F415005

General Info

Members Datasets Scaffolds Average Seq Length
342 246 684 203

Family's Representative Sequence

Representative Sequence 3300003790|Ga0055528_1017100|Ga0055528_10171002
Length 227
Sequence MMLDPFYLIVDSTEWIARLVPLGVKLVQLRIKDKETAELRTEIRTAKAICAKHGCQLIVNDYWQLAIEQGCDFVHLGQEDLEAADLGAIRAAGLKLGLSTHDDAELETALAAKPDYIALGPIYPTILKQMKWSPQGPERLRLWKSRLGDLPLVAIGGLNVDRIEGVLSQGADSAAVVTDITLNPDPETLTRQWLAATAPWRSVEMPLGRLQNRTVDGSFGRNTFKND

Samples

Sample ID Description Type Environment
1 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
12 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
13 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
14 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
19 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
26 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
34 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
35 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
36 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
43 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
44 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
45 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
46 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
47 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
48 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
51 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
55 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
62 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
65 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
66 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
67 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
70 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
71 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
72 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
73 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
74 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
75 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
76 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
77 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
78 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
79 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
80 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
81 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
82 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
83 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
84 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
90 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
93 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
94 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
101 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
106 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
107 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
108 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
109 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
110 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
111 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
114 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
115 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
116 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
117 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
118 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
119 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
125 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
126 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
138 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
140 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
143 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
144 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
145 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
146 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
147 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
148 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
149 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
