F414951

General Info

Members Datasets Scaffolds Average Seq Length
341 237 682 187

Family's Representative Sequence

Representative Sequence 3300053154|Ga0500619_097709|Ga0500619_097709_25_696
Length 223
Sequence LLGCRPSVRNNNRLWLWVPDLRSLMLACPGRERERPDVPHYTKTDFPVDNVRRFLEPGPVVLVSSAHRNETNIMTMGWHMVVEFQPSLISCVISSANHSFEMIRKSRQCVINVPTVDLAAKVVKIGNCSGRDVDKFAEFDLTAKAAVQVRAPLIEECYANFECVLVDASQVNKYNVFIFEVVQAHVATAPKYPKTIHYRGDGEFMISGENTRRYRKLFRPEML

Samples

Sample ID Description Type Environment
1 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
89 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
131 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
132 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
133 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
134 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
135 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
136 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
141 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
145 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
146 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
149 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
150 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
154 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
155 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
156 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
174 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
175 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
176 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
191 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
192 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
200 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
201 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
202 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
203 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
204 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
205 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
215 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
218 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
219 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
220 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
224 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
227 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
228 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
229 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
230 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
231 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
232 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
233 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
234 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
235 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
236 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
237 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.48
Metatranscriptomes 0
Isolates 3.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.44
Nodule 2.05
Rhizoplane 2.93
Rhizosphere 77.13
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500619_097709 3300053154 Bacteria 995
2 JGI25153J46596_10082764 3300003215 Bacteria 795
3 Ga0055539_1000958 3300003752 Bacteria 6383
4 Ga0055524_1007453 3300003775 Bacteria 4643
5 Ga0065715_10547482 3300005293 Unclassified 743
6 Ga0070690_100095083 3300005330 Bacteria 1967
7 Ga0070670_100003589 3300005331 Bacteria 12907
8 Ga0068869_100002483 3300005334 Bacteria 11121
9 Ga0070666_10375691 3300005335 Unclassified 1020
