265 | 3300025949 | Ga0207667_10243146 | Ga0207667_102431461 | 273 |
| 266 | 3300026116 | Ga0207674_10179275 | Ga0207674_101792752 | 273 |
| 267 | 3300026142 | Ga0207698_10077901 | Ga0207698_100779012 | 273 |
| 268 | 3300027907 | Ga0207428_10068479 | Ga0207428_100684793 | 273 |
| 269 | 3300031456 | Ga0307513_10174504 | Ga0307513_101745042 | 273 |
| 270 | 3300031456 | Ga0307513_10207993 | Ga0307513_102079932 | 273 |
| 271 | 3300032004 | Ga0307414_10000001 | Ga0307414_10000001580 | 273 |
| 272 | 3300032004 | Ga0307414_10294432 | Ga0307414_102944322 | 273 |
| 273 | 3300044658 | Ga0466972_0000159 | Ga0466972_0000159_43646_44521 | 273 |
| 274 | 3300044765 | Ga0466970_0000562 | Ga0466970_0000562_4855_5730 | 273 |
| 275 | 3300045051 | Ga0451576_0062892 | Ga0451576_0062892_292_1134 | 273 |
| 276 | 3300049705 | Ga0501225_0002117 | Ga0501225_0002117_2174_3148 | 273 |
| 277 | 3300053092 | Ga0500583_0002891 | Ga0500583_0002891_2014_2835 | 273 |
| 278 | 3300053156 | Ga0500622_0049142 | Ga0500622_0049142_514_1335 | 273 |
| 279 | 3300003323 | rootH1_10006403 | rootH1_100064039 | 274 |
| 280 | 3300013105 | Ga0157369_10263468 | Ga0157369_102634682 | 274 |
| 281 | 3300025911 | Ga0207654_10000877 | Ga0207654_100008773 | 274 |
| 282 | 3300031251 | Ga0265327_10000395 | Ga0265327_1000039521 | 274 |
| 283 | 3300042007 | Ga0439449_0008123 | Ga0439449_0008123_270_1100 | 274 |
| 284 | 3300047443 | Ga0495687_016713 | Ga0495687_016713_2006_2836 | 274 |
| 285 | 3300053103 | Ga0500555_046292 | Ga0500555_046292_114_983 | 274 |
| 286 | 3300053122 | Ga0500608_000986 | Ga0500608_000986_3401_4249 | 274 |
| 287 | 3300005327 | Ga0070658_10258774 | Ga0070658_102587742 | 275 |
| 288 | 3300006195 | Ga0075366_10009752 | Ga0075366_100097522 | 275 |
| 289 | 3300009545 | Ga0105237_10000326 | Ga0105237_1000032637 | 275 |
| 290 | 3300009551 | Ga0105238_10028024 | Ga0105238_100280246 | 275 |
| 291 | 3300010375 | Ga0105239_10002198 | Ga0105239_1000219810 | 275 |
| 292 | 3300013104 | Ga0157370_10030786 | Ga0157370_100307862 | 275 |
| 293 | 3300025909 | Ga0207705_10072137 | Ga0207705_100721373 | 275 |
| 294 | 3300025911 | Ga0207654_10017977 | Ga0207654_100179774 | 275 |
| 295 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013701 | 275 |
| 296 | 3300025914 | Ga0207671_10000875 | Ga0207671_1000087519 | 275 |
| 297 | 3300031251 | Ga0265327_10000296 | Ga0265327_1000029613 | 275 |
| 298 | 3300036401 | Ga0373937_0073508 | Ga0373937_0073508_2241_3080 | 275 |
| 299 | 3300046476 | Ga0495662_0036703 | Ga0495662_0036703_859_1698 | 275 |
| 300 | 3300046517 | Ga0495630_0268945 | Ga0495630_0268945_265_1104 | 275 |
| 301 | 3300046531 | Ga0495665_0049322 | Ga0495665_0049322_990_1829 | 275 |
| 302 | 3300046642 | Ga0495634_0106076 | Ga0495634_0106076_171_1010 | 275 |
| 303 | 3300046663 | Ga0495635_0049682 | Ga0495635_0049682_818_1657 | 275 |
| 304 | 3300046683 | Ga0495658_0017414 | Ga0495658_0017414_476_1315 | 275 |
| 305 | 3300046809 | Ga0495600_0307967 | Ga0495600_0307967_27_866 | 275 |
| 306 | 3300047319 | Ga0495674_0054543 | Ga0495674_0054543_513_1352 | 275 |
| 307 | 3300047321 | Ga0495676_0098244 | Ga0495676_0098244_635_1474 | 275 |
| 308 | 3300047472 | Ga0495686_0091027 | Ga0495686_0091027_793_1635 | 275 |
| 309 | 3300050493 | nmdc:mga0k408_13171_c1 | nmdc:mga0k408_13171_c1_2030_2875 | 275 |
| 310 | iso_pu_bacteria | 2919437846 | 2919442575 | 275 |
| 311 | 3300025302 | Ga0207426_1000009 | Ga0207426_1000009380 | 276 |
| 312 | 3300003323 | rootH1_10076533 | rootH1_100765333 | 277 |
| 313 | 3300013104 | Ga0157370_10013222 | Ga0157370_100132224 | 277 |
| 314 | 3300031730 | Ga0307516_10001231 | Ga0307516_1000123121 | 277 |