150 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
151 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
152 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
153 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
154 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
155 2508501050 Microvirga lupini Lut6 Isolate Nodule
156 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
157 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
158 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
159 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
160 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
161 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
162 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
163 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
164 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
165 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
166 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
167 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
168 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
169 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
170 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
171 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
172 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
173 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
174 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
175 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
176 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
177 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
178 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
179 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
180 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
181 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
182 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
183 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
184 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
185 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
186 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
187 2643221599 Rhizobium sp. Root708 Isolate Unclassified
188 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
189 2643221688 Rhizobium sp. Root482 Isolate Unclassified
190 2643221734 Bosea sp. Root670 Isolate Unclassified
191 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
192 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
193 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
194 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
195 2773857925 Microvirga vignae BR3299 Isolate Unclassified
196 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
197 2791355267 Rhizobium sp. L18 Isolate Nodule
198 2802429633 Rhizobium anhuiense J3 Isolate Nodule
199 2802429634 Rhizobium anhuiense S10 Isolate Nodule
200 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
201 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
202 2802429637 Rhizobium anhuiense C15 Isolate Nodule
203 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
204 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
205 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
206 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
207 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
208 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
209 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
210 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
211 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
212 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
213 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
214 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
215 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
216 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
217 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
218 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
219 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
220 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
