F414992

General Info

Members Datasets Scaffolds Average Seq Length
342 151 684 152

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10001280|JGI24751J29686_100012803
Length 157
Sequence MADNKQVIERFYTAFQKLDYKTMQDCYSDDIIFSDPVFLVLRGNEVRAMWEMLCKNAKDLPAGRQGFSLTFSDIELLDEEYATCKWVASYTFSKTGNKVVNNIKAFMKLKDGKIIEHSDAFRLSTWIGQALGMKRAVQRNARKNLANFMNKYAIPAN

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
127 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
139 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
142 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
143 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
144 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
145 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
151 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.05
Nodule 0
Rhizoplane 1.17
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 18.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10001280 3300002459 Bacteria 5305
2 MBSR1b_contig_6515636 2162886012 Bacteria 938
3 rootL2_10018107 3300003322 Bacteria 4967
4 Ga0065704_10117326 3300005289 Unclassified 1836
5 Ga0065704_10191461 3300005289 Bacteria 1183
6 Ga0065712_10072708 3300005290 Bacteria 4639
7 Ga0065712_10094007 3300005290 Bacteria 2261
8 Ga0065712_10149383 3300005290 Bacteria 1370
9 Ga0065715_10115253 3300005293 Unclassified 2370
10 Ga0065707_10087796 3300005295 Bacteria 4886
11 Ga0070676_10078429 3300005328 Bacteria 1998
12 Ga0070690_100087430 3300005330 Bacteria 2047
13 Ga0070690_100168839 3300005330 Bacteria 1504
14 Ga0070670_100006896 3300005331 Bacteria 9628
15 Ga0070670_100024013 3300005331 Bacteria 5245
16 Ga0070670_100084840 3300005331 Bacteria 2721
17 Ga0070670_100191396 3300005331 Unclassified 1777
18 Ga0070670_100421012 3300005331 Unclassified 1181
19 Ga0068869_100089822 3300005334 Bacteria 2308
20 Ga0068869_100317861 3300005334 Bacteria 1262
21 Ga0068869_100371289 3300005334 Bacteria 1171
22 Ga0070666_10723423 3300005335 Unclassified 731
23 Ga0070682_100871423 3300005337 Unclassified 737
24 Ga0068868_100179958 3300005338 Unclassified 1753
25 Ga0068868_100693332 3300005338 Bacteria 910
26 Ga0068868_101594390 3300005338 Bacteria 613
27 Ga0070689_100059089 3300005340 Bacteria 2979
28 Ga0070689_100169377 3300005340 Bacteria 1769
29 Ga0070689_100231295 3300005340 Bacteria 1520
30 Ga0070689_100335535 3300005340 Bacteria 1265
31 Ga0070689_100521442 3300005340 Bacteria 1020
32 Ga0070691_10529535 3300005341 Unclassified 685
33 Ga0070661_100295725 3300005344 Bacteria 1259
34 Ga0070668_100020308 3300005347 Bacteria 5012
35 Ga0070668_100061405 3300005347 Bacteria 2911
36 Ga0070669_100046308 3300005353 Unclassified 3172
37 Ga0070669_100216211 3300005353 Bacteria 1514
38 Ga0070669_100438650 3300005353 Bacteria 1074
39 Ga0070675_100018967 3300005354 Bacteria 5479
40 Ga0070675_100099502 3300005354 Unclassified 2448
41 Ga0070671_100214369 3300005355 Bacteria 1633
42 Ga0070674_100020509 3300005356 Bacteria 4225
43 Ga0070674_100040558 3300005356 Bacteria 3150
44 Ga0070674_100834211 3300005356 Unclassified 798
45 Ga0070673_100003798 3300005364 Bacteria 9473
46 Ga0070673_100135734 3300005364 Bacteria 2070
47 Ga0070673_100147066 3300005364 Bacteria 1993
48 Ga0070688_100006277 3300005365 Bacteria 6341
49 Ga0070659_100467865 3300005366 Bacteria 1071
50 Ga0070667_100087858 3300005367 Bacteria 2669
51 Ga0070667_100155846 3300005367 Bacteria 2009
52 Ga0070701_10186290 3300005438 Bacteria 1218
53 Ga0070701_10372602 3300005438 Unclassified 898
54 Ga0070700_100205834 3300005441 Bacteria 1385
55 Ga0070678_100091122 3300005456 Bacteria 2339
56 Ga0070678_100116972 3300005456 Bacteria 2096
57 Ga0070662_100190952 3300005457 Bacteria 1620
58 Ga0070662_100364986 3300005457 Bacteria 1185
59 Ga0068867_100113312 3300005459 Bacteria 2086
60 Ga0068867_100152392 3300005459 Bacteria 1817
61 Ga0068867_100164764 3300005459 Bacteria 1751
62 Ga0068867_100196552 3300005459 Bacteria 1612
63 Ga0070685_10011161 3300005466 Unclassified 4696
64 Ga0070685_10089409 3300005466 Bacteria 1861
65 Ga0070685_10271893 3300005466 Bacteria 1131
66 Ga0070685_10527941 3300005466 Bacteria 839
67 Ga0070707_100316729 3300005468 Bacteria 1516
68 Ga0070698_100007488 3300005471 Bacteria 11813
69 Ga0070698_100030150 3300005471 Bacteria 5626
70 Ga0070698_100119562 3300005471 Bacteria 2595
71 Ga0070698_100571540 3300005471 Bacteria 1070
72 Ga0070699_100152944 3300005518 Bacteria 2041
73 Ga0068853_100078403 3300005539 Bacteria 2887
74 Ga0070686_100014838 3300005544 Bacteria 4497
75 Ga0070686_100546595 3300005544 Bacteria 905
76 Ga0070665_100008754 3300005548 Bacteria 10244
77 Ga0070704_100425252 3300005549 Bacteria 1138
78 Ga0070664_100025661 3300005564 Bacteria 4887
79 Ga0070664_100123281 3300005564 Bacteria 2271
80 Ga0070664_100304755 3300005564 Bacteria 1440
81 Ga0068857_100188064 3300005577 Unclassified 1880
82 Ga0068857_101179981 3300005577 Bacteria 741
83 Ga0068854_100016293 3300005578 Bacteria 4952
84 Ga0068854_100128291 3300005578 Unclassified 1934
85 Ga0068854_100743926 3300005578 Unclassified 850
86 Ga0070702_100017251 3300005615 Bacteria 3721
87 Ga0068852_100337090 3300005616 Bacteria 1469
88 Ga0068859_100029232 3300005617 Bacteria 5530
89 Ga0068859_100038050 3300005617 Bacteria 4828
90 Ga0068859_100061878 3300005617 Bacteria 3772
91 Ga0068859_100089079 3300005617 Bacteria 3136
92 Ga0068859_100198682 3300005617 Bacteria 2090
93 Ga0068859_100339087 3300005617 Bacteria 1597
94 Ga0068859_100490091 3300005617 Bacteria 1324
95 Ga0068864_100690212 3300005618 Bacteria 997
96 Ga0068866_10626219 3300005718 Bacteria 729
97 Ga0068861_100051379 3300005719 Bacteria 3129
98 Ga0068861_100115216 3300005719 Unclassified 2159
99 Ga0068861_100170472 3300005719 Bacteria 1803
100 Ga0068861_100447308 3300005719 Unclassified 1157
101 Ga0068870_10022809 3300005840 Bacteria 3079
102 Ga0068870_10294065 3300005840 Bacteria 1023
103 Ga0068870_10297121 3300005840 Bacteria 1018
104 Ga0068870_10337423 3300005840 Bacteria 963
105 Ga0068870_10726573 3300005840 Unclassified 687
106 Ga0068863_100002643 3300005841 Bacteria 17735
107 Ga0068863_100246056 3300005841 Bacteria 1727
108 Ga0068863_100352127 3300005841 Bacteria 1434
109 Ga0068858_100173258 3300005842 Unclassified 2035
110 Ga0068858_100299756 3300005842 Bacteria 1533
111 Ga0068858_100423261 3300005842 Bacteria 1281
112 Ga0068858_100427465 3300005842 Bacteria 1274
113 Ga0068860_100111068 3300005843 Bacteria 2620
114 Ga0068860_100124768 3300005843 Unclassified 2468
115 Ga0068860_100255920 3300005843 Unclassified 1706
116 Ga0068860_100367512 3300005843 Unclassified 1418
117 Ga0068860_100506407 3300005843 Bacteria 1206
118 Ga0068860_100854530 3300005843 Bacteria 925
119 Ga0068862_100045317 3300005844 Unclassified 3752
120 Ga0068862_101164206 3300005844 Unclassified 768
121 Ga0068862_102532396 3300005844 Bacteria 525
122 Ga0075366_10075748 3300006195 Bacteria 2007
123 Ga0075366_10099316 3300006195 Bacteria 1746
124 Ga0097621_100031542 3300006237 Bacteria 4206
125 Ga0068871_100037001 3300006358 Bacteria 3890
126 Ga0068871_100101678 3300006358 Bacteria 2409
127 Ga0068871_100297585 3300006358 Bacteria 1416
128 Ga0075428_100014305 3300006844 Bacteria 8822
129 Ga0075428_100031397 3300006844 Bacteria 5872
130 Ga0075428_101646538 3300006844 Unclassified 670
131 Ga0075430_100083844 3300006846 Bacteria 2670
132 Ga0075431_100006682 3300006847 Bacteria 11457
133 Ga0075433_10460006 3300006852 Bacteria 1121
134 Ga0075429_100003055 3300006880 Bacteria 14198
135 Ga0075429_100091846 3300006880 Bacteria 2648
136 Ga0075429_100160183 3300006880 Bacteria 1971
137 Ga0068865_100008713 3300006881 Bacteria 6273
138 Ga0068865_100132708 3300006881 Bacteria 1867
139 Ga0097620_100029233 3300006931 Bacteria 5530
140 Ga0097620_100038045 3300006931 Bacteria 4828
141 Ga0097620_100061882 3300006931 Bacteria 3772
142 Ga0097620_100089075 3300006931 Bacteria 3136
143 Ga0097620_100198684 3300006931 Bacteria 2090
144 Ga0097620_100339094 3300006931 Bacteria 1597
145 Ga0097620_100490085 3300006931 Bacteria 1324
146 Ga0111539_10055807 3300009094 Bacteria 4696
147 Ga0111539_10059075 3300009094 Bacteria 4549
148 Ga0111539_10402284 3300009094 Bacteria 1595
149 Ga0105245_11741537 3300009098 Bacteria 676
150 Ga0114129_10162070 3300009147 Bacteria 3054
151 Ga0114129_10616664 3300009147 Unclassified 1404
152 Ga0105243_10154467 3300009148 Bacteria 1972
153 Ga0105243_11187423 3300009148 Bacteria 775
154 Ga0105241_10250009 3300009174 Bacteria 1503
155 Ga0105241_10321223 3300009174 Bacteria 1335
156 Ga0105241_10972961 3300009174 Bacteria 792
157 Ga0105241_12393178 3300009174 Unclassified 527
158 Ga0105242_10005055 3300009176 Bacteria 10186
159 Ga0105242_10824081 3300009176 Bacteria 921
160 Ga0105248_10426004 3300009177 Bacteria 1494
161 Ga0105248_10771856 3300009177 Bacteria 1085
162 Ga0105249_10001308 3300009553 Bacteria 21834
163 Ga0105249_10015821 3300009553 Bacteria 6684
164 Ga0105249_10545391 3300009553 Bacteria 1210
165 Ga0105249_11613805 3300009553 Unclassified 721
166 Ga0105246_10087285 3300011119 Bacteria 2239
167 Ga0157374_10152757 3300013296 Bacteria 2245
168 Ga0157378_10001024 3300013297 Bacteria 25548
169 Ga0157378_10277389 3300013297 Unclassified 1614
170 Ga0157378_10457247 3300013297 Bacteria 1268
171 Ga0163162_10058552 3300013306 Bacteria 3882
172 Ga0163162_10072034 3300013306 Bacteria 3510
173 Ga0163162_10121446 3300013306 Unclassified 2717
174 Ga0163162_10308652 3300013306 Bacteria 1714
175 Ga0163162_10369878 3300013306 Bacteria 1566
176 Ga0163162_10889244 3300013306 Bacteria 1004
177 Ga0157375_10031740 3300013308 Bacteria 5000
178 Ga0157375_10190975 3300013308 Unclassified 2203
179 Ga0157375_10377232 3300013308 Bacteria 1585
180 Ga0157375_11682707 3300013308 Bacteria 751
181 Ga0157375_11873762 3300013308 Unclassified 712
182 Ga0157375_12126374 3300013308 Unclassified 668
183 Ga0163163_10111549 3300014325 Bacteria 2764
184 Ga0157380_10055739 3300014326 Bacteria 3140
185 Ga0157380_10063582 3300014326 Bacteria 2959
186 Ga0157380_10065468 3300014326 Unclassified 2921
187 Ga0157380_10154096 3300014326 Bacteria 1990
188 Ga0157380_10374866 3300014326 Bacteria 1341
189 Ga0157380_10428922 3300014326 Bacteria 1263
190 Ga0157380_10429717 3300014326 Bacteria 1262
191 Ga0157380_11843145 3300014326 Bacteria 665
192 Ga0157377_10001387 3300014745 Bacteria 10435
193 Ga0157377_10004324 3300014745 Bacteria 6523
194 Ga0157377_10074056 3300014745 Bacteria 1975
195 Ga0157377_10562344 3300014745 Bacteria 807
196 Ga0157379_10552704 3300014968 Unclassified 1071
197 Ga0157379_11271696 3300014968 Bacteria 710
198 Ga0157379_11712211 3300014968 Unclassified 616
199 Ga0157376_10402360 3300014969 Bacteria 1324
200 Ga0163161_10019289 3300017792 Bacteria 4782
201 Ga0163161_10236214 3300017792 Bacteria 1420
202 Ga0163161_10320925 3300017792 Bacteria 1224
203 Ga0163161_10481090 3300017792 Bacteria 1008
204 Ga0207682_10031220 3300025893 Unclassified 2137
205 Ga0207688_10030271 3300025901 Bacteria 2984
206 Ga0207688_10151692 3300025901 Bacteria 1369
207 Ga0207680_10015157 3300025903 Bacteria 4016
208 Ga0207680_10167873 3300025903 Bacteria 1476
209 Ga0207647_10604120 3300025904 Unclassified 605
210 Ga0207685_10591642 3300025905 Unclassified 594
211 Ga0207645_10003031 3300025907 Bacteria 12943
212 Ga0207645_10099300 3300025907 Bacteria 1877
213 Ga0207645_10111575 3300025907 Bacteria 1771
214 Ga0207643_10010054 3300025908 Bacteria 5088
215 Ga0207643_10401343 3300025908 Unclassified 867
216 Ga0207643_10426921 3300025908 Bacteria 841
217 Ga0207643_10454074 3300025908 Bacteria 815
218 Ga0207654_10509816 3300025911 Unclassified 850
219 Ga0207662_10005444 3300025918 Bacteria 6791
220 Ga0207662_10241335 3300025918 Unclassified 1183
221 Ga0207649_10340239 3300025920 Unclassified 1108
222 Ga0207646_10172921 3300025922 Bacteria 1951
223 Ga0207681_10015872 3300025923 Bacteria 4701
224 Ga0207681_10033961 3300025923 Bacteria 3350
225 Ga0207681_10224223 3300025923 Bacteria 1456
226 Ga0207650_10015607 3300025925 Bacteria 5294
227 Ga0207650_10021223 3300025925 Bacteria 4591
228 Ga0207650_10063297 3300025925 Unclassified 2765
229 Ga0207650_10084749 3300025925 Bacteria 2410
230 Ga0207650_10221205 3300025925 Unclassified 1524
231 Ga0207700_11541372 3300025928 Unclassified 589
232 Ga0207706_10121889 3300025933 Bacteria 2293
233 Ga0207686_10003338 3300025934 Bacteria 8620
234 Ga0207686_10245019 3300025934 Bacteria 1306
235 Ga0207686_10363880 3300025934 Bacteria 1092
236 Ga0207686_10543581 3300025934 Bacteria 907
237 Ga0207709_10436207 3300025935 Bacteria 1009
238 Ga0207670_10062744 3300025936 Bacteria 2541
239 Ga0207670_10153533 3300025936 Bacteria 1711
240 Ga0207670_10187018 3300025936 Bacteria 1564
241 Ga0207670_10315721 3300025936 Unclassified 1228
242 Ga0207670_10326548 3300025936 Bacteria 1208
243 Ga0207669_10149804 3300025937 Bacteria 1632
244 Ga0207669_10296198 3300025937 Bacteria 1227
245 Ga0207691_10092665 3300025940 Bacteria 2705
246 Ga0207691_10918218 3300025940 Bacteria 732
247 Ga0207689_10021122 3300025942 Bacteria 5472
248 Ga0207689_10028587 3300025942 Bacteria 4662
249 Ga0207689_10050213 3300025942 Bacteria 3440
250 Ga0207689_10177060 3300025942 Bacteria 1759
251 Ga0207689_10212382 3300025942 Bacteria 1599
252 Ga0207651_10147379 3300025960 Bacteria 1827
253 Ga0207651_10295706 3300025960 Bacteria 1344
254 Ga0207651_10747256 3300025960 Unclassified 864
255 Ga0207712_10002079 3300025961 Bacteria 13126
256 Ga0207712_10006827 3300025961 Bacteria 7203
257 Ga0207712_10010513 3300025961 Bacteria 5874
258 Ga0207712_10159725 3300025961 Bacteria 1750
259 Ga0207712_10273483 3300025961 Bacteria 1375
260 Ga0207712_11168612 3300025961 Bacteria 686
261 Ga0207640_10158087 3300025981 Bacteria 1673
262 Ga0207658_10111773 3300025986 Bacteria 2161
263 Ga0207658_10341753 3300025986 Bacteria 1301
264 Ga0207658_10370292 3300025986 Bacteria 1252
265 Ga0207677_10040375 3300026023 Unclassified 3076
266 Ga0207677_10314811 3300026023 Bacteria 1298
267 Ga0207677_10361817 3300026023 Bacteria 1219
268 Ga0207703_10236347 3300026035 Bacteria 1641
269 Ga0207703_10750398 3300026035 Unclassified 930
270 Ga0207703_12124222 3300026035 Unclassified 538
271 Ga0207639_10060698 3300026041 Unclassified 2917
272 Ga0207639_10153097 3300026041 Bacteria 1934
273 Ga0207641_10000637 3300026088 Bacteria 38255
274 Ga0207641_10045718 3300026088 Bacteria 3688
275 Ga0207641_10223145 3300026088 Bacteria 1748
276 Ga0207648_10002156 3300026089 Bacteria 21404
277 Ga0207648_10024924 3300026089 Bacteria 5333
278 Ga0207648_10029570 3300026089 Bacteria 4858
279 Ga0207674_10063289 3300026116 Bacteria 3734
280 Ga0207674_10063684 3300026116 Unclassified 3722
281 Ga0207674_10286431 3300026116 Bacteria 1596
282 Ga0207674_10454868 3300026116 Unclassified 1237
283 Ga0207674_10667499 3300026116 Bacteria 1004
284 Ga0207675_100014036 3300026118 Bacteria 7470
285 Ga0207675_100019562 3300026118 Bacteria 6318
286 Ga0207675_100071678 3300026118 Bacteria 3240
287 Ga0207675_100097689 3300026118 Unclassified 2766
288 Ga0207675_100422229 3300026118 Bacteria 1317
289 Ga0207675_101081297 3300026118 Bacteria 822
290 Ga0207683_10008097 3300026121 Bacteria 8988
291 Ga0207683_10232750 3300026121 Bacteria 1680
292 Ga0207683_11005892 3300026121 Unclassified 774
293 Ga0207698_10987775 3300026142 Unclassified 852
294 Ga0268266_10485129 3300028379 Bacteria 1178
295 Ga0268265_12480472 3300028380 Bacteria 525
296 Ga0268264_10036189 3300028381 Bacteria 4065
297 Ga0268264_10039362 3300028381 Bacteria 3906
298 Ga0268264_10285172 3300028381 Unclassified 1549
299 Ga0268264_10447364 3300028381 Bacteria 1251
300 Ga0268264_10845678 3300028381 Bacteria 916
301 Ga0268264_11051530 3300028381 Bacteria 822
302 Ga0307513_10502200 3300031456 Bacteria 930
303 Ga0307509_10030668 3300031507 Bacteria 5944
304 Ga0307516_10139955 3300031730 Bacteria 2191
305 Ga0307409_101013629 3300031995 Unclassified 849
306 Ga0307414_10379263 3300032004 Bacteria 1222
307 Ga0436361_0527374 3300039447 Bacteria 732
308 Ga0451793_0956737 3300041452 Bacteria 643
309 Ga0451802_0161514 3300041460 Bacteria 685
310 Ga0451802_0195435 3300041460 Bacteria 1040
311 Ga0451802_0647346 3300041460 Bacteria 562
312 Ga0439462_0061318 3300042015 Bacteria 1018
313 Ga0450923_090107 3300042125 Bacteria 698
314 Ga0450898_037387 3300042134 Bacteria 909
315 Ga0439434_0016941 3300042435 Bacteria 2179
316 Ga0439460_0023504 3300042461 Bacteria 1701
317 Ga0495643_0052326 3300046522 Unclassified 2193
318 Ga0495621_0239880 3300046539 Bacteria 738
319 Ga0495672_0038469 3300047320 Bacteria 2918
320 Ga0495686_0011126 3300047472 Bacteria 6355
321 Ga0501034_0057997 3300049571 Bacteria 3892
322 Ga0501037_0099445 3300049573 Bacteria 2101
323 Ga0501039_1048313 3300049575 Unclassified 633
324 Ga0501043_0388361 3300049579 Unclassified 1056
325 Ga0501047_0184308 3300049581 Bacteria 1953
326 Ga0501080_1488437 3300049742 Bacteria 576
327 Ga0501083_0243783 3300049744 Unclassified 1170
328 Ga0501044_0434670 3300049823 Bacteria 1221
329 nmdc:mga0k408_104859_c1 3300050493 Bacteria 1669
330 nmdc:mga0k408_375473_c1 3300050493 Bacteria 847
331 nmdc:mga0k408_64001_c1 3300050493 Bacteria 2140
332 nmdc:mga09592_1480210_c1 3300050508 Bacteria 553
333 nmdc:mga09592_472692_c1 3300050508 Bacteria 1081
334 nmdc:mga09592_4747_c1 3300050508 Bacteria 11012
335 nmdc:mga09592_701439_c1 3300050508 Bacteria 861
336 nmdc:mga0qj67_190710_c1 3300050509 Bacteria 1666
337 nmdc:mga06r32_289474_c1 3300050510 Bacteria 1625
338 nmdc:mga08y16_1128043_c1 3300050511 Bacteria 758
339 nmdc:mga08y16_72189_c1 3300050511 Bacteria 3597
340 nmdc:mga08y16_752826_c1 3300050511 Bacteria 970
341 Ga0500641_0064416 3300053096 Bacteria 1531
342 Ga0500611_000007 3300053727 Bacteria 210964
343 JGI24751J29686_10001280
344 MBSR1b_contig_6515636
345 rootL2_10018107
346 Ga0065704_10117326
347 Ga0065704_10191461
348 Ga0065712_10072708
349 Ga0065712_10094007
350 Ga0065712_10149383
351 Ga0065715_10115253
352 Ga0065707_10087796
353 Ga0070676_10078429
354 Ga0070690_100087430
355 Ga0070690_100168839
356 Ga0070670_100006896
357 Ga0070670_100024013
358 Ga0070670_100084840
359 Ga0070670_100191396
360 Ga0070670_100421012
361 Ga0068869_100089822
362 Ga0068869_100317861
363 Ga0068869_100371289
364 Ga0070666_10723423
365 Ga0070682_100871423
366 Ga0068868_100179958
367 Ga0068868_100693332
368 Ga0068868_101594390
369 Ga0070689_100059089
370 Ga0070689_100169377
371 Ga0070689_100231295
372 Ga0070689_100335535
373 Ga0070689_100521442
374 Ga0070691_10529535
375 Ga0070661_100295725
376 Ga0070668_100020308
377 Ga0070668_100061405
378 Ga0070669_100046308
379 Ga0070669_100216211
380 Ga0070669_100438650
381 Ga0070675_100018967
382 Ga0070675_100099502
383 Ga0070671_100214369
384 Ga0070674_100020509
385 Ga0070674_100040558
386 Ga0070674_100834211
387 Ga0070673_100003798
388 Ga0070673_100135734
389 Ga0070673_100147066
390 Ga0070688_100006277
391 Ga0070659_100467865
392 Ga0070667_100087858
393 Ga0070667_100155846
394 Ga0070701_10186290
395 Ga0070701_10372602
396 Ga0070700_100205834
397 Ga0070678_100091122
398 Ga0070678_100116972
399 Ga0070662_100190952
400 Ga0070662_100364986
401 Ga0068867_100113312
402 Ga0068867_100152392
403 Ga0068867_100164764
404 Ga0068867_100196552
405 Ga0070685_10011161
406 Ga0070685_10089409
407 Ga0070685_10271893
408 Ga0070685_10527941
409 Ga0070707_100316729
410 Ga0070698_100007488
411 Ga0070698_100030150
412 Ga0070698_100119562
413 Ga0070698_100571540
414 Ga0070699_100152944
415 Ga0068853_100078403
416 Ga0070686_100014838
417 Ga0070686_100546595
418 Ga0070665_100008754
419 Ga0070704_100425252
420 Ga0070664_100025661
421 Ga0070664_100123281
422 Ga0070664_100304755
423 Ga0068857_100188064
424 Ga0068857_101179981
425 Ga0068854_100016293
426 Ga0068854_100128291
427 Ga0068854_100743926
428 Ga0070702_100017251
429 Ga0068852_100337090
430 Ga0068859_100029232
431 Ga0068859_100038050
432 Ga0068859_100061878
433 Ga0068859_100089079
434 Ga0068859_100198682
435 Ga0068859_100339087
436 Ga0068859_100490091
437 Ga0068864_100690212
438 Ga0068866_10626219
439 Ga0068861_100051379
440 Ga0068861_100115216
441 Ga0068861_100170472
442 Ga0068861_100447308
443 Ga0068870_10022809
444 Ga0068870_10294065
445 Ga0068870_10297121
446 Ga0068870_10337423
447 Ga0068870_10726573
448 Ga0068863_100002643
449 Ga0068863_100246056
450 Ga0068863_100352127
451 Ga0068858_100173258
452 Ga0068858_100299756
453 Ga0068858_100423261
454 Ga0068858_100427465
455 Ga0068860_100111068
456 Ga0068860_100124768
457 Ga0068860_100255920
458 Ga0068860_100367512
459 Ga0068860_100506407
460 Ga0068860_100854530
461 Ga0068862_100045317
462 Ga0068862_101164206
463 Ga0068862_102532396
464 Ga0075366_10075748
465 Ga0075366_10099316
466 Ga0097621_100031542
467 Ga0068871_100037001
468 Ga0068871_100101678
469 Ga0068871_100297585
470 Ga0075428_100014305
471 Ga0075428_100031397
472 Ga0075428_101646538
473 Ga0075430_100083844
474 Ga0075431_100006682
475 Ga0075433_10460006
476 Ga0075429_100003055
477 Ga0075429_100091846
478 Ga0075429_100160183
479 Ga0068865_100008713
480 Ga0068865_100132708
481 Ga0097620_100029233
482 Ga0097620_100038045
483 Ga0097620_100061882
484 Ga0097620_100089075
485 Ga0097620_100198684
486 Ga0097620_100339094
487 Ga0097620_100490085
488 Ga0111539_10055807
489 Ga0111539_10059075
490 Ga0111539_10402284
491 Ga0105245_11741537
492 Ga0114129_10162070
493 Ga0114129_10616664
494 Ga0105243_10154467
495 Ga0105243_11187423
496 Ga0105241_10250009
497 Ga0105241_10321223
498 Ga0105241_10972961
499 Ga0105241_12393178
500 Ga0105242_10005055
501 Ga0105242_10824081
502 Ga0105248_10426004
503 Ga0105248_10771856
504 Ga0105249_10001308
505 Ga0105249_10015821
506 Ga0105249_10545391
507 Ga0105249_11613805
508 Ga0105246_10087285
509 Ga0157374_10152757
510 Ga0157378_10001024
511 Ga0157378_10277389
512 Ga0157378_10457247
513 Ga0163162_10058552
514 Ga0163162_10072034
515 Ga0163162_10121446
516 Ga0163162_10308652
517 Ga0163162_10369878
518 Ga0163162_10889244
519 Ga0157375_10031740
520 Ga0157375_10190975
521 Ga0157375_10377232
522 Ga0157375_11682707
523 Ga0157375_11873762
524 Ga0157375_12126374
525 Ga0163163_10111549
526 Ga0157380_10055739
527 Ga0157380_10063582
528 Ga0157380_10065468
529 Ga0157380_10154096
530 Ga0157380_10374866
531 Ga0157380_10428922
532 Ga0157380_10429717
533 Ga0157380_11843145
534 Ga0157377_10001387
535 Ga0157377_10004324
536 Ga0157377_10074056
537 Ga0157377_10562344
538 Ga0157379_10552704
539 Ga0157379_11271696
540 Ga0157379_11712211
541 Ga0157376_10402360
542 Ga0163161_10019289
543 Ga0163161_10236214
544 Ga0163161_10320925
545 Ga0163161_10481090
546 Ga0207682_10031220
547 Ga0207688_10030271
548 Ga0207688_10151692
549 Ga0207680_10015157
550 Ga0207680_10167873
551 Ga0207647_10604120
552 Ga0207685_10591642
553 Ga0207645_10003031
554 Ga0207645_10099300
555 Ga0207645_10111575
556 Ga0207643_10010054
557 Ga0207643_10401343
558 Ga0207643_10426921
559 Ga0207643_10454074
560 Ga0207654_10509816
561 Ga0207662_10005444
562 Ga0207662_10241335
563 Ga0207649_10340239
564 Ga0207646_10172921
565 Ga0207681_10015872
566 Ga0207681_10033961
567 Ga0207681_10224223
568 Ga0207650_10015607
569 Ga0207650_10021223
570 Ga0207650_10063297
571 Ga0207650_10084749
572 Ga0207650_10221205
573 Ga0207700_11541372
574 Ga0207706_10121889
575 Ga0207686_10003338
576 Ga0207686_10245019
577 Ga0207686_10363880
578 Ga0207686_10543581
579 Ga0207709_10436207
580 Ga0207670_10062744
581 Ga0207670_10153533
582 Ga0207670_10187018
583 Ga0207670_10315721
584 Ga0207670_10326548
585 Ga0207669_10149804
586 Ga0207669_10296198
587 Ga0207691_10092665
588 Ga0207691_10918218
589 Ga0207689_10021122
590 Ga0207689_10028587
591 Ga0207689_10050213
592 Ga0207689_10177060
593 Ga0207689_10212382
594 Ga0207651_10147379
595 Ga0207651_10295706
596 Ga0207651_10747256
597 Ga0207712_10002079
598 Ga0207712_10006827
599 Ga0207712_10010513
600 Ga0207712_10159725
601 Ga0207712_10273483
602 Ga0207712_11168612
603 Ga0207640_10158087
604 Ga0207658_10111773
605 Ga0207658_10341753
606 Ga0207658_10370292
607 Ga0207677_10040375
608 Ga0207677_10314811
609 Ga0207677_10361817
610 Ga0207703_10236347
611 Ga0207703_10750398
612 Ga0207703_12124222
613 Ga0207639_10060698
614 Ga0207639_10153097
615 Ga0207641_10000637
616 Ga0207641_10045718
617 Ga0207641_10223145
618 Ga0207648_10002156
619 Ga0207648_10024924
620 Ga0207648_10029570
621 Ga0207674_10063289
622 Ga0207674_10063684
623 Ga0207674_10286431
624 Ga0207674_10454868
625 Ga0207674_10667499
626 Ga0207675_100014036
627 Ga0207675_100019562
628 Ga0207675_100071678
629 Ga0207675_100097689
630 Ga0207675_100422229
631 Ga0207675_101081297
632 Ga0207683_10008097
633 Ga0207683_10232750
634 Ga0207683_11005892
635 Ga0207698_10987775
636 Ga0268266_10485129
637 Ga0268265_12480472
638 Ga0268264_10036189
639 Ga0268264_10039362
640 Ga0268264_10285172
641 Ga0268264_10447364
642 Ga0268264_10845678
643 Ga0268264_11051530
644 Ga0307513_10502200
645 Ga0307509_10030668
646 Ga0307516_10139955
647 Ga0307409_101013629
648 Ga0307414_10379263
649 Ga0436361_0527374
650 Ga0451793_0956737
651 Ga0451802_0161514
652 Ga0451802_0195435
653 Ga0451802_0647346
654 Ga0439462_0061318
655 Ga0450923_090107
656 Ga0450898_037387
657 Ga0439434_0016941
658 Ga0439460_0023504
659 Ga0495643_0052326
660 Ga0495621_0239880
661 Ga0495672_0038469
662 Ga0495686_0011126
663 Ga0501034_0057997
664 Ga0501037_0099445
665 Ga0501039_1048313
666 Ga0501043_0388361
667 Ga0501047_0184308
668 Ga0501080_1488437
669 Ga0501083_0243783
670 Ga0501044_0434670
671 nmdc:mga0k408_104859_c1
672 nmdc:mga0k408_375473_c1
673 nmdc:mga0k408_64001_c1
674 nmdc:mga09592_1480210_c1
675 nmdc:mga09592_472692_c1
676 nmdc:mga09592_4747_c1
677 nmdc:mga09592_701439_c1
678 nmdc:mga0qj67_190710_c1
679 nmdc:mga06r32_289474_c1
680 nmdc:mga08y16_1128043_c1
681 nmdc:mga08y16_72189_c1
682 nmdc:mga08y16_752826_c1
683 Ga0500641_0064416
684 Ga0500611_000007