10 Ga0068868_100406314 3300005338 Bacteria 1176
11 Ga0068868_100507232 3300005338 Bacteria 1057
12 Ga0070687_100009275 3300005343 Bacteria 4210
13 Ga0070687_100299715 3300005343 Unclassified 1019
14 Ga0070668_100002788 3300005347 Bacteria 12856
15 Ga0070669_100085525 3300005353 Bacteria 2355
16 Ga0070669_100192588 3300005353 Bacteria 1600
17 Ga0070675_100014408 3300005354 Bacteria 6234
18 Ga0070675_100046047 3300005354 Bacteria 3571
19 Ga0070675_100099062 3300005354 Bacteria 2453
20 Ga0070675_100946682 3300005354 Unclassified 790
21 Ga0070674_100016475 3300005356 Bacteria 4633
22 Ga0070674_100029507 3300005356 Bacteria 3614
23 Ga0070673_100015830 3300005364 Bacteria 5311
24 Ga0070673_100043949 3300005364 Bacteria 3456
25 Ga0070667_100005969 3300005367 Bacteria 10121
26 Ga0070705_100050352 3300005440 Bacteria 2423
27 Ga0070700_100015766 3300005441 Bacteria 4292
28 Ga0070694_100405191 3300005444 Bacteria 1068
29 Ga0070663_100237971 3300005455 Bacteria 1436
30 Ga0070678_100041926 3300005456 Bacteria 3249
31 Ga0070678_100065050 3300005456 Bacteria 2705
32 Ga0070678_100241099 3300005456 Bacteria 1512
33 Ga0070662_100914322 3300005457 Bacteria 749
34 Ga0070681_10924150 3300005458 Bacteria 791
35 Ga0068867_100001479 3300005459 Bacteria 16259
36 Ga0068867_100012011 3300005459 Bacteria 6116
37 Ga0068867_100689797 3300005459 Bacteria 900
38 Ga0070699_100421239 3300005518 Bacteria 1208
39 Ga0070672_100148207 3300005543 Bacteria 1940
40 Ga0070672_100209173 3300005543 Bacteria 1633
41 Ga0070686_100498781 3300005544 Bacteria 944
42 Ga0070696_100070285 3300005546 Bacteria 2462
43 Ga0070704_100334339 3300005549 Bacteria 1273
44 Ga0068855_100012375 3300005563 Bacteria 10306
45 Ga0068855_100128773 3300005563 Bacteria 2892
46 Ga0070664_100027183 3300005564 Bacteria 4753
47 Ga0070664_100120363 3300005564 Bacteria 2298
48 Ga0068857_100135996 3300005577 Bacteria 2219
49 Ga0068854_100203928 3300005578 Bacteria 1556
50 Ga0070702_100173754 3300005615 Bacteria 1404
51 Ga0068859_100993572 3300005617 Unclassified 921
52 Ga0068864_100024464 3300005618 Bacteria 5081
53 Ga0068864_100032476 3300005618 Bacteria 4436
54 Ga0068866_10010310 3300005718 Bacteria 4002
55 Ga0068861_100039256 3300005719 Bacteria 3532
56 Ga0068861_100041404 3300005719 Bacteria 3450
57 Ga0068861_100060871 3300005719 Bacteria 2895
58 Ga0068870_10091821 3300005840 Bacteria 1699
59 Ga0068863_100013827 3300005841 Bacteria 7780
60 Ga0068863_100098082 3300005841 Unclassified 2783
61 Ga0068863_100253741 3300005841 Bacteria 1699
62 Ga0068863_101461257 3300005841 Bacteria 692
63 Ga0068858_100064260 3300005842 Bacteria 3396
64 Ga0068860_100037433 3300005843 Bacteria 4645
65 Ga0068860_100186002 3300005843 Bacteria 2009
66 Ga0068860_100438905 3300005843 Bacteria 1296
67 Ga0068862_100020695 3300005844 Bacteria 5497
68 Ga0068862_101049092 3300005844 Bacteria 808
69 Ga0081455_10000022 3300005937 Bacteria 159620
70 Ga0081455_10042370 3300005937 Bacteria 3994
71 Ga0075363_100009485 3300006048 Bacteria 4576
72 Ga0075363_100026290 3300006048 Bacteria 2977
73 Ga0075364_10039654 3300006051 Bacteria 3054
74 Ga0075367_10091169 3300006178 Bacteria 1854
75 Ga0075366_10174776 3300006195 Bacteria 1304
76 Ga0097621_100718693 3300006237 Bacteria 921
77 Ga0068871_100267692 3300006358 Bacteria 1492
78 Ga0068871_100827291 3300006358 Bacteria 855
79 Ga0075431_100000777 3300006847 Bacteria 27728
80 Ga0075431_100484402 3300006847 Bacteria 1229
81 Ga0075433_10153745 3300006852 Bacteria 2046
82 Ga0075433_10589441 3300006852 Unclassified 976
83 Ga0075434_100195499 3300006871 Unclassified 2042
84 Ga0075429_100160414 3300006880 Bacteria 1969
85 Ga0068865_100067090 3300006881 Bacteria 2533
86 Ga0097620_100993571 3300006931 Unclassified 921
87 Ga0105240_10127234 3300009093 Bacteria 3060
88 Ga0111539_10000752 3300009094 Bacteria 42122
89 Ga0105247_10038959 3300009101 Bacteria 2903
90 Ga0114129_10000243 3300009147 Bacteria 61230
91 Ga0114129_10382016 3300009147 Unclassified 1860
92 Ga0114129_10386771 3300009147 Bacteria 1846
93 Ga0105243_10225359 3300009148 Bacteria 1660
94 Ga0105243_10299451 3300009148 Unclassified 1457
95 Ga0105241_11470793 3300009174 Bacteria 655
96 Ga0105242_10012208 3300009176 Bacteria 6612
97 Ga0105242_11122656 3300009176 Bacteria 801
98 Ga0105248_10068090 3300009177 Bacteria 3997
99 Ga0105237_10203978 3300009545 Bacteria 1978
100 Ga0105238_10146344 3300009551 Bacteria 2339
101 Ga0105249_10626075 3300009553 Bacteria 1132
102 Ga0105239_10764771 3300010375 Unclassified 1106
103 Ga0105246_10188010 3300011119 Bacteria 1596
104 Ga0105246_11073762 3300011119 Unclassified 733
105 Ga0157370_10258068 3300013104 Unclassified 1611
106 Ga0157374_10002710 3300013296 Bacteria 14898
107 Ga0157378_10107633 3300013297 Bacteria 2551
108 Ga0157378_10443673 3300013297 Bacteria 1287
109 Ga0163162_12055166 3300013306 Bacteria 655
110 Ga0157372_10350433 3300013307 Bacteria 1720
111 Ga0157375_10499638 3300013308 Unclassified 1380
112 Ga0163163_10006608 3300014325 Bacteria 10155
113 Ga0163163_10074366 3300014325 Bacteria 3389
114 Ga0163163_10097204 3300014325 Bacteria 2965
115 Ga0157380_10024981 3300014326 Bacteria 4527
116 Ga0157380_10195281 3300014326 Bacteria 1791
117 Ga0157377_10015353 3300014745 Bacteria 3916
118 Ga0157379_10000542 3300014968 Bacteria 30483
119 Ga0157379_10161526 3300014968 Bacteria 2022
120 Ga0157376_10032759 3300014969 Bacteria 4176
121 Ga0157376_10679145 3300014969 Bacteria 1033
122 Ga0157376_11540010 3300014969 Bacteria 698
123 Ga0163161_10270466 3300017792 Bacteria 1330
124 Ga0213876_10031832 3300021384 Bacteria 2782
125 Ga0213876_10089741 3300021384 Bacteria 1628
126 Ga0209563_103091 3300025230 Bacteria 3532
127 Ga0209677_101711 3300025253 Bacteria 9125
128 Ga0209676_1021043 3300025292 Bacteria 2199
129 Ga0209025_1025776 3300025294 Bacteria 2978
130 Ga0209758_1018506 3300025297 Bacteria 3408
131 Ga0209256_1000547 3300025299 Bacteria 53996
132 Ga0207682_10170299 3300025893 Bacteria 990
133 Ga0207642_10008278 3300025899 Bacteria 3557
134 Ga0207710_10017771 3300025900 Bacteria 3018
135 Ga0207645_10083046 3300025907 Bacteria 2054
136 Ga0207645_10571865 3300025907 Bacteria 767
137 Ga0207643_10256624 3300025908 Bacteria 1078
138 Ga0207707_10184518 3300025912 Bacteria 1821
139 Ga0207662_10058051 3300025918 Bacteria 2315
140 Ga0207662_10071579 3300025918 Bacteria 2100
141 Ga0207650_10002282 3300025925 Bacteria 13376
142 Ga0207650_10085887 3300025925 Bacteria 2394
143 Ga0207659_10022007 3300025926 Bacteria 4240
144 Ga0207644_10203702 3300025931 Bacteria 1562
145 Ga0207706_10668204 3300025933 Bacteria 889
146 Ga0207686_10171050 3300025934 Bacteria 1532
147 Ga0207686_10421685 3300025934 Bacteria 1021
148 Ga0207669_10011110 3300025937 Bacteria 4368
149 Ga0207704_10039207 3300025938 Bacteria 2756
150 Ga0207691_10065237 3300025940 Bacteria 3297
151 Ga0207691_10222846 3300025940 Bacteria 1635
152 Ga0207691_10354447 3300025940 Bacteria 1255
153 Ga0207711_10015257 3300025941 Bacteria 6378
154 Ga0207689_10012582 3300025942 Bacteria 7229
155 Ga0207679_10191347 3300025945 Bacteria 1701
156 Ga0207667_10145369 3300025949 Bacteria 2441
157 Ga0207667_10321538 3300025949 Bacteria 1580
158 Ga0207651_10025498 3300025960 Bacteria 3675
159 Ga0207712_11103751 3300025961 Bacteria 706
160 Ga0207668_10073541 3300025972 Bacteria 2450
161 Ga0207668_10087307 3300025972 Bacteria 2281
162 Ga0207668_10739092 3300025972 Bacteria 867
163 Ga0207658_10082167 3300025986 Bacteria 2473
164 Ga0207658_10784119 3300025986 Bacteria 865
165 Ga0207677_10495536 3300026023 Bacteria 1055
166 Ga0207677_10825809 3300026023 Bacteria 831
167 Ga0207703_10000552 3300026035 Bacteria 38477
168 Ga0207678_10261878 3300026067 Bacteria 1482
169 Ga0207708_10008708 3300026075 Bacteria 7512
170 Ga0207641_10071273 3300026088 Bacteria 2989
171 Ga0207641_10839046 3300026088 Unclassified 910
172 Ga0207648_10000406 3300026089 Bacteria 47912
173 Ga0207648_10004793 3300026089 Bacteria 13810
174 Ga0207648_10024775 3300026089 Bacteria 5353
175 Ga0207648_10306559 3300026089 Bacteria 1425
176 Ga0207648_10796477 3300026089 Bacteria 879
177 Ga0207676_10052257 3300026095 Bacteria 3193
178 Ga0207674_10138144 3300026116 Bacteria 2398
179 Ga0207675_100003012 3300026118 Bacteria 16522
180 Ga0207675_100030165 3300026118 Bacteria 5050
181 Ga0207675_100115878 3300026118 Bacteria 2532
182 Ga0207675_100888445 3300026118 Bacteria 907
183 Ga0207683_10154107 3300026121 Bacteria 2075
184 Ga0207683_10267636 3300026121 Bacteria 1561
185 Ga0207428_10040910 3300027907 Bacteria 3754
186 Ga0268265_10117714 3300028380 Bacteria 2183
187 Ga0268265_10357966 3300028380 Bacteria 1335
188 Ga0268264_10000940 3300028381 Bacteria 30212
189 Ga0268264_10042213 3300028381 Bacteria 3776
190 Ga0268264_10420204 3300028381 Bacteria 1289
191 Ga0307513_10466978 3300031456 Bacteria 984
192 Ga0373937_0461960 3300036401 Bacteria 1206
193 Ga0395905_0045400 3300037471 Bacteria 4121
194 Ga0395905_0276223 3300037471 Bacteria 1566
195 Ga0395905_0294405 3300037471 Bacteria 1510
196 Ga0436365_1870797 3300039437 Bacteria 11660
197 Ga0451807_2112856 3300041486 Bacteria 2934
198 Ga0439431_0015571 3300041997 Bacteria 1771
199 Ga0439437_000235 3300042000 Bacteria 4962
200 Ga0450911_000005 3300042115 Bacteria 233469
201 Ga0439446_0005793 3300042156 Bacteria 3194
202 Ga0439459_0090037 3300042438 Bacteria 737
203 Ga0451577_0643215 3300042876 Bacteria 962
204 Ga0466960_0103441 3300044901 Bacteria 1470
205 Ga0495603_0329272 3300046455 Bacteria 877
206 Ga0495653_0178656 3300046463 Bacteria 1459
207 Ga0495584_0016159 3300046491 Bacteria 3806
208 Ga0495584_0120407 3300046491 Bacteria 1329
209 Ga0495616_0050849 3300046513 Bacteria 2070
210 Ga0495632_0054676 3300046519 Bacteria 1956
211 Ga0495652_0248181 3300046529 Bacteria 1320
212 Ga0495609_0000184 3300046538 Bacteria 63327
213 Ga0495621_0059445 3300046539 Bacteria 1385
214 Ga0495633_0002349 3300046558 Bacteria 13408
215 Ga0495656_0413681 3300046615 Bacteria 707
216 Ga0495625_0000310 3300046660 Bacteria 74325
217 Ga0495635_0074871 3300046663 Bacteria 2319
218 Ga0495661_0041315 3300046665 Bacteria 2854
219 Ga0495588_0085335 3300046674 Bacteria 1651
220 Ga0495657_0459403 3300046675 Bacteria 745
221 Ga0495658_0014593 3300046683 Bacteria 4017
222 Ga0495613_0049279 3300046689 Bacteria 3109
223 Ga0495624_0155560 3300046690 Bacteria 1397
224 Ga0495649_0311437 3300046694 Bacteria 800
225 Ga0495604_0005812 3300047317 Bacteria 9784
226 Ga0495676_0213383 3300047321 Bacteria 1334
227 Ga0495677_0158498 3300047445 Bacteria 873
228 Ga0495686_0000190 3300047472 Bacteria 115114
229 Ga0495686_0051447 3300047472 Bacteria 2585
230 Ga0495686_0261264 3300047472 Bacteria 969
231 Ga0496102_0007268 3300048905 Bacteria 9454
232 Ga0496104_0365383 3300048907 Bacteria 1355
233 Ga0496104_0440944 3300048907 Unclassified 1214
234 Ga0496105_0019630 3300048908 Bacteria 5453
235 Ga0496107_0874140 3300048910 Unclassified 656
236 Ga0496110_0001234 3300048913 Bacteria 18261
237 Ga0496113_0145993 3300048916 Bacteria 1864
238 Ga0496115_0315776 3300048918 Bacteria 1279
239 Ga0496115_0457578 3300048918 Bacteria 1030
240 Ga0496117_0224993 3300048920 Bacteria 1041
241 Ga0496118_0046680 3300048921 Bacteria 3366
242 Ga0496119_0015088 3300048922 Bacteria 5981
243 Ga0496119_0073561 3300048922 Bacteria 1993
244 Ga0496120_0169713 3300048923 Bacteria 1080
245 Ga0496121_0002920 3300048924 Bacteria 25047
246 Ga0496121_0014951 3300048924 Bacteria 8175
247 Ga0496122_0069524 3300048925 Bacteria 2521
248 Ga0496124_0000003 3300048927 Bacteria 1300161
249 Ga0496125_0100309 3300048928 Bacteria 2135
250 Ga0496126_0014958 3300048929 Bacteria 7822
251 Ga0496126_0029638 3300048929 Bacteria 5196
252 Ga0496126_0036375 3300048929 Bacteria 4604
253 Ga0496126_0488626 3300048929 Bacteria 985
254 Ga0496126_0995535 3300048929 Bacteria 629
255 Ga0501031_0798492 3300049568 Bacteria 605
256 Ga0501034_0014579 3300049571 Bacteria 8092
257 Ga0501034_0072887 3300049571 Bacteria 3443
258 Ga0501036_0350916 3300049572 Bacteria 1232
259 Ga0501037_0012629 3300049573 Bacteria 6223
260 Ga0501038_0139461 3300049574 Bacteria 1985
261 Ga0501039_0065394 3300049575 Bacteria 2821
262 Ga0501040_0623003 3300049576 Bacteria 780
263 Ga0501047_0296320 3300049581 Bacteria 1460
264 Ga0501067_0008899 3300049583 Bacteria 5562
265 Ga0501069_0015211 3300049585 Bacteria 4123
266 Ga0501069_0335060 3300049585 Bacteria 890
267 Ga0501070_0029468 3300049586 Bacteria 4601
268 Ga0501070_0041000 3300049586 Bacteria 3857
269 Ga0501070_0122710 3300049586 Bacteria 2147
270 Ga0501070_0381389 3300049586 Bacteria 1142
271 Ga0501073_0033834 3300049589 Bacteria 3637
272 Ga0501074_0001855 3300049590 Bacteria 14501
273 Ga0501074_0018552 3300049590 Bacteria 5053
274 Ga0501076_0253334 3300049592 Bacteria 1441
275 Ga0501076_0334009 3300049592 Bacteria 1243
276 Ga0501077_0037220 3300049593 Bacteria 3100
277 Ga0501077_0040200 3300049593 Bacteria 2980
278 Ga0501219_005273 3300049703 Bacteria 919
279 Ga0501080_0035007 3300049742 Bacteria 4689
280 Ga0501080_0649935 3300049742 Bacteria 933
281 Ga0501081_0732096 3300049743 Bacteria 743
282 Ga0501083_0039070 3300049744 Bacteria 3224
283 Ga0501083_0062742 3300049744 Bacteria 2479
284 Ga0501083_0105121 3300049744 Bacteria 1859
285 Ga0501241_008780 3300049758 Bacteria 1843
286 Ga0501044_0091297 3300049823 Bacteria 3072
287 Ga0501044_0191258 3300049823 Bacteria 2009
288 Ga0501045_0054587 3300049824 Bacteria 2921
289 Ga0501045_0092651 3300049824 Bacteria 2235
290 Ga0501284_00088 3300050005 Bacteria 22558
291 nmdc:mga03n38_14744_c1 3300050490 Bacteria 3003
292 nmdc:mga0k408_27467_c1 3300050493 Bacteria 3232
293 nmdc:mga06z11_596369_c1 3300050494 Bacteria 672
294 nmdc:mga04h51_11171_c2 3300050495 Bacteria 2067
295 nmdc:mga05p37_260_c1 3300050507 Bacteria 54707
296 nmdc:mga05p37_764412_c1 3300050507 Bacteria 1063
297 nmdc:mga05p37_769218_c1 3300050507 Bacteria 1058
298 nmdc:mga09592_33993_c2 3300050508 Bacteria 1995
299 nmdc:mga06r32_1981_c1 3300050510 Bacteria 18290
300 nmdc:mga06r32_215702_c1 3300050510 Unclassified 1907
301 nmdc:mga08y16_86_c1 3300050511 Bacteria 78136
302 nmdc:mga0n895_129277_c1 3300050512 Bacteria 2550
303 nmdc:mga0n895_359769_c1 3300050512 Bacteria 1474
304 nmdc:mga0a205_397084_c1 3300050515 Unclassified 1243
305 nmdc:mga0a205_548724_c1 3300050515 Unclassified 1011
306 Ga0500583_0000310 3300053092 Bacteria 16685
307 Ga0500583_0001876 3300053092 Bacteria 6147
308 Ga0500566_0027185 3300053094 Bacteria 3348
309 Ga0500641_0005495 3300053096 Bacteria 4488
310 Ga0500641_0008563 3300053096 Bacteria 3655
311 Ga0500593_001264 3300053117 Bacteria 9144
312 Ga0500595_000589 3300053119 Bacteria 21663
313 Ga0500655_048668 3300053133 Bacteria 842
314 Ga0500559_0062698 3300053136 Bacteria 1660
315 Ga0500559_0148752 3300053136 Bacteria 1098
316 Ga0500568_0000005 3300053139 Bacteria 614296
317 Ga0500568_0014774 3300053139 Bacteria 3514
318 Ga0500568_0081347 3300053139 Bacteria 1229
319 Ga0500573_0021001 3300053140 Bacteria 3740
320 Ga0500639_212629 3300053163 Bacteria 817
321 Ga0500636_0139888 3300053177 Bacteria 1340
322 Ga0500645_044185 3300053730 Bacteria 1311
323 Ga0500596_010628 3300053735 Bacteria 1418
324 Ga0500596_070612 3300053735 Bacteria 596
325 Ga0501084_0001177 3300054114 Bacteria 20422
326 Ga0501084_0027790 3300054114 Bacteria 4727
327 Ga0501084_0187544 3300054114 Bacteria 1745
328 Ga0500661_058363 3300055283 Bacteria 695
329 Ga0501082_0547785 3300060353 Bacteria 1012
330 2511387376 2511231026 Bacteria 5225445
331 2513671798 2513237098 Bacteria 9902361
332 2588234256 2585428187 Bacteria 4629388
333 2849083278 2849076700 Bacteria 7039503
334 2885388432 2885383462 Bacteria 9473874
335 2888390433 2888388044 Bacteria 7304136
336 2903774874 2903768456 Bacteria 9749579
337 2935778266 2935777560 Bacteria 8077691
338 8016618197 8016613128 Bacteria 8794220
339 8019540255 8019538911 Bacteria 7872763
340 8056687334 8056681323 Bacteria 8472857
341 8056975782 8056967851 Bacteria 9038162
342 Ga0500619_097709
343 JGI25153J46596_10082764
344 Ga0055539_1000958
345 Ga0055524_1007453
346 Ga0065715_10547482
347 Ga0070690_100095083
348 Ga0070670_100003589
349 Ga0068869_100002483
350 Ga0070666_10375691
351 Ga0068868_100406314
352 Ga0068868_100507232
353 Ga0070687_100009275
354 Ga0070687_100299715
355 Ga0070668_100002788
356 Ga0070669_100085525
357 Ga0070669_100192588
358 Ga0070675_100014408
359 Ga0070675_100046047
360 Ga0070675_100099062
361 Ga0070675_100946682
362 Ga0070674_100016475
363 Ga0070674_100029507
364 Ga0070673_100015830
365 Ga0070673_100043949
366 Ga0070667_100005969
367 Ga0070705_100050352
368 Ga0070700_100015766
369 Ga0070694_100405191
370 Ga0070663_100237971
371 Ga0070678_100041926
372 Ga0070678_100065050
373 Ga0070678_100241099
374 Ga0070662_100914322
375 Ga0070681_10924150
376 Ga0068867_100001479
377 Ga0068867_100012011
378 Ga0068867_100689797
379 Ga0070699_100421239
380 Ga0070672_100148207
381 Ga0070672_100209173
382 Ga0070686_100498781
383 Ga0070696_100070285
384 Ga0070704_100334339
385 Ga0068855_100012375
386 Ga0068855_100128773
387 Ga0070664_100027183
388 Ga0070664_100120363
389 Ga0068857_100135996
390 Ga0068854_100203928
391 Ga0070702_100173754
392 Ga0068859_100993572
393 Ga0068864_100024464
394 Ga0068864_100032476
395 Ga0068866_10010310
396 Ga0068861_100039256
397 Ga0068861_100041404
398 Ga0068861_100060871
399 Ga0068870_10091821
400 Ga0068863_100013827
401 Ga0068863_100098082
402 Ga0068863_100253741
403 Ga0068863_101461257
404 Ga0068858_100064260
405 Ga0068860_100037433
406 Ga0068860_100186002
407 Ga0068860_100438905
408 Ga0068862_100020695
409 Ga0068862_101049092
410 Ga0081455_10000022
411 Ga0081455_10042370
412 Ga0075363_100009485
413 Ga0075363_100026290
414 Ga0075364_10039654
415 Ga0075367_10091169
416 Ga0075366_10174776
417 Ga0097621_100718693
418 Ga0068871_100267692
419 Ga0068871_100827291
420 Ga0075431_100000777
421 Ga0075431_100484402
422 Ga0075433_10153745
423 Ga0075433_10589441
424 Ga0075434_100195499
425 Ga0075429_100160414
426 Ga0068865_100067090
427 Ga0097620_100993571
428 Ga0105240_10127234
429 Ga0111539_10000752
430 Ga0105247_10038959
431 Ga0114129_10000243
432 Ga0114129_10382016
433 Ga0114129_10386771
434 Ga0105243_10225359
435 Ga0105243_10299451
436 Ga0105241_11470793
437 Ga0105242_10012208
438 Ga0105242_11122656
439 Ga0105248_10068090
440 Ga0105237_10203978
441 Ga0105238_10146344
442 Ga0105249_10626075
443 Ga0105239_10764771
444 Ga0105246_10188010
445 Ga0105246_11073762
446 Ga0157370_10258068
447 Ga0157374_10002710
448 Ga0157378_10107633
449 Ga0157378_10443673
450 Ga0163162_12055166
451 Ga0157372_10350433
452 Ga0157375_10499638
453 Ga0163163_10006608
454 Ga0163163_10074366
455 Ga0163163_10097204
456 Ga0157380_10024981
457 Ga0157380_10195281
458 Ga0157377_10015353
459 Ga0157379_10000542
460 Ga0157379_10161526
461 Ga0157376_10032759
462 Ga0157376_10679145
463 Ga0157376_11540010
464 Ga0163161_10270466
465 Ga0213876_10031832
466 Ga0213876_10089741
467 Ga0209563_103091
468 Ga0209677_101711
469 Ga0209676_1021043
470 Ga0209025_1025776
471 Ga0209758_1018506
472 Ga0209256_1000547
473 Ga0207682_10170299
474 Ga0207642_10008278
475 Ga0207710_10017771
476 Ga0207645_10083046
477 Ga0207645_10571865
478 Ga0207643_10256624
479 Ga0207707_10184518
480 Ga0207662_10058051
481 Ga0207662_10071579
482 Ga0207650_10002282
483 Ga0207650_10085887
484 Ga0207659_10022007
485 Ga0207644_10203702
486 Ga0207706_10668204
487 Ga0207686_10171050
488 Ga0207686_10421685
489 Ga0207669_10011110
490 Ga0207704_10039207
491 Ga0207691_10065237
492 Ga0207691_10222846
493 Ga0207691_10354447
494 Ga0207711_10015257
495 Ga0207689_10012582
496 Ga0207679_10191347
497 Ga0207667_10145369
498 Ga0207667_10321538
499 Ga0207651_10025498
500 Ga0207712_11103751
501 Ga0207668_10073541
502 Ga0207668_10087307
503 Ga0207668_10739092
504 Ga0207658_10082167
505 Ga0207658_10784119
506 Ga0207677_10495536
507 Ga0207677_10825809
508 Ga0207703_10000552
509 Ga0207678_10261878
510 Ga0207708_10008708
511 Ga0207641_10071273
512 Ga0207641_10839046
513 Ga0207648_10000406
514 Ga0207648_10004793
515 Ga0207648_10024775
516 Ga0207648_10306559
517 Ga0207648_10796477
518 Ga0207676_10052257
519 Ga0207674_10138144
520 Ga0207675_100003012
521 Ga0207675_100030165
522 Ga0207675_100115878
523 Ga0207675_100888445
524 Ga0207683_10154107
525 Ga0207683_10267636
526 Ga0207428_10040910
527 Ga0268265_10117714
528 Ga0268265_10357966
529 Ga0268264_10000940
530 Ga0268264_10042213
531 Ga0268264_10420204
532 Ga0307513_10466978
533 Ga0373937_0461960
534 Ga0395905_0045400
535 Ga0395905_0276223
536 Ga0395905_0294405
537 Ga0436365_1870797
538 Ga0451807_2112856
539 Ga0439431_0015571
540 Ga0439437_000235
541 Ga0450911_000005
542 Ga0439446_0005793
543 Ga0439459_0090037
544 Ga0451577_0643215
545 Ga0466960_0103441
546 Ga0495603_0329272
547 Ga0495653_0178656
548 Ga0495584_0016159
549 Ga0495584_0120407
550 Ga0495616_0050849
551 Ga0495632_0054676
552 Ga0495652_0248181
553 Ga0495609_0000184
554 Ga0495621_0059445
555 Ga0495633_0002349
556 Ga0495656_0413681
557 Ga0495625_0000310
558 Ga0495635_0074871
559 Ga0495661_0041315
560 Ga0495588_0085335
561 Ga0495657_0459403
562 Ga0495658_0014593
563 Ga0495613_0049279
564 Ga0495624_0155560
565 Ga0495649_0311437
566 Ga0495604_0005812
567 Ga0495676_0213383
568 Ga0495677_0158498
569 Ga0495686_0000190
570 Ga0495686_0051447
571 Ga0495686_0261264
572 Ga0496102_0007268
573 Ga0496104_0365383
574 Ga0496104_0440944
575 Ga0496105_0019630
576 Ga0496107_0874140
577 Ga0496110_0001234
578 Ga0496113_0145993
579 Ga0496115_0315776
580 Ga0496115_0457578
581 Ga0496117_0224993
582 Ga0496118_0046680
583 Ga0496119_0015088
584 Ga0496119_0073561
585 Ga0496120_0169713
586 Ga0496121_0002920
587 Ga0496121_0014951
588 Ga0496122_0069524
589 Ga0496124_0000003