221 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
222 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
223 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
224 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
225 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
226 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
227 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
228 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
229 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
230 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
231 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
232 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
233 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
234 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
235 2996887358 Rhizobium sp. R711 Isolate Nodule
236 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
237 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
238 8005258706 Rhizobium sp. R693 Isolate Nodule
239 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
240 8005321885 Rhizobium sp. R72 Isolate Nodule
241 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
242 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
243 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
244 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
245 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
246 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 71.64
Metatranscriptomes 0
Isolates 28.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 27.78
Nodule 16.37
Rhizoplane 5.85
Rhizosphere 28.65
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055528_1017100 3300003790 Bacteria 2530
2 JGI24740J21852_10002648 3300001979 Bacteria 8063
3 JGI25151J46595_10047543 3300003187 Bacteria 1491
4 JGI25165J46597_1000569 3300003214 Bacteria 33265
5 JGI25153J46596_10005912 3300003215 Bacteria 6315
6 JGI25153J46596_10014202 3300003215 Bacteria 3324
7 rootH1_10034953 3300003316 Bacteria 8892
8 rootH2_10072276 3300003320 Bacteria 1610
9 rootH2_10194731 3300003320 Bacteria 1089
10 rootL2_10065397 3300003322 Bacteria 9006
11 rootH1_10139937 3300003323 Bacteria 2700
12 JGI25160J50197_1000005 3300003354 Bacteria 417280
13 JGI25160J50197_1003123 3300003354 Bacteria 7533
14 JGI25161J50226_1001080 3300003374 Bacteria 9210
15 Ga0055526_1000568 3300003771 Bacteria 29103
16 Ga0055526_1007741 3300003771 Bacteria 5514
17 Ga0055526_1013288 3300003771 Bacteria 3496
18 Ga0055526_1042193 3300003771 Bacteria 1127
19 Ga0055524_1000100 3300003775 Bacteria 107020
20 Ga0055524_1001450 3300003775 Bacteria 13572
21 Ga0055524_1005584 3300003775 Bacteria 5588
22 Ga0055536_1002606 3300003781 Bacteria 10050
23 Ga0055528_1000191 3300003790 Bacteria 52111
24 Ga0055528_1000571 3300003790 Bacteria 27871
25 Ga0055528_1008979 3300003790 Bacteria 4221
26 Ga0055528_1020207 3300003790 Bacteria 2170
27 Ga0055528_1036105 3300003790 Bacteria 1186
28 Ga0055540_1023112 3300003792 Bacteria 1573
29 Ga0055531_10010823 3300003794 Bacteria 4484
30 Ga0058692_1042893 3300003856 Bacteria 783
31 Ga0055543_1000764 3300004625 Bacteria 16076
32 Ga0055543_1000863 3300004625 Bacteria 14563
33 Ga0065165_1000002 3300005262 Bacteria 444192
34 Ga0070670_100803830 3300005331 Bacteria 849
35 Ga0070671_100222349 3300005355 Bacteria 1602
36 Ga0070671_100289018 3300005355 Bacteria 1395
37 Ga0070662_100348871 3300005457 Bacteria 1212
38 Ga0070662_100514726 3300005457 Bacteria 999
39 Ga0068856_100023977 3300005614 Bacteria 5935
40 Ga0068856_100914957 3300005614 Bacteria 896
41 Ga0075365_10000612 3300006038 Bacteria 14045
42 Ga0075365_10027137 3300006038 Bacteria 3640
43 Ga0075368_10038168 3300006042 Bacteria 1880
44 Ga0075364_10066189 3300006051 Bacteria 2373
45 Ga0070712_100272616 3300006175 Bacteria 1360
46 Ga0075367_10001133 3300006178 Bacteria 11091
47 Ga0075367_10013545 3300006178 Bacteria 4388
48 Ga0075369_10002303 3300006186 Bacteria 6790
49 Ga0075369_10016734 3300006186 Bacteria 2963
50 Ga0075369_10136979 3300006186 Bacteria 1115
51 Ga0075366_10034639 3300006195 Bacteria 2974
52 Ga0075370_10003421 3300006353 Bacteria 7552
53 Ga0075370_10036441 3300006353 Bacteria 2763
54 Ga0075370_10404502 3300006353 Bacteria 819
55 Ga0075428_100932452 3300006844 Bacteria 920
56 Ga0105251_10021870 3300009011 Bacteria 3331
57 Ga0123342_1019455 3300009766 Bacteria 5178
58 Ga0157373_10204068 3300013100 Bacteria 1394
59 Ga0171463_1002 3300013249 Bacteria 1274851
60 Ga0163163_10068118 3300014325 Bacteria 3541
61 Ga0183363_1030 3300015690 Bacteria 49061
62 Ga0213875_10035528 3300021388 Bacteria 2351
63 Ga0213875_10081601 3300021388 Bacteria 1509
64 Ga0209436_100556 3300025208 Bacteria 16119
65 Ga0209437_100067 3300025233 Bacteria 317685
66 Ga0209646_1008282 3300025246 Bacteria 1676
67 Ga0209129_1003913 3300025258 Bacteria 6188
68 Ga0209129_1017590 3300025258 Bacteria 1398
69 Ga0209233_1000088 3300025261 Bacteria 317980
70 Ga0209565_1020852 3300025263 Bacteria 1378
71 Ga0209673_1000020 3300025273 Bacteria 430653
72 Ga0209673_1000126 3300025273 Bacteria 167949
73 Ga0209673_1000162 3300025273 Bacteria 139078
74 Ga0209673_1004331 3300025273 Bacteria 7654
75 Ga0209130_1000010 3300025284 Bacteria 444920
76 Ga0209675_1001404 3300025291 Bacteria 13969
77 Ga0209676_1039937 3300025292 Bacteria 1327
78 Ga0209025_1000234 3300025294 Bacteria 130341
79 Ga0209025_1008206 3300025294 Bacteria 7553
80 Ga0209564_1000035 3300025295 Bacteria 442446
81 Ga0209564_1000114 3300025295 Bacteria 209934
82 Ga0209564_1000234 3300025295 Bacteria 121532
83 Ga0209564_1000368 3300025295 Bacteria 83910
84 Ga0209564_1009709 3300025295 Bacteria 4534
85 Ga0209758_1000527 3300025297 Bacteria 61122
86 Ga0209758_1001273 3300025297 Bacteria 31189
87 Ga0209758_1007993 3300025297 Bacteria 6999
88 Ga0209758_1010955 3300025297 Bacteria 5331
89 Ga0209256_1000025 3300025299 Bacteria 442449
90 Ga0209256_1000123 3300025299 Bacteria 165547
91 Ga0209256_1001078 3300025299 Bacteria 31546
92 Ga0209256_1004717 3300025299 Bacteria 8348
93 Ga0209256_1007323 3300025299 Bacteria 5487
94 Ga0209256_1009045 3300025299 Bacteria 4455
95 Ga0207426_1000036 3300025302 Bacteria 444920
96 Ga0207426_1000299 3300025302 Bacteria 97846
97 Ga0207426_1000839 3300025302 Bacteria 32462
98 Ga0209051_1009820 3300025303 Bacteria 4898
99 Ga0209051_1012441 3300025303 Bacteria 4116
100 Ga0209051_1013769 3300025303 Bacteria 3822
101 Ga0207644_10215986 3300025931 Bacteria 1518
102 Ga0207706_10374856 3300025933 Bacteria 1235
103 Ga0207706_10484279 3300025933 Bacteria 1069
104 Ga0207711_10470051 3300025941 Bacteria 1171
105 Ga0207678_10092297 3300026067 Bacteria 2588
106 Ga0207702_10947804 3300026078 Bacteria 853
107 Ga0209371_1003033 3300027312 Bacteria 8653
108 Ga0209813_10023202 3300027866 Bacteria 1762
109 Ga0307515_10000556 3300028794 Bacteria 88174
110 Ga0307515_10001904 3300028794 Bacteria 46390
111 Ga0307515_10362302 3300028794 Bacteria 1090
112 Ga0268256_1002046 3300030500 Bacteria 10882
113 Ga0307513_10000685 3300031456 Bacteria 48701
114 Ga0307406_10016446 3300031901 Bacteria 4299
115 Ga0307406_10096093 3300031901 Bacteria 2007
116 Ga0436364_0037955 3300037853 Bacteria 1880
117 Ga0436364_0176803 3300037853 Bacteria 2419
118 Ga0436365_1412305 3300039437 Bacteria 1282
119 Ga0439436_0019056 3300041404 Bacteria 2050
120 Ga0451833_0031600 3300041491 Bacteria 5730
121 Ga0451837_0061716 3300041494 Bacteria 5207
122 Ga0451839_0033262 3300041496 Bacteria 5424
123 Ga0451841_0392562 3300041498 Bacteria 3482
124 Ga0451845_0914410 3300041501 Bacteria 14288
125 Ga0451849_0575369 3300041505 Bacteria 11049
126 Ga0451851_0482345 3300041507 Bacteria 11233
127 Ga0451843_0072390 3300041509 Bacteria 12375
128 Ga0451855_0945207 3300041511 Bacteria 4244
129 Ga0451853_0720237 3300041512 Bacteria 7155
130 Ga0439432_077449 3300042006 Bacteria 1009
131 Ga0439449_0041991 3300042007 Bacteria 1700
132 Ga0495627_037286 3300046453 Bacteria 1508
133 Ga0495638_0000035 3300046460 Bacteria 276385
134 Ga0495638_0048263 3300046460 Bacteria 2666
135 Ga0495605_0001337 3300046474 Bacteria 16311
136 Ga0495605_0151134 3300046474 Bacteria 1036
137 Ga0495585_0027149 3300046492 Bacteria 3268
138 Ga0495585_0027886 3300046492 Bacteria 3223
139 Ga0495585_0145561 3300046492 Bacteria 1238
140 Ga0495607_0019585 3300046501 Bacteria 4296
141 Ga0495607_0074501 3300046501 Bacteria 1884
142 Ga0495607_0131111 3300046501 Bacteria 1304
143 Ga0495607_0224758 3300046501 Bacteria 916
144 Ga0495583_0008148 3300046506 Bacteria 6451
145 Ga0495606_0036046 3300046507 Bacteria 3375
146 Ga0495610_0050528 3300046512 Bacteria 2029
147 Ga0495616_0095474 3300046513 Bacteria 1401
148 Ga0495616_0224628 3300046513 Bacteria 816
149 Ga0495620_0012238 3300046515 Bacteria 4443
150 Ga0495620_0021881 3300046515 Bacteria 3095
151 Ga0495631_0049805 3300046518 Bacteria 1833
152 Ga0495631_0150115 3300046518 Bacteria 1000
153 Ga0495632_0005511 3300046519 Bacteria 8348
154 Ga0495632_0115941 3300046519 Bacteria 1255
155 Ga0495643_0090260 3300046522 Bacteria 1581
156 Ga0495648_0191911 3300046524 Bacteria 1030
157 Ga0495654_0082536 3300046530 Bacteria 1504
158 Ga0495609_0116250 3300046538 Bacteria 1152
159 Ga0495597_0011447 3300046542 Bacteria 4301
160 Ga0495633_0099750 3300046558 Bacteria 1348
161 Ga0495668_0061014 3300046616 Bacteria 2080
162 Ga0495611_0007694 3300046648 Bacteria 4577
163 Ga0495625_0008605 3300046660 Bacteria 8686
164 Ga0495625_0132638 3300046660 Bacteria 1686
165 Ga0495661_0022207 3300046665 Bacteria 4129
166 Ga0495661_0226877 3300046665 Bacteria 965
167 Ga0495588_0051601 3300046674 Bacteria 2119
168 Ga0495670_0109680 3300046691 Bacteria 1427
169 Ga0495670_0128849 3300046691 Bacteria 1318
170 Ga0495649_0182973 3300046694 Bacteria 1093
171 Ga0495589_0176328 3300046794 Bacteria 1015
172 Ga0495600_0021680 3300046809 Bacteria 4118
173 Ga0495660_0120565 3300046810 Bacteria 1327
174 Ga0495636_0064129 3300047318 Bacteria 1558
175 Ga0495672_0078766 3300047320 Bacteria 1842
176 Ga0495676_0107229 3300047321 Bacteria 2057
177 Ga0495686_0008792 3300047472 Bacteria 7358
178 Ga0495686_0049366 3300047472 Bacteria 2648
179 Ga0495626_0146069 3300048091 Bacteria 1000
180 Ga0496100_0100210 3300048903 Bacteria 1995
181 Ga0496103_0127886 3300048906 Bacteria 1621
182 Ga0496104_0006074 3300048907 Bacteria 10596
183 Ga0496104_0039931 3300048907 Bacteria 4396
184 Ga0496105_0056149 3300048908 Bacteria 3251
185 Ga0496105_0057363 3300048908 Bacteria 3215
186 Ga0496105_0752955 3300048908 Bacteria 744
187 Ga0496108_0003597 3300048911 Bacteria 12418
188 Ga0496109_0007779 3300048912 Bacteria 9074
189 Ga0496110_0014107 3300048913 Bacteria 6624
190 Ga0496110_0081143 3300048913 Bacteria 2891
191 Ga0496111_0005920 3300048914 Bacteria 7884
192 Ga0496111_0408508 3300048914 Bacteria 1003
193 Ga0496113_0258766 3300048916 Bacteria 1390
194 Ga0496113_0924844 3300048916 Bacteria 689
195 Ga0496114_0415513 3300048917 Bacteria 1191
196 Ga0496115_0018309 3300048918 Bacteria 5375
197 Ga0496115_0467678 3300048918 Bacteria 1017
198 Ga0496116_0026878 3300048919 Bacteria 4198
199 Ga0496116_0073307 3300048919 Bacteria 2159
200 Ga0496117_0001283 3300048920 Bacteria 37037
201 Ga0496117_0119310 3300048920 Bacteria 1624
202 Ga0496118_0001320 3300048921 Bacteria 37647
203 Ga0496118_0006608 3300048921 Bacteria 12661
204 Ga0496119_0011886 3300048922 Bacteria 7143
205 Ga0496119_0033390 3300048922 Bacteria 3411
206 Ga0496119_0038232 3300048922 Bacteria 3104
207 Ga0496120_0005270 3300048923 Bacteria 10382
208 Ga0496120_0074652 3300048923 Bacteria 1852
209 Ga0496120_0082376 3300048923 Bacteria 1739
210 Ga0496121_0086871 3300048924 Bacteria 2456
211 Ga0496121_0175441 3300048924 Bacteria 1552
212 Ga0496121_0227768 3300048924 Bacteria 1308
213 Ga0496122_0017337 3300048925 Bacteria 6742
214 Ga0496122_0045852 3300048925 Bacteria 3392
215 Ga0496123_0011503 3300048926 Bacteria 7666
216 Ga0496123_0090046 3300048926 Bacteria 1826
217 Ga0496124_0052116 3300048927 Bacteria 3478
218 Ga0496124_0092634 3300048927 Bacteria 2461
219 Ga0496125_0030010 3300048928 Bacteria 4872
220 Ga0496125_0220813 3300048928 Bacteria 1221
221 Ga0496125_0288977 3300048928 Bacteria 1011
222 Ga0496125_0371911 3300048928 Bacteria 845
223 Ga0496126_0101635 3300048929 Bacteria 2515
224 Ga0496126_0106700 3300048929 Bacteria 2444
225 Ga0501033_0003225 3300049570 Bacteria 13493
226 Ga0501035_0012890 3300049822 Bacteria 7720
227 nmdc:mga00v17_140111_c1 3300050491 Bacteria 1550
228 nmdc:mga0yw44_104132_c1 3300050492 Bacteria 1811
229 nmdc:mga06z11_59616_c1 3300050494 Bacteria 1984
230 nmdc:mga04h51_22826_c1 3300050495 Bacteria 1898
231 nmdc:mga07m45_171340_c1 3300050496 Bacteria 1262
232 nmdc:mga0sz30_23624_c1 3300050516 Bacteria 2504
233 nmdc:mga0sz30_28759_c1 3300050516 Bacteria 2288
234 nmdc:mga0sz30_95229_c1 3300050516 Bacteria 1298
235 Ga0500578_0251822 3300053086 Bacteria 1063
236 Ga0500557_006758 3300053105 Bacteria 2625
237 Ga0500569_008459 3300053109 Bacteria 2354
238 Ga0500594_0006763 3300053118 Bacteria 2583
239 Ga0500618_008369 3300053125 Bacteria 2891
240 Ga0500658_0003857 3300053134 Bacteria 5640
241 Ga0500568_0053536 3300053139 Bacteria 1581
242 Ga0500577_0043916 3300053142 Bacteria 1645
243 Ga0500616_0004385 3300053153 Bacteria 10085
244 Ga0500616_0121141 3300053153 Bacteria 1249
245 Ga0500627_0044876 3300053158 Bacteria 1911
246 2508729661 2508501050 Bacteria 9633614
247 2509073814 2508501114 Bacteria 7082538
248 2511131608 2510917022 Bacteria 6504556
249 2511184058 2510917028 Bacteria 6185411
250 2513574381 2513237085 Bacteria 7695351
251 2513596855 2513237088 Bacteria 6927906
252 2513867527 2513237138 Bacteria 7368160
253 2513912203 2513237144 Bacteria 7530820
254 2514590910 2513237351 Bacteria 6968952
255 2515109753 2515075009 Bacteria 7288508
256 2515737851 2515154134 Bacteria 7220242
257 2517079849 2516653085 Bacteria 7346596
258 2535519063 2534681796 Bacteria 7146037
259 2551713753 2551306089 Bacteria 7162724
260 2585201698 2582581294 Bacteria 6626667
261 2585228708 2582581299 Bacteria 6518058
262 2585257321 2582581304 Bacteria 5831370
263 2585275082 2582581307 Bacteria 6597605
264 2585385619 2582581865 Bacteria 6644329
265 2585399788 2582581867 Bacteria 7184437
266 2585525846 2585427526 Bacteria 7258840
267 2585539026 2585427528 Bacteria 6842387
268 2585561204 2585427531 Bacteria 6992870
269 2585820876 2585427590 Bacteria 6824633
270 2585836976 2585427593 Bacteria 7141551
271 2585900069 2585427608 Bacteria 6544331
272 2585908202 2585427609 Bacteria 6667127
273 2587983763 2585428125 Bacteria 6662905
274 2600196501 2599185352 Bacteria 7228948
275 2616552098 2615840698 Bacteria 7319877
276 2643777537 2643221551 Bacteria 3750538
277 2643795985 2643221555 Bacteria 3749717
278 2644002498 2643221599 Bacteria 6292121
279 2644240474 2643221643 Bacteria 5749658
280 2644496497 2643221688 Bacteria 5260751
281 2644733344 2643221734 Bacteria 5365412
282 2671114115 2667528174 Bacteria 6435400
283 2692318050 2690316117 Bacteria 6800650
284 2725945861 2724679232 Bacteria 7646494
285 2725945976 2724679232 Bacteria 7646494
286 2739033410 2738541333 Bacteria 7106503
287 2774871320 2773857925 Bacteria 6472445
288 2792640727 2791355094 Bacteria 7011481
289 2793365196 2791355267 Bacteria 7222458
290 2806049277 2802429633 Bacteria 7341974
291 2806055555 2802429634 Bacteria 7083200
292 2806061419 2802429635 Bacteria 7650140
293 2806069941 2802429636 Bacteria 7597525
294 2806077839 2802429637 Bacteria 7067217
295 2819609998 2818991448 Bacteria 6772224
296 2838667724 2838661181 Bacteria 7385261
297 2838687890 2838686498 Bacteria 7807632
298 2838690897 2838686498 Bacteria 7807632
299 2838733613 2838729681 Bacteria 7400765
300 2838746283 2838742623 Bacteria 7396178
301 2841857728 2841851746 Bacteria 7532261
302 2842115397 2842110456 Bacteria 7656360
303 2842159294 2842156927 Bacteria 6894975
304 2842163793 2842163707 Bacteria 6916235
305 2842183137 2842180545 Bacteria 6888678
306 2842234401 2842229732 Bacteria 7475766
307 2842247923 2842243621 Bacteria 7421798
308 2842259518 2842257432 Bacteria 7401195
309 2842272079 2842271015 Bacteria 7807131
310 2842275372 2842271015 Bacteria 7807131
311 2844459846 2844454524 Bacteria 7952546
312 2844462152 2844454524 Bacteria 7952546
313 2847423444 2847417321 Bacteria 6913799
314 2856357411 2856356410 Bacteria 6297484
315 2881864581 2881861095 Bacteria 7128710
316 2882459509 2882456835 Bacteria 6863978
317 2885316141 2885312484 Bacteria 6415165
318 2885319466 2885318864 Bacteria 6729568
319 2894235057 2894232714 Bacteria 8834183
320 2894241682 2894232714 Bacteria 8834183
321 2919412561 2919408235 Bacteria 6149349
322 2920827743 2920822456 Bacteria 6897201
323 2923560566 2923556063 Bacteria 6793593
324 2924789341 2924784321 Bacteria 7416538
325 2933023567 2933016740 Bacteria 6355406
326 2933589789 2933586486 Bacteria 7667493
327 2935902893 2935901341 Bacteria 7341747
328 2937016635 2937016420 Bacteria 6782579
329 2937846506 2937843397 Bacteria 5256375
330 2967742118 2967742019 Bacteria 6794534
331 2996890283 2996887358 Bacteria 5795980
332 3005413598 3005409236 Bacteria 7188837
333 3005455975 3005452660 Bacteria 5889319
334 8005262466 8005258706 Bacteria 6184835
335 8005307664 8005307578 Bacteria 7395396
336 8005324810 8005321885 Bacteria 5795980
337 8005465792 8005460587 Bacteria 7157962
338 8005546714 8005542996 Bacteria 7077758
339 8005576117 8005570704 Bacteria 6957481
340 8005647823 8005645114 Bacteria 6950293
341 8023685675 8023680758 Bacteria 7729763
342 8046770954 8046767195 Bacteria 7547379
343 Ga0055528_1017100
344 JGI24740J21852_10002648
345 JGI25151J46595_10047543
346 JGI25165J46597_1000569
347 JGI25153J46596_10005912
348 JGI25153J46596_10014202
349 rootH1_10034953
350 rootH2_10072276
351 rootH2_10194731
352 rootL2_10065397
353 rootH1_10139937
354 JGI25160J50197_1000005
355 JGI25160J50197_1003123
356 JGI25161J50226_1001080
357 Ga0055526_1000568
358 Ga0055526_1007741
359 Ga0055526_1013288
360 Ga0055526_1042193
361 Ga0055524_1000100
362 Ga0055524_1001450
363 Ga0055524_1005584
364 Ga0055536_1002606
365 Ga0055528_1000191
366 Ga0055528_1000571
367 Ga0055528_1008979
368 Ga0055528_1020207
369 Ga0055528_1036105
370 Ga0055540_1023112
371 Ga0055531_10010823
372 Ga0058692_1042893
373 Ga0055543_1000764
374 Ga0055543_1000863
375 Ga0065165_1000002
376 Ga0070670_100803830
377 Ga0070671_100222349
378 Ga0070671_100289018
379 Ga0070662_100348871
380 Ga0070662_100514726
381 Ga0068856_100023977
382 Ga0068856_100914957
383 Ga0075365_10000612
384 Ga0075365_10027137
385 Ga0075368_10038168
386 Ga0075364_10066189
387 Ga0070712_100272616
388 Ga0075367_10001133
389 Ga0075367_10013545
390 Ga0075369_10002303
391 Ga0075369_10016734
392 Ga0075369_10136979
393 Ga0075366_10034639
394 Ga0075370_10003421
395 Ga0075370_10036441
396 Ga0075370_10404502
397 Ga0075428_100932452
398 Ga0105251_10021870
399 Ga0123342_1019455
400 Ga0157373_10204068
401 Ga0171463_1002
402 Ga0163163_10068118
403 Ga0183363_1030
404 Ga0213875_10035528
405 Ga0213875_10081601
406 Ga0209436_100556
407 Ga0209437_100067
408 Ga0209646_1008282
409 Ga0209129_1003913
410 Ga0209129_1017590
411 Ga0209233_1000088
412 Ga0209565_1020852
413 Ga0209673_1000020
414 Ga0209673_1000126
415 Ga0209673_1000162
416 Ga0209673_1004331
417 Ga0209130_1000010
418 Ga0209675_1001404
419 Ga0209676_1039937
420 Ga0209025_1000234
421 Ga0209025_1008206
422 Ga0209564_1000035
423 Ga0209564_1000114
424 Ga0209564_1000234
425 Ga0209564_1000368
426 Ga0209564_1009709
427 Ga0209758_1000527
428 Ga0209758_1001273
429 Ga0209758_1007993
430 Ga0209758_1010955
431 Ga0209256_1000025
432 Ga0209256_1000123
433 Ga0209256_1001078
434 Ga0209256_1004717
435 Ga0209256_1007323
436 Ga0209256_1009045
437 Ga0207426_1000036
438 Ga0207426_1000299
439 Ga0207426_1000839
440 Ga0209051_1009820
441 Ga0209051_1012441
442 Ga0209051_1013769
443 Ga0207644_10215986
444 Ga0207706_10374856
445 Ga0207706_10484279
446 Ga0207711_10470051
447 Ga0207678_10092297
448 Ga0207702_10947804
449 Ga0209371_1003033
450 Ga0209813_10023202
451 Ga0307515_10000556
452 Ga0307515_10001904
453 Ga0307515_10362302
454 Ga0268256_1002046
455 Ga0307513_10000685
456 Ga0307406_10016446
457 Ga0307406_10096093
458 Ga0436364_0037955
459 Ga0436364_0176803
460 Ga0436365_1412305
461 Ga0439436_0019056
462 Ga0451833_0031600
463 Ga0451837_0061716
464 Ga0451839_0033262
465 Ga0451841_0392562
466 Ga0451845_0914410
467 Ga0451849_0575369
468 Ga0451851_0482345
469 Ga0451843_0072390
470 Ga0451855_0945207
471 Ga0451853_0720237
472 Ga0439432_077449
473 Ga0439449_0041991
474 Ga0495627_037286
475 Ga0495638_0000035
476 Ga0495638_0048263
477 Ga0495605_0001337
478 Ga0495605_0151134
479 Ga0495585_0027149
480 Ga0495585_0027886
481 Ga0495585_0145561
482 Ga0495607_0019585
483 Ga0495607_0074501
484 Ga0495607_0131111
485 Ga0495607_0224758
486 Ga0495583_0008148
487 Ga0495606_0036046
488 Ga0495610_0050528
489 Ga0495616_0095474
490 Ga0495616_0224628
491 Ga0495620_0012238
492 Ga0495620_0021881
493 Ga0495631_0049805
494 Ga0495631_0150115
495 Ga0495632_0005511
496 Ga0495632_0115941
497 Ga0495643_0090260
498 Ga0495648_0191911
499 Ga0495654_0082536
500 Ga0495609_0116250
501 Ga0495597_0011447
502 Ga0495633_0099750
503 Ga0495668_0061014
504 Ga0495611_0007694
505 Ga0495625_0008605
506 Ga0495625_0132638
507 Ga0495661_0022207
508 Ga0495661_0226877
509 Ga0495588_0051601
510 Ga0495670_0109680
511 Ga0495670_0128849
512 Ga0495649_0182973
513 Ga0495589_0176328
514 Ga0495600_0021680
515 Ga0495660_0120565
516 Ga0495636_0064129
517 Ga0495672_0078766
518 Ga0495676_0107229
519 Ga0495686_0008792
520 Ga0495686_0049366
521 Ga0495626_0146069
522 Ga0496100_0100210
523 Ga0496103_0127886
524 Ga0496104_0006074
525 Ga0496104_0039931
526 Ga0496105_0056149
527 Ga0496105_0057363
528 Ga0496105_0752955
529 Ga0496108_0003597
530 Ga0496109_0007779
531 Ga0496110_0014107
532 Ga0496110_0081143
533 Ga0496111_0005920
534 Ga0496111_0408508
535 Ga0496113_0258766
536 Ga0496113_0924844
537 Ga0496114_0415513
538 Ga0496115_0018309
539 Ga0496115_0467678
540 Ga0496116_0026878
541 Ga0496116_0073307
542 Ga0496117_0001283
543 Ga0496117_0119310
544 Ga0496118_0001320
545 Ga0496118_0006608
546 Ga0496119_0011886
547 Ga0496119_0033390
548 Ga0496119_0038232
549 Ga0496120_0005270
550 Ga0496120_0074652
551 Ga0496120_0082376
552 Ga0496121_0086871
553 Ga0496121_0175441
554 Ga0496121_0227768
555 Ga0496122_0017337
556 Ga0496122_0045852
557 Ga0496123_0011503
558 Ga0496123_0090046
559 Ga0496124_0052116
560 Ga0496124_0092634
561 Ga0496125_0030010
562 Ga0496125_0220813
563 Ga0496125_0288977
564 Ga0496125_0371911
565 Ga0496126_0101635
566 Ga0496126_0106700
567 Ga0501033_0003225
568 Ga0501035_0012890
569 nmdc:mga00v17_140111_c1
570 nmdc:mga0yw44_104132_c1
571 nmdc:mga06z11_59616_c1
572 nmdc:mga04h51_22826_c1
573 nmdc:mga07m45_171340_c1
574 nmdc:mga0sz30_23624_c1
575 nmdc:mga0sz30_28759_c1
576 nmdc:mga0sz30_95229_c1
577 Ga0500578_0251822
578 Ga0500557_006758
579 Ga0500569_008459
580 Ga0500594_0006763
581 Ga0500618_008369
582 Ga0500658_0003857
583 Ga0500568_0053536
584 Ga0500577_0043916
585 Ga0500616_0004385
586 Ga0500616_0121141
587 Ga0500627_0044876
588 2508729661
589 2509073814
590 2511131608
591 2511184058
592 2513574381
593 2513596855
594 2513867527
595 2513912203
596 2514590910
597 2515109753
598 2515737851
599 2517079849
600 2535519063
601 2551713753
602 2585201698
603 2585228708
604 2585257321
605 2585275082
606 2585385619
607 2585399788
608 2585525846
609 2585539026
610 2585561204
611 2585820876
612 2585836976
613 2585900069
614 2585908202
615 2587983763
616 2600196501
617 2616552098
618 2643777537
619 2643795985
620 2644002498
621 2644240474
622 2644496497
623 2644733344
624 2671114115
625 2692318050
626 2725945861
627 2725945976
628 2739033410
629 2774871320
630 2792640727
631 2793365196
632 2806049277
633 2806055555
634 2806061419
635 2806069941
636 2806077839
637 2819609998
638 2838667724
639 2838687890
640 2838690897
641 2838733613
642 2838746283
643 2841857728
644 2842115397
645 2842159294
646 2842163793
647 2842183137
648 2842234401
649 2842247923
650 2842259518
651 2842272079
652 2842275372
653 2844459846
654 2844462152
655 2847423444
656 2856357411
657 2881864581
658 2882459509
659 2885316141
660 2885319466
661 2894235057
662 2894241682
663 2919412561
664 2920827743
665 2923560566
666 2924789341
667 2933023567
668 2933589789
669 2935902893
670 2937016635
671 2937846506
672 2967742118
673 2996890283
674 3005413598
675 3005455975
676 8005262466
677 8005307664
678 8005324810
679 8005465792
680 8005546714
681 8005576117
682 8005647823
683 8023685675
684 8046770954

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02581

TMP-TENI

Thiamine monophosphate synthase

6

180

0.98

Map