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

8

117

0.89

PF13474

SnoaL_3

SnoaL-like domain

5

98

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.8822 4 115
4pej-assembly2.cif.gz_B crystal structure of a computationally designed retro-aldolase, ra110.4 (cys free) 0.8778 3 115
7rxf-assembly1.cif.gz_B multi-conformer model of apo ketosteroid isomerase y57f mutant from pseudomonas putida (pksi) at 250 k 0.8765 7 115
3fzw-assembly1.cif.gz_B crystal structure of ketosteroid isomerase d40n-d103n from pseudomonas putida (pksi) with bound equilenin 0.8764 3 115
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8748 7 118
ID Description Score Start End Superfamily
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8743 4 115 3.10.450.50
af_O06820_1_123_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.862 1 115 3.10.450.50
4rzmB02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8595 3 114 3.10.450.50
5cxoA00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8584 4 118 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8584 6 113 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A4Q5Y1P9-F1-model_v4 Nuclear transport factor 2 family protein 0.9913 1 123
AF-A0A4Q5Y1P9-F1-model_v4 Nuclear transport factor 2 family protein 0.9833 1 123
AF-A0A059X0X5-F1-model_v4 SnoaL-like domain protein 0.9819 3 115
AF-A0A519UJP2-F1-model_v4 Nuclear transport factor 2 family protein 0.9769 1 123
AF-A0A519UJP2-F1-model_v4 Nuclear transport factor 2 family protein 0.9691 1 123

Map