| 315 | 3300048928 | Ga0496125_0000026 | Ga0496125_0000026_230104_230961 | 277 |
| 316 | 3300049686 | Ga0501257_027665 | Ga0501257_027665_427_1341 | 277 |
| 317 | 3300003316 | rootH1_10137592 | rootH1_101375922 | 278 |
| 318 | 3300005354 | Ga0070675_100391419 | Ga0070675_1003914191 | 278 |
| 319 | 3300005844 | Ga0068862_100034398 | Ga0068862_1000343985 | 278 |
| 320 | 3300009553 | Ga0105249_10829753 | Ga0105249_108297531 | 278 |
| 321 | 3300010375 | Ga0105239_10009914 | Ga0105239_100099149 | 278 |
| 322 | 3300013306 | Ga0163162_10089120 | Ga0163162_100891203 | 278 |
| 323 | 3300025913 | Ga0207695_10038211 | Ga0207695_100382112 | 278 |
| 324 | 3300025940 | Ga0207691_10195716 | Ga0207691_101957162 | 278 |
| 325 | 3300026095 | Ga0207676_10324770 | Ga0207676_103247702 | 278 |
| 326 | 3300049579 | Ga0501043_0256184 | Ga0501043_0256184_111_959 | 279 |
| 327 | 3300049822 | Ga0501035_0305824 | Ga0501035_0305824_323_1171 | 279 |
| 328 | 3300013102 | Ga0157371_10016277 | Ga0157371_100162774 | 280 |
| 329 | 3300013104 | Ga0157370_10045811 | Ga0157370_100458112 | 280 |
| 330 | 3300013105 | Ga0157369_10115319 | Ga0157369_101153192 | 280 |
| 331 | 3300014969 | Ga0157376_10123868 | Ga0157376_101238682 | 280 |
| 332 | 3300014969 | Ga0157376_10317137 | Ga0157376_103171372 | 281 |
| 333 | 3300053092 | Ga0500583_0000002 | Ga0500583_0000002_200342_201199 | 282 |
| 334 | 3300025928 | Ga0207700_10270226 | Ga0207700_102702261 | 287 |
| 335 | 3300044658 | Ga0466972_0000091 | Ga0466972_0000091_25738_26607 | 289 |
| 336 | 3300013296 | Ga0157374_10199821 | Ga0157374_101998211 | 290 |
| 337 | 3300044658 | Ga0466972_0012128 | Ga0466972_0012128_896_1768 | 290 |
| 338 | 3300053086 | Ga0500578_0000029 | Ga0500578_0000029_60340_61212 | 290 |
| 339 | 3300053086 | Ga0500578_0030964 | Ga0500578_0030964_1108_1980 | 290 |
| 340 | 3300002738 | JGI25154J39366_1007454 | JGI25154J39366_10074542 | 300 |
| 341 | 3300025246 | Ga0209646_1001524 | Ga0209646_10015242 | 300 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4pxy-assembly1.cif.gz_A | crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution | 0.9465 | 29 | 278 |
| 4pxy-assembly1.cif.gz_A | crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution | 0.8868 | 29 | 278 |
| 2d7j-assembly1.cif.gz_A | crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 | 0.7016 | 35 | 279 |
| 2d7j-assembly1.cif.gz_A | crystal structure analysis of glutamine amidotransferase from pyrococcus horikoshii ot3 | 0.6952 | 35 | 279 |
| 2b4y-assembly4.cif.gz_D | crystal structure of human sirtuin homolog 5 | 0.6909 | 81 | 118 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4pxyB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9452 | 29 | 278 | 3.40.50.880 |
| 4pxyB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.8846 | 29 | 278 | 3.40.50.880 |
| 3cs3A01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.733 | 34 | 118 | 3.40.50.2300 |
| af_Q20481_13_287_3.40.50.1220 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;TPP-binding domain | 0.7248 | 80 | 118 | 3.40.50.1220 |
| 1t0bA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.6962 | 31 | 287 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4R8DGN2-F1-model_v4 | Trehalose utilization protein | 0.9882 | 30 | 280 |
|
| AF-A0A4Q3SNT1-F1-model_v4 | ThuA domain-containing protein | 0.9877 | 30 | 279 |
|
| AF-A0A4Q3PAI9-F1-model_v4 | deleted | 0.9848 | 74 | 276 |
|
| AF-A0A5B0FSI8-F1-model_v4 | ThuA domain-containing protein | 0.9791 | 21 | 279 |
|
| AF-A0A7Y0FLB7-F1-model_v4 | ThuA domain-containing protein | 0.9777 | 21 | 279 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar