F414980

General Info

Members Datasets Scaffolds Average Seq Length
341 192 682 72

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8055412473|8055413411
Length 66
Sequence LTVKEAAARLGTTERFPRRLIAERRIRYVKLGGSHVRIPESALAEFIASGVVEPVTVSWSGGKVVA

Samples

Sample ID Description Type Environment
1 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
2 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
7 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
12 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
13 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
35 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
43 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
44 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
61 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
62 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
63 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
66 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
70 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
74 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
75 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
76 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
77 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
78 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
79 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
80 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
82 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
89 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
90 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
91 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
92 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
93 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
94 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
95 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
96 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
97 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
98 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
99 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
100 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
101 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
105 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
106 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
107 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
108 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
112 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
113 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
114 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
115 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
116 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
122 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
123 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
130 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
131 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
132 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
133 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
134 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
135 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
136 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
137 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
138 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
141 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
144 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
145 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
146 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
147 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
162 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
163 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
164 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
177 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
180 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
181 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
183 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
184 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
185 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
186 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
187 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
188 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
189 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
190 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
191 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
192 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.07
Metatranscriptomes 0
Isolates 2.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.29
Nodule 0.29
Rhizoplane 2.05
Rhizosphere 94.43
Stem 0
Stem Tuber 0
Unclassified 13.78

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070682_101959184 3300005337 Bacteria 514
2 Ga0070674_100388695 3300005356 Bacteria 1137
3 Ga0070709_10031113 3300005434 Bacteria 3208
4 Ga0070709_10794535 3300005434 Unclassified 742
5 Ga0070709_10891246 3300005434 Unclassified 703
6 Ga0070714_100122870 3300005435 Bacteria 2311
7 Ga0070714_101477202 3300005435 Bacteria 664
8 Ga0070714_102494164 3300005435 Bacteria 502
9 Ga0070714_102494707 3300005435 Unclassified 502
10 Ga0070713_100119274 3300005436 Bacteria 2311
11 Ga0070713_100921823 3300005436 Bacteria 841
12 Ga0070713_101275388 3300005436 Bacteria 712
13 Ga0070713_101621597 3300005436 Bacteria 628
14 Ga0070710_10005047 3300005437 Bacteria 6248
15 Ga0070710_10284414 3300005437 Bacteria 1074
16 Ga0070710_10367587 3300005437 Bacteria 956
17 Ga0070710_10550359 3300005437 Bacteria 797
18 Ga0070711_100074702 3300005439 Bacteria 2398
19 Ga0070711_100161795 3300005439 Bacteria 1697
20 Ga0070711_100269972 3300005439 Bacteria 1342
21 Ga0070711_100287195 3300005439 Bacteria 1304
22 Ga0070711_100883432 3300005439 Unclassified 762
23 Ga0070711_101055253 3300005439 Unclassified 699
24 Ga0070708_100000768 3300005445 Bacteria 24119
25 Ga0070708_100015389 3300005445 Bacteria 6317
26 Ga0070708_100126445 3300005445 Bacteria 2363
27 Ga0070706_100134947 3300005467 Bacteria 2304
28 Ga0070706_100258698 3300005467 Bacteria 1625
29 Ga0070706_101573341 3300005467 Bacteria 600
30 Ga0070707_100011408 3300005468 Bacteria 8286
31 Ga0070699_100002369 3300005518 Bacteria 16907
32 Ga0070693_100429158 3300005547 Unclassified 923
33 Ga0068856_100734991 3300005614 Bacteria 1007
34 Ga0070702_101146957 3300005615 Unclassified 623
35 Ga0068866_10147419 3300005718 Bacteria 1359
36 Ga0081455_11043161 3300005937 Bacteria 505
37 Ga0070717_10012264 3300006028 Bacteria 6534
38 Ga0070717_10204017 3300006028 Bacteria 1733
39 Ga0070715_10331384 3300006163 Bacteria 825
40 Ga0070716_100008990 3300006173 Bacteria 4970
41 Ga0070716_101331471 3300006173 Bacteria 581
42 Ga0070712_100015374 3300006175 Bacteria 4928
43 Ga0070712_100147949 3300006175 Bacteria 1800
44 Ga0070712_100529058 3300006175 Bacteria 991
45 Ga0070712_101281393 3300006175 Unclassified 638
46 Ga0070712_101716326 3300006175 Bacteria 550
47 Ga0075428_100365357 3300006844 Bacteria 1548
48 Ga0075430_100672401 3300006846 Unclassified 854
49 Ga0075431_100019042 3300006847 Bacteria 6994
50 Ga0075433_10048620 3300006852 Bacteria 3689
51 Ga0075434_100044999 3300006871 Bacteria 4378
52 Ga0075434_100061327 3300006871 Bacteria 3741
53 Ga0075434_101865430 3300006871 Bacteria 607
54 Ga0075429_100887082 3300006880 Unclassified 781
55 Ga0075436_100630558 3300006914 Bacteria 791
56 Ga0075436_100781339 3300006914 Bacteria 710
57 Ga0075435_100024383 3300007076 Bacteria 4694
58 Ga0075435_100070637 3300007076 Bacteria 2850
59 Ga0075435_101256348 3300007076 Bacteria 648
60 Ga0105240_11913203 3300009093 Unclassified 617
61 Ga0111539_11114282 3300009094 Bacteria 917
62 Ga0105245_10299134 3300009098 Bacteria 1578
63 Ga0105245_10743689 3300009098 Unclassified 1016
64 Ga0114129_10353680 3300009147 Bacteria 1945
65 Ga0114129_13206547 3300009147 Bacteria 532
66 Ga0105243_10064142 3300009148 Bacteria 2946
67 Ga0105243_12237388 3300009148 Unclassified 584
68 Ga0105237_11252447 3300009545 Unclassified 748
69 Ga0105249_10085559 3300009553 Bacteria 2938
70 Ga0105249_13442852 3300009553 Unclassified 509
71 Ga0105246_10213916 3300011119 Bacteria 1506
72 Ga0157369_10426454 3300013105 Bacteria 1375
73 Ga0157378_10403205 3300013297 Bacteria 1348
74 Ga0157378_12201751 3300013297 Unclassified 602
75 Ga0163162_13136343 3300013306 Unclassified 531
76 Ga0157375_10196314 3300013308 Bacteria 2173
77 Ga0157375_10441766 3300013308 Bacteria 1467
78 Ga0157380_11972027 3300014326 Unclassified 645
79 Ga0163161_10159814 3300017792 Bacteria 1718
80 Ga0207426_1022696 3300025302 Bacteria 2150
81 Ga0207692_10020703 3300025898 Bacteria 2997
82 Ga0207692_10097315 3300025898 Bacteria 1609
83 Ga0207642_10024706 3300025899 Bacteria 2420
84 Ga0207642_11117576 3300025899 Unclassified 510
85 Ga0207699_10013323 3300025906 Bacteria 4206
86 Ga0207699_10317197 3300025906 Bacteria 1092
87 Ga0207684_10182857 3300025910 Bacteria 1808
88 Ga0207684_10814284 3300025910 Bacteria 789
89 Ga0207684_11314819 3300025910 Bacteria 595
90 Ga0207693_10017666 3300025915 Bacteria 5687
91 Ga0207693_10097716 3300025915 Bacteria 2303
92 Ga0207693_10209521 3300025915 Bacteria 1532
93 Ga0207693_10297529 3300025915 Bacteria 1264
94 Ga0207693_10467081 3300025915 Bacteria 986
95 Ga0207663_10009627 3300025916 Bacteria 5115
96 Ga0207663_10023947 3300025916 Bacteria 3512
97 Ga0207663_10151059 3300025916 Bacteria 1629
98 Ga0207687_10841185 3300025927 Unclassified 784
99 Ga0207700_10005716 3300025928 Bacteria 7472
100 Ga0207700_10316530 3300025928 Bacteria 1351
101 Ga0207700_10918748 3300025928 Bacteria 783
102 Ga0207700_11342012 3300025928 Bacteria 637
103 Ga0207700_11769861 3300025928 Bacteria 544
104 Ga0207664_10077015 3300025929 Bacteria 2701
105 Ga0207664_10110083 3300025929 Bacteria 2289
106 Ga0207664_11331240 3300025929 Bacteria 638
107 Ga0207644_10946817 3300025931 Bacteria 722
108 Ga0207686_10134160 3300025934 Bacteria 1702
109 Ga0207686_11661102 3300025934 Unclassified 528
110 Ga0207709_10083141 3300025935 Bacteria 2069
111 Ga0207704_11470309 3300025938 Unclassified 584
112 Ga0207665_10002522 3300025939 Bacteria 12316
113 Ga0207712_10091615 3300025961 Bacteria 2240
114 Ga0207675_101632965 3300026118 Unclassified 665
115 Ga0307508_10028141 3300031616 Bacteria 5084
116 Ga0307514_10583923 3300031649 Bacteria 507
117 Ga0307413_11885304 3300031824 Bacteria 537
118 Ga0307406_10361184 3300031901 Bacteria 1138
119 Ga0307409_101338680 3300031995 Bacteria 742
120 Ga0307416_100132347 3300032002 Bacteria 2248
121 Ga0307507_10398929 3300033179 Bacteria 783
122 Ga0373926_0351020 3300035083 Bacteria 579
123 Ga0373934_0000052 3300035086 Bacteria 39557
124 Ga0373934_0000826 3300035086 Bacteria 11176
125 Ga0373944_0163617 3300035089 Bacteria 790
126 Ga0373923_0014184 3300035111 Bacteria 2988
127 Ga0373923_0095959 3300035111 Bacteria 1302
128 Ga0373923_0150176 3300035111 Bacteria 1058
129 Ga0373936_0002592 3300035113 Bacteria 6776
130 Ga0373936_0025544 3300035113 Bacteria 2310
131 Ga0373945_0007176 3300035116 Bacteria 3606
132 Ga0373953_0000049 3300035117 Bacteria 30634
133 Ga0373953_0042185 3300035117 Bacteria 1817
134 Ga0373954_0002010 3300035118 Bacteria 8449
135 Ga0373954_0048285 3300035118 Bacteria 1994
136 Ga0373956_0002102 3300035119 Bacteria 8257
137 Ga0373956_0148284 3300035119 Bacteria 1103
138 Ga0373957_0000096 3300035120 Bacteria 20961
139 Ga0373957_0024479 3300035120 Bacteria 2168
140 Ga0373943_0000655 3300035170 Bacteria 14996
141 Ga0373943_0068659 3300035170 Bacteria 1790
142 Ga0373946_0000492 3300035171 Bacteria 13089
143 Ga0373946_0124913 3300035171 Bacteria 1178
144 Ga0373955_0000313 3300035172 Bacteria 20150
145 Ga0373955_0008903 3300035172 Bacteria 4680
146 Ga0373924_0000017 3300035410 Bacteria 42763
147 Ga0373924_0057189 3300035410 Bacteria 1626
148 Ga0373924_0192470 3300035410 Bacteria 899
149 Ga0373931_0150772 3300035691 Bacteria 1355
150 Ga0373935_0001003 3300035692 Bacteria 15351
151 Ga0373935_0056035 3300035692 Bacteria 2512
152 Ga0373927_0001070 3300035695 Bacteria 20944
153 Ga0373933_0000079 3300035724 Bacteria 60394
154 Ga0373933_0016508 3300035724 Bacteria 4130
155 Ga0373947_0000830 3300035725 Bacteria 18648
156 Ga0373947_0413520 3300035725 Bacteria 911
157 Ga0373947_0573447 3300035725 Bacteria 769
158 Ga0373947_0645171 3300035725 Bacteria 722
159 Ga0373937_0000189 3300036401 Bacteria 60393
160 Ga0373937_0001102 3300036401 Bacteria 22734
161 Ga0373925_0017177 3300037068 Bacteria 5239
162 Ga0373925_0075275 3300037068 Bacteria 2558
163 Ga0373925_0097393 3300037068 Bacteria 2256
164 Ga0373925_0543547 3300037068 Bacteria 955
165 Ga0395901_1801483 3300038443 Bacteria 561
166 Ga0436363_0523736 3300039450 Bacteria 931
167 Ga0451797_0129694 3300041453 Unclassified 570
168 Ga0451797_1374536 3300041453 Bacteria 714
169 Ga0451798_0659557 3300041458 Bacteria 562
170 Ga0451802_1423631 3300041460 Unclassified 828
171 Ga0439448_0030127 3300042005 Bacteria 1720
172 Ga0439448_0059763 3300042005 Unclassified 1259
173 Ga0439463_010506 3300042016 Bacteria 2273
174 Ga0439463_129341 3300042016 Bacteria 653
175 Ga0439440_0035291 3300042993 Bacteria 1199
176 Ga0466969_0082358 3300044656 Bacteria 1534
177 Ga0466971_0057650 3300044719 Bacteria 1752
178 Ga0466970_0027612 3300044765 Bacteria 2978
179 Ga0466970_0389483 3300044765 Unclassified 794
180 Ga0466957_0006776 3300044842 Bacteria 6473
181 Ga0466959_0102540 3300045049 Unclassified 2048
182 Ga0466959_0399353 3300045049 Unclassified 934
183 Ga0466958_0004596 3300045836 Bacteria 7311
184 Ga0466967_0015696 3300045976 Bacteria 5948
185 Ga0495592_0000154 3300046454 Bacteria 59985
186 Ga0495592_0006132 3300046454 Bacteria 8939
187 Ga0495603_0317530 3300046455 Bacteria 894
188 Ga0495629_0038295 3300046459 Bacteria 3378
189 Ga0495629_0933858 3300046459 Unclassified 567
190 Ga0495641_0017481 3300046461 Bacteria 3737
191 Ga0495641_0082885 3300046461 Unclassified 1436
192 Ga0495651_0000240 3300046462 Bacteria 42303
193 Ga0495651_0004999 3300046462 Bacteria 10127
194 Ga0495651_0449866 3300046462 Bacteria 832
195 Ga0495653_0000750 3300046463 Bacteria 24833
196 Ga0495653_0002616 3300046463 Bacteria 14323
197 Ga0495653_0007847 3300046463 Bacteria 8738
198 Ga0495653_0204962 3300046463 Bacteria 1336
199 Ga0495653_0748491 3300046463 Bacteria 591
200 Ga0495580_0228781 3300046472 Bacteria 1277
201 Ga0495582_0015308 3300046473 Bacteria 4215
202 Ga0495639_0444520 3300046475 Bacteria 658
203 Ga0495662_0028674 3300046476 Bacteria 2687
204 Ga0495664_0008264 3300046477 Bacteria 5800
205 Ga0495664_0012673 3300046477 Bacteria 4775
206 Ga0495608_0000123 3300046511 Bacteria 55519
207 Ga0495608_0005540 3300046511 Bacteria 9019
208 Ga0495608_0274145 3300046511 Bacteria 1048
209 Ga0495618_0021719 3300046514 Bacteria 3957
210 Ga0495618_0336593 3300046514 Bacteria 932
211 Ga0495618_0814527 3300046514 Bacteria 543
212 Ga0495628_0001401 3300046516 Bacteria 22116
213 Ga0495628_0004909 3300046516 Bacteria 11770
214 Ga0495628_0254448 3300046516 Bacteria 1310
215 Ga0495628_0261728 3300046516 Unclassified 1289
216 Ga0495630_0013427 3300046517 Bacteria 5960
217 Ga0495630_0041422 3300046517 Bacteria 3439
218 Ga0495630_0932533 3300046517 Unclassified 661
219 Ga0495630_1090125 3300046517 Bacteria 606
220 Ga0495637_0356111 3300046520 Unclassified 513
221 Ga0495666_0465039 3300046526 Bacteria 566
222 Ga0495652_0000278 3300046529 Bacteria 60389
223 Ga0495652_0007763 3300046529 Bacteria 9862
224 Ga0495652_0013313 3300046529 Bacteria 7404
225 Ga0495652_0238479 3300046529 Bacteria 1355
226 Ga0495665_0024161 3300046531 Bacteria 3265
227 Ga0495665_0120309 3300046531 Bacteria 1375
228 Ga0495640_0014886 3300046533 Bacteria 5866
229 Ga0495640_0481219 3300046533 Bacteria 756
230 Ga0495587_0000126 3300046536 Bacteria 57849
231 Ga0495587_0004680 3300046536 Bacteria 8988
232 Ga0495587_0691862 3300046536 Unclassified 559
233 Ga0495645_0008587 3300046543 Bacteria 7135
234 Ga0495645_0520523 3300046543 Bacteria 741
235 Ga0495645_0972702 3300046543 Bacteria 500
236 Ga0495667_0000123 3300046559 Bacteria 55776
237 Ga0495667_0052215 3300046559 Bacteria 2694
238 Ga0495667_0072329 3300046559 Bacteria 2247
239 Ga0495656_0312515 3300046615 Unclassified 808
240 Ga0495656_0362469 3300046615 Unclassified 753
241 Ga0495634_0030595 3300046642 Bacteria 3717
242 Ga0495634_0145077 3300046642 Bacteria 1504
243 Ga0495634_0297399 3300046642 Bacteria 977
244 Ga0495635_0001360 3300046663 Bacteria 16268
245 Ga0495635_0008772 3300046663 Bacteria 7059
246 Ga0495661_0582636 3300046665 Bacteria 527
247 Ga0495657_0000164 3300046675 Bacteria 59903
248 Ga0495657_0017171 3300046675 Bacteria 5259
249 Ga0495599_0000096 3300046678 Bacteria 61855
250 Ga0495599_0001736 3300046678 Bacteria 12606
251 Ga0495599_0022746 3300046678 Bacteria 3915
252 Ga0495599_0244556 3300046678 Bacteria 1093
253 Ga0495623_0000243 3300046679 Bacteria 35316
254 Ga0495623_0162158 3300046679 Bacteria 1313
255 Ga0495646_0003894 3300046680 Bacteria 9338
256 Ga0495646_0013229 3300046680 Bacteria 5244
257 Ga0495646_0254410 3300046680 Bacteria 940
258 Ga0495613_0022827 3300046689 Bacteria 4662
259 Ga0495613_0095004 3300046689 Bacteria 2157
260 Ga0495624_0002304 3300046690 Bacteria 14540
261 Ga0495600_0000513 3300046809 Bacteria 20094
262 Ga0495600_0015344 3300046809 Bacteria 4842
263 Ga0495581_0025800 3300047315 Bacteria 3408
264 Ga0495581_0242650 3300047315 Bacteria 1054
265 Ga0495604_0000141 3300047317 Bacteria 61811
266 Ga0495604_0038663 3300047317 Bacteria 3753
267 Ga0495636_0664030 3300047318 Bacteria 513
268 Ga0495674_0008352 3300047319 Bacteria 9871
269 Ga0495674_0008821 3300047319 Bacteria 9590
270 Ga0495674_1131131 3300047319 Bacteria 595
271 Ga0495676_0171393 3300047321 Bacteria 1527
272 Ga0495676_0814986 3300047321 Bacteria 601
273 Ga0495680_0000874 3300047322 Bacteria 33467
274 Ga0495680_0006143 3300047322 Bacteria 11209
275 Ga0495680_0013960 3300047322 Bacteria 6983
276 Ga0495680_0108896 3300047322 Bacteria 2055
277 Ga0495687_156077 3300047443 Bacteria 774
278 Ga0495675_0000519 3300047444 Bacteria 25004
279 Ga0495684_0013227 3300047471 Bacteria 6369
280 Ga0495684_0014255 3300047471 Bacteria 6116
281 Ga0495593_0029127 3300047673 Bacteria 3030
282 Ga0495602_0000189 3300048088 Bacteria 58271
283 Ga0495602_0006576 3300048088 Bacteria 12182
284 Ga0495602_0705411 3300048088 Unclassified 684
285 Ga0496102_1924564 3300048905 Unclassified 508
286 Ga0496104_1021580 3300048907 Unclassified 731
287 Ga0496114_0336173 3300048917 Bacteria 1335
288 Ga0501034_0898128 3300049571 Bacteria 774
289 Ga0501036_1503293 3300049572 Unclassified 545
290 Ga0501038_0719069 3300049574 Bacteria 747
291 Ga0501039_0132551 3300049575 Unclassified 1956
292 Ga0501041_0196505 3300049577 Bacteria 1264
293 Ga0501042_0402210 3300049578 Bacteria 992
294 Ga0501043_0437625 3300049579 Bacteria 984
295 Ga0501043_0793366 3300049579 Bacteria 686
296 Ga0501046_0439671 3300049580 Bacteria 939
297 Ga0501046_0495855 3300049580 Bacteria 875
298 Ga0501067_0180870 3300049583 Bacteria 1174
299 Ga0501072_1182919 3300049588 Unclassified 594
300 Ga0501075_0564833 3300049591 Bacteria 868
301 Ga0501076_0933749 3300049592 Bacteria 715
302 Ga0501250_082351 3300049680 Bacteria 549
303 Ga0501079_0333014 3300049741 Unclassified 1189
304 Ga0501044_0030153 3300049823 Bacteria 5717
305 Ga0501044_0534350 3300049823 Bacteria 1071
306 Ga0501044_0681778 3300049823 Bacteria 914
307 Ga0501044_0687850 3300049823 Bacteria 909
308 Ga0501045_0549167 3300049824 Bacteria 857
309 nmdc:mga05p37_170192_c1 3300050507 Bacteria 2657
310 nmdc:mga05p37_81777_c1 3300050507 Bacteria 3979
311 nmdc:mga09592_567508_c1 3300050508 Bacteria 974
312 nmdc:mga0qj67_262431_c1 3300050509 Bacteria 1401
313 nmdc:mga06r32_6413_c1 3300050510 Bacteria 10568
314 nmdc:mga06r32_961183_c1 3300050510 Bacteria 808
315 nmdc:mga08y16_1054152_c1 3300050511 Bacteria 790
316 nmdc:mga0n895_113538_c1 3300050512 Bacteria 2727
317 nmdc:mga0n895_239073_c1 3300050512 Bacteria 1843
318 nmdc:mga0rr50_207795_c1 3300050513 Bacteria 1612
319 nmdc:mga0rr50_43553_c1 3300050513 Bacteria 3286
320 nmdc:mga08x19_222569_c1 3300050514 Bacteria 1297
321 nmdc:mga0a205_40504_c1 3300050515 Bacteria 4485
322 Ga0495601_0118634 3300053077 Bacteria 1717
323 Ga0495595_0001228 3300053084 Bacteria 9976
324 Ga0495595_0003678 3300053084 Bacteria 6097
325 Ga0495619_0015781 3300053085 Bacteria 4782
326 Ga0501084_1679413 3300054114 Unclassified 531
327 Ga0501082_0814234 3300060353 Unclassified 817
328 Ga0501082_1493458 3300060353 Unclassified 590
329 Ga0466962_0020022 3300061719 Bacteria 3216
330 Ga0466962_0120582 3300061719 Bacteria 1265
331 Ga0530510_0092752 3300061734 Bacteria 2204
332 8055413411 8055412473 Bacteria 6257500
333 2616695238 2616644814 Bacteria 11555299
334 2793982135 2791355406 Bacteria 11364898
335 2811845548 2808606982 Bacteria 7791042
336 2995467642 2995463766 Bacteria 8577691
337 3002998874 3002998708 Bacteria 11715108
338 8008487110 8008485437 Bacteria 7198341
339 8025525129 8025524527 Bacteria 7197316
340 8048361507 8048356638 Bacteria 11044339
341 8056831842 8056829672 Bacteria 9045328
342 Ga0070682_101959184
343 Ga0070674_100388695
344 Ga0070709_10031113
345 Ga0070709_10794535
346 Ga0070709_10891246
347 Ga0070714_100122870
348 Ga0070714_101477202
349 Ga0070714_102494164
350 Ga0070714_102494707
351 Ga0070713_100119274
352 Ga0070713_100921823
353 Ga0070713_101275388
354 Ga0070713_101621597
355 Ga0070710_10005047
356 Ga0070710_10284414
357 Ga0070710_10367587
358 Ga0070710_10550359
359 Ga0070711_100074702
360 Ga0070711_100161795
361 Ga0070711_100269972
362 Ga0070711_100287195
363 Ga0070711_100883432
364 Ga0070711_101055253
365 Ga0070708_100000768
366 Ga0070708_100015389
367 Ga0070708_100126445
368 Ga0070706_100134947
369 Ga0070706_100258698
370 Ga0070706_101573341
371 Ga0070707_100011408
372 Ga0070699_100002369
373 Ga0070693_100429158
374 Ga0068856_100734991
375 Ga0070702_101146957
376 Ga0068866_10147419
377 Ga0081455_11043161
378 Ga0070717_10012264
379 Ga0070717_10204017
380 Ga0070715_10331384
381 Ga0070716_100008990
382 Ga0070716_101331471
383 Ga0070712_100015374
384 Ga0070712_100147949
385 Ga0070712_100529058
386 Ga0070712_101281393
387 Ga0070712_101716326
388 Ga0075428_100365357
389 Ga0075430_100672401
390 Ga0075431_100019042
391 Ga0075433_10048620
392 Ga0075434_100044999
393 Ga0075434_100061327
394 Ga0075434_101865430
395 Ga0075429_100887082
396 Ga0075436_100630558
397 Ga0075436_100781339
398 Ga0075435_100024383
399 Ga0075435_100070637
400 Ga0075435_101256348
401 Ga0105240_11913203
402 Ga0111539_11114282
403 Ga0105245_10299134
404 Ga0105245_10743689
405 Ga0114129_10353680
406 Ga0114129_13206547
407 Ga0105243_10064142
408 Ga0105243_12237388
409 Ga0105237_11252447
410 Ga0105249_10085559
411 Ga0105249_13442852
412 Ga0105246_10213916
413 Ga0157369_10426454
414 Ga0157378_10403205
415 Ga0157378_12201751
416 Ga0163162_13136343
417 Ga0157375_10196314
418 Ga0157375_10441766
419 Ga0157380_11972027
420 Ga0163161_10159814
421 Ga0207426_1022696
422 Ga0207692_10020703
423 Ga0207692_10097315
424 Ga0207642_10024706
425 Ga0207642_11117576
426 Ga0207699_10013323
427 Ga0207699_10317197
428 Ga0207684_10182857
429 Ga0207684_10814284
430 Ga0207684_11314819
431 Ga0207693_10017666
432 Ga0207693_10097716
433 Ga0207693_10209521
434 Ga0207693_10297529
435 Ga0207693_10467081
436 Ga0207663_10009627
437 Ga0207663_10023947
438 Ga0207663_10151059
439 Ga0207687_10841185
440 Ga0207700_10005716
441 Ga0207700_10316530
442 Ga0207700_10918748
443 Ga0207700_11342012
444 Ga0207700_11769861
445 Ga0207664_10077015
446 Ga0207664_10110083
447 Ga0207664_11331240
448 Ga0207644_10946817
449 Ga0207686_10134160
450 Ga0207686_11661102
451 Ga0207709_10083141
452 Ga0207704_11470309
453 Ga0207665_10002522
454 Ga0207712_10091615
455 Ga0207675_101632965
456 Ga0307508_10028141
457 Ga0307514_10583923
458 Ga0307413_11885304
459 Ga0307406_10361184
460 Ga0307409_101338680
461 Ga0307416_100132347
462 Ga0307507_10398929
463 Ga0373926_0351020
464 Ga0373934_0000052
465 Ga0373934_0000826
466 Ga0373944_0163617
467 Ga0373923_0014184
468 Ga0373923_0095959
469 Ga0373923_0150176
470 Ga0373936_0002592
471 Ga0373936_0025544
472 Ga0373945_0007176
473 Ga0373953_0000049
474 Ga0373953_0042185
475 Ga0373954_0002010
476 Ga0373954_0048285
477 Ga0373956_0002102
478 Ga0373956_0148284
479 Ga0373957_0000096
480 Ga0373957_0024479
481 Ga0373943_0000655
482 Ga0373943_0068659
483 Ga0373946_0000492
484 Ga0373946_0124913
485 Ga0373955_0000313
486 Ga0373955_0008903
487 Ga0373924_0000017
488 Ga0373924_0057189
489 Ga0373924_0192470
490 Ga0373931_0150772
491 Ga0373935_0001003
492 Ga0373935_0056035
493 Ga0373927_0001070
494 Ga0373933_0000079
495 Ga0373933_0016508
496 Ga0373947_0000830
497 Ga0373947_0413520
498 Ga0373947_0573447
499 Ga0373947_0645171
500 Ga0373937_0000189
501 Ga0373937_0001102
502 Ga0373925_0017177
503 Ga0373925_0075275
504 Ga0373925_0097393
505 Ga0373925_0543547
506 Ga0395901_1801483
507 Ga0436363_0523736
508 Ga0451797_0129694
509 Ga0451797_1374536
510 Ga0451798_0659557
511 Ga0451802_1423631
512 Ga0439448_0030127
513 Ga0439448_0059763
514 Ga0439463_010506
515 Ga0439463_129341
516 Ga0439440_0035291
517 Ga0466969_0082358
518 Ga0466971_0057650
519 Ga0466970_0027612
520 Ga0466970_0389483
521 Ga0466957_0006776
522 Ga0466959_0102540
523 Ga0466959_0399353
524 Ga0466958_0004596
525 Ga0466967_0015696
526 Ga0495592_0000154
527 Ga0495592_0006132
528 Ga0495603_0317530
529 Ga0495629_0038295
530 Ga0495629_0933858
531 Ga0495641_0017481
532 Ga0495641_0082885
533 Ga0495651_0000240
534 Ga0495651_0004999
535 Ga0495651_0449866
536 Ga0495653_0000750
537 Ga0495653_0002616
538 Ga0495653_0007847
539 Ga0495653_0204962
540 Ga0495653_0748491
541 Ga0495580_0228781
542 Ga0495582_0015308
543 Ga0495639_0444520
544 Ga0495662_0028674
545 Ga0495664_0008264
546 Ga0495664_0012673
547 Ga0495608_0000123
548 Ga0495608_0005540
549 Ga0495608_0274145
550 Ga0495618_0021719
551 Ga0495618_0336593
552 Ga0495618_0814527
553 Ga0495628_0001401
554 Ga0495628_0004909
555 Ga0495628_0254448
556 Ga0495628_0261728
557 Ga0495630_0013427
558 Ga0495630_0041422
559 Ga0495630_0932533
560 Ga0495630_1090125
561 Ga0495637_0356111
562 Ga0495666_0465039
563 Ga0495652_0000278
564 Ga0495652_0007763
565 Ga0495652_0013313
566 Ga0495652_0238479
567 Ga0495665_0024161
568 Ga0495665_0120309
569 Ga0495640_0014886
570 Ga0495640_0481219
571 Ga0495587_0000126
572 Ga0495587_0004680
573 Ga0495587_0691862
574 Ga0495645_0008587
575 Ga0495645_0520523
576 Ga0495645_0972702
577 Ga0495667_0000123
578 Ga0495667_0052215
579 Ga0495667_0072329
580 Ga0495656_0312515
581 Ga0495656_0362469
582 Ga0495634_0030595
583 Ga0495634_0145077
584 Ga0495634_0297399
585 Ga0495635_0001360
586 Ga0495635_0008772
587 Ga0495661_0582636
588 Ga0495657_0000164
589 Ga0495657_0017171
590 Ga0495599_0000096
591 Ga0495599_0001736
592 Ga0495599_0022746
593 Ga0495599_0244556
594 Ga0495623_0000243
595 Ga0495623_0162158
596 Ga0495646_0003894
597 Ga0495646_0013229
598 Ga0495646_0254410
599 Ga0495613_0022827
600 Ga0495613_0095004
601 Ga0495624_0002304
602 Ga0495600_0000513
603 Ga0495600_0015344
604 Ga0495581_0025800
605 Ga0495581_0242650
606 Ga0495604_0000141
607 Ga0495604_0038663
608 Ga0495636_0664030
609 Ga0495674_0008352
610 Ga0495674_0008821
611 Ga0495674_1131131
612 Ga0495676_0171393
613 Ga0495676_0814986
614 Ga0495680_0000874
615 Ga0495680_0006143
616 Ga0495680_0013960
617 Ga0495680_0108896
618 Ga0495687_156077
619 Ga0495675_0000519
620 Ga0495684_0013227
621 Ga0495684_0014255
622 Ga0495593_0029127
623 Ga0495602_0000189
624 Ga0495602_0006576
625 Ga0495602_0705411
626 Ga0496102_1924564
627 Ga0496104_1021580
628 Ga0496114_0336173
629 Ga0501034_0898128
630 Ga0501036_1503293
631 Ga0501038_0719069
632 Ga0501039_0132551
633 Ga0501041_0196505
634 Ga0501042_0402210
635 Ga0501043_0437625
636 Ga0501043_0793366
637 Ga0501046_0439671
638 Ga0501046_0495855
639 Ga0501067_0180870
640 Ga0501072_1182919
641 Ga0501075_0564833
642 Ga0501076_0933749
643 Ga0501250_082351
644 Ga0501079_0333014
645 Ga0501044_0030153
646 Ga0501044_0534350
647 Ga0501044_0681778
648 Ga0501044_0687850
649 Ga0501045_0549167
650 nmdc:mga05p37_170192_c1
651 nmdc:mga05p37_81777_c1
652 nmdc:mga09592_567508_c1
653 nmdc:mga0qj67_262431_c1
654 nmdc:mga06r32_6413_c1
655 nmdc:mga06r32_961183_c1
656 nmdc:mga08y16_1054152_c1
657 nmdc:mga0n895_113538_c1
658 nmdc:mga0n895_239073_c1
659 nmdc:mga0rr50_207795_c1
660 nmdc:mga0rr50_43553_c1
661 nmdc:mga08x19_222569_c1
662 nmdc:mga0a205_40504_c1
663 Ga0495601_0118634
664 Ga0495595_0001228
665 Ga0495595_0003678
666 Ga0495619_0015781
667 Ga0501084_1679413
668 Ga0501082_0814234
669 Ga0501082_1493458
670 Ga0466962_0020022
671 Ga0466962_0120582
672 Ga0530510_0092752
673 8055413411
674 2616695238
675 2793982135
676 2811845548
677 2995467642
678 3002998874
679 8008487110
680 8025525129
681 8048361507
682 8056831842

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12728

HTH_17

Helix-turn-helix domain

1

51

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j2n-assembly1.cif.gz_A crystal structure of mycobacteriophage pukovnik xis 0.9234 12 56
6amk-assembly1.cif.gz_B structure of streptomyces venezuelae bldc-whii opt complex 0.8861 11 59
6amk-assembly1.cif.gz_A structure of streptomyces venezuelae bldc-whii opt complex 0.8819 11 59
6ama-assembly1.cif.gz_A structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8669 10 59
6ama-assembly1.cif.gz_B structure of s. coelicolor/s. venezuelae bldc-smea-ssfa complex to 3.09 angstrom 0.8595 10 59
ID Description Score Start End Superfamily
af_P9WLC3_19_69_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9328 13 61 1.10.10.10
af_I6YE30_32_77_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9318 13 55 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9263 12 61 1.10.10.10
af_O53399_195_246_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9207 12 61 1.10.10.10
af_P9WKT7_24_74_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8933 12 61 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A523E0Z8-F1-model_v4 DNA-binding protein 0.9829 8 62 GO:0003677
AF-A0A0A0J166-F1-model_v4 DNA-binding protein 0.9618 6 61 GO:0003677
AF-A0A4V2XYN9-F1-model_v4 Helix-turn-helix domain-containing protein 0.9594 10 65 GO:0003677
AF-A0A7J9ZRL3-F1-model_v4 Helix-turn-helix domain-containing protein 0.9206 6 65 GO:0003677
AF-A0A5S4GM51-F1-model_v4 Helix-turn-helix domain-containing protein 0.9193 6 65 GO:0003677

Map