590 Ga0496125_0100309
591 Ga0496126_0014958
592 Ga0496126_0029638
593 Ga0496126_0036375
594 Ga0496126_0488626
595 Ga0496126_0995535
596 Ga0501031_0798492
597 Ga0501034_0014579
598 Ga0501034_0072887
599 Ga0501036_0350916
600 Ga0501037_0012629
601 Ga0501038_0139461
602 Ga0501039_0065394
603 Ga0501040_0623003
604 Ga0501047_0296320
605 Ga0501067_0008899
606 Ga0501069_0015211
607 Ga0501069_0335060
608 Ga0501070_0029468
609 Ga0501070_0041000
610 Ga0501070_0122710
611 Ga0501070_0381389
612 Ga0501073_0033834
613 Ga0501074_0001855
614 Ga0501074_0018552
615 Ga0501076_0253334
616 Ga0501076_0334009
617 Ga0501077_0037220
618 Ga0501077_0040200
619 Ga0501219_005273
620 Ga0501080_0035007
621 Ga0501080_0649935
622 Ga0501081_0732096
623 Ga0501083_0039070
624 Ga0501083_0062742
625 Ga0501083_0105121
626 Ga0501241_008780
627 Ga0501044_0091297
628 Ga0501044_0191258
629 Ga0501045_0054587
630 Ga0501045_0092651
631 Ga0501284_00088
632 nmdc:mga03n38_14744_c1
633 nmdc:mga0k408_27467_c1
634 nmdc:mga06z11_596369_c1
635 nmdc:mga04h51_11171_c2
636 nmdc:mga05p37_260_c1
637 nmdc:mga05p37_764412_c1
638 nmdc:mga05p37_769218_c1
639 nmdc:mga09592_33993_c2
640 nmdc:mga06r32_1981_c1
641 nmdc:mga06r32_215702_c1
642 nmdc:mga08y16_86_c1
643 nmdc:mga0n895_129277_c1
644 nmdc:mga0n895_359769_c1
645 nmdc:mga0a205_397084_c1
646 nmdc:mga0a205_548724_c1
647 Ga0500583_0000310
648 Ga0500583_0001876
649 Ga0500566_0027185
650 Ga0500641_0005495
651 Ga0500641_0008563
652 Ga0500593_001264
653 Ga0500595_000589
654 Ga0500655_048668
655 Ga0500559_0062698
656 Ga0500559_0148752
657 Ga0500568_0000005
658 Ga0500568_0014774
659 Ga0500568_0081347
660 Ga0500573_0021001
661 Ga0500639_212629
662 Ga0500636_0139888
663 Ga0500645_044185
664 Ga0500596_010628
665 Ga0500596_070612
666 Ga0501084_0001177
667 Ga0501084_0027790
668 Ga0501084_0187544
669 Ga0500661_058363
670 Ga0501082_0547785
671 2511387376
672 2513671798
673 2588234256
674 2849083278
675 2885388432
676 2888390433
677 2903774874
678 2935778266
679 8016618197
680 8019540255
681 8056687334
682 8056975782

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01613

Flavin_Reduct

Flavin reductase like domain

52

203

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9589 7 180
3e4v-assembly1.cif.gz_B crystal structure of nadh:fmn oxidoreductase like protein in complex with fmn (yp_544701.1) from methylobacillus flagellatus kt at 1.40 a resolution 0.9277 7 180
3hmz-assembly1.cif.gz_A-2 crystal structure of a fmn-binding domain of flavin reductases-like enzyme (sbal_0626) from shewanella baltica os155 at 1.50 a resolution 0.9085 1 174
1i0s-assembly1.cif.gz_A archaeoglobus fulgidus ferric reductase complex with nadp+ 0.9056 22 149
2d5m-assembly1.cif.gz_A-2 flavoredoxin of desulfovibrio vulgaris (miyazaki f) 0.9047 22 174
ID Description Score Start End Superfamily
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9432 7 174 2.30.110.10
af_P76121_1_188_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9342 6 174 2.30.110.10
3e4vB01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9109 7 174 2.30.110.10
1i0sA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9056 22 149 2.30.110.10
2d5mA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.9047 22 174 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A653UQ58-F1-model_v4 deleted 0.9984 2 160
AF-A0A7Y2K599-F1-model_v4 Flavin reductase family protein 0.9938 4 171 GO:0010181
GO:0016646
AF-A0A381H151-F1-model_v4 deleted 0.9919 2 170
AF-A0A258SKZ0-F1-model_v4 Flavin reductase 0.9913 5 149 GO:0010181
GO:0016646
AF-K2DLI3-F1-model_v4 Flavin reductase protein 0.9897 5 161 GO:0010181
GO:0016646

Map